BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF007C11

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074970.1|  PREDICTED: elongation factor 1-gamma-like          282   3e-90   Sesamum indicum [beniseed]
gb|AGJ83736.1|  elongation factor 1-gamma-like protein                  270   4e-88   Caragana korshinskii
emb|CBI39244.3|  unnamed protein product                                265   7e-87   Vitis vinifera
ref|NP_001046318.1|  Os02g0220600                                       270   2e-85   
ref|XP_002278756.2|  PREDICTED: elongation factor 1-gamma               270   2e-85   Vitis vinifera
ref|XP_006647077.1|  PREDICTED: elongation factor 1-gamma 2-like        270   3e-85   Oryza brachyantha
ref|XP_007222556.1|  hypothetical protein PRUPE_ppa006233mg             269   4e-85   
gb|ACA50518.1|  elongation factor 1-gamma                               268   2e-84   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046317.1|  Os02g0220500                                       267   2e-84   
ref|XP_008219063.1|  PREDICTED: elongation factor 1-gamma-like          268   2e-84   Prunus mume [ume]
sp|Q6YW46.2|EF1G2_ORYSJ  RecName: Full=Elongation factor 1-gamma ...    267   2e-84   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004294500.1|  PREDICTED: elongation factor 1-gamma-like          267   3e-84   Fragaria vesca subsp. vesca
ref|XP_007041182.1|  Elongation factor 1-gamma 3 isoform 2              263   4e-84   
ref|XP_011099002.1|  PREDICTED: elongation factor 1-gamma 2-like        265   6e-84   Sesamum indicum [beniseed]
ref|XP_007041183.1|  Elongation factor 1-gamma 3 isoform 3              262   2e-83   
gb|KDO42761.1|  hypothetical protein CISIN_1g014592mg                   261   2e-83   Citrus sinensis [apfelsine]
ref|XP_004240589.1|  PREDICTED: elongation factor 1-gamma 2-like        263   6e-83   Solanum lycopersicum
emb|CDP10743.1|  unnamed protein product                                263   1e-82   Coffea canephora [robusta coffee]
ref|XP_010686883.1|  PREDICTED: elongation factor 1-gamma-like          263   1e-82   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI29689.3|  unnamed protein product                                254   2e-82   Vitis vinifera
ref|XP_009418787.1|  PREDICTED: elongation factor 1-gamma 2-like        262   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU28215.1|  hypothetical protein MIMGU_mgv1a007176mg                262   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_006478210.1|  PREDICTED: elongation factor 1-gamma-like          262   2e-82   Citrus sinensis [apfelsine]
gb|ADR70876.1|  eukaryotic translation elongation factor 1B gamma...    261   4e-82   Hevea brasiliensis [jebe]
ref|XP_007041181.1|  Elongation factor 1-gamma 3 isoform 1              261   4e-82   Theobroma cacao [chocolate]
ref|XP_002451782.1|  hypothetical protein SORBIDRAFT_04g007760          261   8e-82   Sorghum bicolor [broomcorn]
gb|KDO42759.1|  hypothetical protein CISIN_1g014592mg                   261   8e-82   Citrus sinensis [apfelsine]
ref|XP_003563720.1|  PREDICTED: elongation factor 1-gamma 3             260   1e-81   Brachypodium distachyon [annual false brome]
ref|XP_009417204.1|  PREDICTED: elongation factor 1-gamma 2-like        260   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006385057.1|  elongation factor 1-gamma 1 family protein         260   1e-81   Populus trichocarpa [western balsam poplar]
ref|XP_008339178.1|  PREDICTED: elongation factor 1-gamma-like          256   1e-81   
gb|KJB47897.1|  hypothetical protein B456_008G046200                    260   2e-81   Gossypium raimondii
ref|XP_010928857.1|  PREDICTED: elongation factor 1-gamma 2             260   2e-81   Elaeis guineensis
ref|XP_006441587.1|  hypothetical protein CICLE_v10020303mg             259   3e-81   Citrus clementina [clementine]
ref|XP_006656177.1|  PREDICTED: elongation factor 1-gamma 3-like        259   4e-81   
gb|AFW76479.1|  elongation factor gamma1                                254   8e-81   
ref|XP_002264400.1|  PREDICTED: elongation factor 1-gamma-like          258   8e-81   Vitis vinifera
emb|CAN75785.1|  hypothetical protein VITISV_021574                     258   9e-81   Vitis vinifera
ref|XP_003571724.1|  PREDICTED: elongation factor 1-gamma 2             258   1e-80   Brachypodium distachyon [annual false brome]
gb|EYU22759.1|  hypothetical protein MIMGU_mgv1a007114mg                258   1e-80   Erythranthe guttata [common monkey flower]
ref|XP_009353791.1|  PREDICTED: elongation factor 1-gamma               258   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_008339412.1|  PREDICTED: elongation factor 1-gamma               258   1e-80   
ref|XP_009362385.1|  PREDICTED: elongation factor 1-gamma-like          258   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_009610261.1|  PREDICTED: elongation factor 1-gamma 2-like ...    257   2e-80   Nicotiana tomentosiformis
gb|AAO72574.1|  elongation factor 1 gamma-like protein                  257   2e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004250641.1|  PREDICTED: elongation factor 1-gamma 2-like ...    256   3e-80   Solanum lycopersicum
ref|XP_004951452.1|  PREDICTED: elongation factor 1-gamma 2-like        256   3e-80   Setaria italica
ref|XP_011028370.1|  PREDICTED: elongation factor 1-gamma 2-like        256   4e-80   Populus euphratica
gb|EEE56572.1|  hypothetical protein OsJ_05923                          258   7e-80   Oryza sativa Japonica Group [Japonica rice]
gb|ABA81876.1|  unknown                                                 255   7e-80   Solanum tuberosum [potatoes]
ref|XP_010272550.1|  PREDICTED: elongation factor 1-gamma-like is...    257   1e-79   Nelumbo nucifera [Indian lotus]
ref|XP_008643919.1|  PREDICTED: uncharacterized protein LOC100381...    255   1e-79   
ref|XP_006431568.1|  hypothetical protein CICLE_v10003566mg             255   1e-79   Citrus clementina [clementine]
ref|XP_010272551.1|  PREDICTED: elongation factor 1-gamma-like is...    254   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_002438602.1|  hypothetical protein SORBIDRAFT_10g022570          254   2e-79   Sorghum bicolor [broomcorn]
ref|XP_008647353.1|  PREDICTED: uncharacterized protein LOC100192...    254   3e-79   
gb|EEC72757.1|  hypothetical protein OsI_06402                          256   3e-79   Oryza sativa Indica Group [Indian rice]
gb|ACG36145.1|  elongation factor 1-gamma 3                             254   3e-79   Zea mays [maize]
ref|XP_006494223.1|  PREDICTED: elongation factor 1-gamma 3-like ...    254   3e-79   Citrus sinensis [apfelsine]
ref|XP_006339362.1|  PREDICTED: elongation factor 1-gamma 2-like ...    254   4e-79   Solanum tuberosum [potatoes]
ref|NP_001057916.1|  Os06g0571400                                       253   5e-79   
ref|XP_008677347.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    253   5e-79   
sp|Q9FUM1.1|EF1G_PRUAV  RecName: Full=Elongation factor 1-gamma; ...    253   6e-79   Prunus avium [gean]
ref|XP_008789739.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    253   6e-79   Phoenix dactylifera
ref|XP_011047878.1|  PREDICTED: elongation factor 1-gamma               253   6e-79   Populus euphratica
ref|XP_009774948.1|  PREDICTED: elongation factor 1-gamma 2-like ...    253   7e-79   Nicotiana sylvestris
gb|ACB72462.1|  elongation factor 1 gamma-like protein                  253   8e-79   Nicotiana tabacum [American tobacco]
ref|XP_010242290.1|  PREDICTED: elongation factor 1-gamma-like          253   8e-79   Nelumbo nucifera [Indian lotus]
gb|EAZ37421.1|  hypothetical protein OsJ_21756                          253   9e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009610260.1|  PREDICTED: elongation factor 1-gamma 2-like ...    253   1e-78   Nicotiana tomentosiformis
ref|XP_004250642.1|  PREDICTED: elongation factor 1-gamma 2-like ...    253   1e-78   Solanum lycopersicum
gb|EMT20600.1|  Elongation factor 1-gamma 2                             252   1e-78   
gb|EEC80835.1|  hypothetical protein OsI_23436                          254   1e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_008804357.1|  PREDICTED: elongation factor 1-gamma 2-like        253   1e-78   Phoenix dactylifera
ref|NP_001148829.1|  elongation factor 1-gamma 3                        252   2e-78   Zea mays [maize]
ref|XP_009759974.1|  PREDICTED: elongation factor 1-gamma 2-like ...    252   2e-78   Nicotiana sylvestris
gb|ACJ84952.1|  unknown                                                 245   2e-78   Medicago truncatula
ref|NP_001151229.1|  elongation factor 1-gamma 2                        251   5e-78   Zea mays [maize]
ref|XP_007222927.1|  hypothetical protein PRUPE_ppa005220mg             252   6e-78   Prunus persica
ref|XP_004966045.1|  PREDICTED: elongation factor 1-gamma 3-like        251   6e-78   Setaria italica
gb|EMS60520.1|  Elongation factor 1-gamma 2                             250   7e-78   Triticum urartu
ref|XP_010030200.1|  PREDICTED: elongation factor 1-gamma               250   1e-77   Eucalyptus grandis [rose gum]
ref|XP_009774942.1|  PREDICTED: elongation factor 1-gamma 2-like ...    249   3e-77   Nicotiana sylvestris
ref|XP_008365338.1|  PREDICTED: elongation factor 1-gamma-like          246   3e-77   
ref|XP_004966044.1|  PREDICTED: elongation factor 1-gamma 3-like        248   4e-77   Setaria italica
ref|XP_010683294.1|  PREDICTED: elongation factor 1-gamma 2-like        248   4e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|ADB11388.1|  gamma class glutathione transferase EF1Bgamma3          248   6e-77   Populus trichocarpa [western balsam poplar]
gb|AIZ68134.1|  translation elongation factor 1-gamma                   248   6e-77   Ornithogalum longebracteatum [sea-onion]
gb|AAO72563.1|  elongation factor 1 gamma-like protein                  248   6e-77   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006339363.1|  PREDICTED: elongation factor 1-gamma 2-like ...    248   8e-77   Solanum tuberosum [potatoes]
ref|XP_009759973.1|  PREDICTED: elongation factor 1-gamma 2-like ...    247   1e-76   Nicotiana sylvestris
ref|XP_008218696.1|  PREDICTED: elongation factor 1-gamma               247   1e-76   Prunus mume [ume]
gb|KJB47886.1|  hypothetical protein B456_008G046300                    243   2e-76   Gossypium raimondii
gb|AGC13156.1|  EF1Bgamma class glutathione S-transferase               240   3e-76   Pinus tabuliformis [southern Chinese pine]
ref|XP_006389499.1|  elongation factor 1-gamma 1 family protein         246   3e-76   
gb|KEH32762.1|  translation elongation factor EF1B, gamma chain         244   2e-75   Medicago truncatula
ref|XP_009355338.1|  PREDICTED: elongation factor 1-gamma               243   4e-75   Pyrus x bretschneideri [bai li]
ref|XP_008456982.1|  PREDICTED: elongation factor 1-gamma-like          243   6e-75   Cucumis melo [Oriental melon]
ref|XP_008352808.1|  PREDICTED: elongation factor 1-gamma-like          243   7e-75   
gb|KHN03584.1|  Elongation factor 1-gamma                               242   1e-74   Glycine soja [wild soybean]
ref|XP_006600242.1|  PREDICTED: elongation factor 1-gamma isoform X1    242   1e-74   
gb|KDP42461.1|  hypothetical protein JCGZ_00258                         242   1e-74   Jatropha curcas
ref|XP_006845799.1|  hypothetical protein AMTR_s00019p00255470          242   2e-74   
gb|AHZ94964.1|  elongation factor 1                                     241   3e-74   Lilium regale
gb|KHG04277.1|  hypothetical protein F383_29497                         241   3e-74   Gossypium arboreum [tree cotton]
gb|KJB47883.1|  hypothetical protein B456_008G046300                    241   3e-74   Gossypium raimondii
gb|ACU24584.1|  unknown                                                 241   3e-74   Glycine max [soybeans]
ref|XP_003540135.1|  PREDICTED: elongation factor 1-gamma-like          241   3e-74   
gb|KHG12420.1|  hypothetical protein F383_17048                         241   4e-74   Gossypium arboreum [tree cotton]
gb|ABK25057.1|  unknown                                                 240   1e-73   Picea sitchensis
ref|XP_002325529.1|  hypothetical protein POPTR_0019s10560g             240   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_010907209.1|  PREDICTED: elongation factor 1-gamma 2-like        239   2e-73   Elaeis guineensis
gb|AHC03515.1|  gamma class glutathione S-transferase                   239   2e-73   Larix kaempferi [karamatsu]
gb|KHN40193.1|  Elongation factor 1-gamma                               239   2e-73   Glycine soja [wild soybean]
ref|XP_010414808.1|  PREDICTED: probable elongation factor 1-gamma 2    233   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010101278.1|  Elongation factor 1-gamma                          240   3e-73   
ref|NP_001241223.1|  uncharacterized protein LOC100787125               238   3e-73   Glycine max [soybeans]
ref|XP_011031541.1|  PREDICTED: elongation factor 1-gamma-like          238   6e-73   Populus euphratica
ref|NP_001242737.1|  uncharacterized protein LOC100810452               237   9e-73   
ref|NP_001235707.1|  elongation factor 1-gamma                          237   1e-72   
ref|XP_010553691.1|  PREDICTED: probable elongation factor 1-gamma 2    237   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_008218698.1|  PREDICTED: elongation factor 1-gamma-like          236   3e-72   Prunus mume [ume]
ref|XP_006392370.1|  hypothetical protein EUTSA_v10023493mg             236   4e-72   Eutrema salsugineum [saltwater cress]
ref|XP_007153909.1|  hypothetical protein PHAVU_003G075200g             236   4e-72   Phaseolus vulgaris [French bean]
ref|XP_009388887.1|  PREDICTED: elongation factor 1-gamma 2-like        231   8e-72   
ref|XP_002892012.1|  hypothetical protein ARALYDRAFT_474857             235   8e-72   
ref|XP_010511351.1|  PREDICTED: probable elongation factor 1-gamma 2    234   9e-72   Camelina sativa [gold-of-pleasure]
dbj|BAH56923.1|  AT1G57720                                              233   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001274793.1|  elongation factor 1-gamma 2-like                   233   3e-71   Solanum tuberosum [potatoes]
ref|XP_004485430.1|  PREDICTED: elongation factor 1-gamma-like is...    233   3e-71   Cicer arietinum [garbanzo]
ref|NP_176084.1|  elongation factor EF-1 gamma subunit                  233   3e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59587.1|  putative elongation factor 1B gamma                     233   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470318.1|  PREDICTED: probable elongation factor 1-gamma 2    232   7e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010544111.1|  PREDICTED: probable elongation factor 1-gamma 2    231   2e-70   Tarenaya hassleriana [spider flower]
gb|AGC13144.1|  EF1Bgamma class glutathione S-transferase               231   4e-70   Pinus tabuliformis [southern Chinese pine]
ref|XP_006302321.1|  hypothetical protein CARUB_v10020374mg             230   4e-70   Capsella rubella
ref|XP_004300001.1|  PREDICTED: elongation factor 1-gamma-like          230   7e-70   Fragaria vesca subsp. vesca
ref|XP_011470423.1|  PREDICTED: elongation factor 1-gamma-like is...    230   2e-69   Fragaria vesca subsp. vesca
emb|CDY22629.1|  BnaC08g42630D                                          227   7e-69   Brassica napus [oilseed rape]
ref|XP_009118302.1|  PREDICTED: probable elongation factor 1-gamma 1    227   7e-69   Brassica rapa
ref|NP_001184949.1|  elongation factor EF-1 gamma subunit               222   8e-69   Arabidopsis thaliana [mouse-ear cress]
gb|EPS67955.1|  elongation factor 1 gamma-like protein                  227   1e-68   Genlisea aurea
ref|XP_003592901.1|  Elongation factor 1-gamma                          226   2e-68   Medicago truncatula
ref|XP_004308137.1|  PREDICTED: elongation factor 1-gamma-like is...    226   3e-68   Fragaria vesca subsp. vesca
emb|CDY20681.1|  BnaC08g13770D                                          228   6e-68   Brassica napus [oilseed rape]
gb|AFK34308.1|  unknown                                                 225   6e-68   Medicago truncatula
ref|XP_003592902.1|  Elongation factor 1-gamma                          224   7e-68   
gb|EMT01475.1|  Elongation factor 1-gamma 2                             229   9e-68   
ref|XP_002889762.1|  hypothetical protein ARALYDRAFT_471063             224   2e-67   
ref|XP_009110814.1|  PREDICTED: probable elongation factor 1-gamma 1    223   2e-67   Brassica rapa
ref|XP_006417552.1|  hypothetical protein EUTSA_v10007759mg             223   3e-67   Eutrema salsugineum [saltwater cress]
gb|KEH34076.1|  translation elongation factor EF1B, gamma chain         222   6e-67   Medicago truncatula
emb|CDY06365.1|  BnaA09g48380D                                          222   6e-67   
ref|XP_010490215.1|  PREDICTED: probable elongation factor 1-gamma 1    222   6e-67   Camelina sativa [gold-of-pleasure]
emb|CDY31074.1|  BnaA08g26240D                                          222   7e-67   Brassica napus [oilseed rape]
ref|XP_010458260.1|  PREDICTED: probable elongation factor 1-gamma 1    222   9e-67   Camelina sativa [gold-of-pleasure]
gb|ACJ85171.1|  unknown                                                 221   1e-66   Medicago truncatula
ref|NP_563848.1|  elongation factor EF-1 gamma subunit                  221   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452241.1|  PREDICTED: elongation factor 1-gamma-like          219   9e-66   Cucumis melo [Oriental melon]
ref|XP_007148576.1|  hypothetical protein PHAVU_006G220100g             219   1e-65   Phaseolus vulgaris [French bean]
ref|XP_010475804.1|  PREDICTED: probable elongation factor 1-gamm...    218   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010475805.1|  PREDICTED: probable elongation factor 1-gamm...    218   3e-65   
gb|KGN56265.1|  hypothetical protein Csa_3G110620                       215   2e-64   Cucumis sativus [cucumbers]
ref|XP_004172027.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    214   2e-64   
ref|XP_004134257.1|  PREDICTED: elongation factor 1-gamma-like          214   2e-64   
gb|KGN56266.1|  hypothetical protein Csa_3G110630                       214   4e-64   Cucumis sativus [cucumbers]
ref|XP_004133719.1|  PREDICTED: elongation factor 1-gamma-like          214   5e-64   
ref|XP_008365322.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    214   8e-64   
gb|KDO42760.1|  hypothetical protein CISIN_1g014592mg                   213   1e-63   Citrus sinensis [apfelsine]
ref|XP_006307657.1|  hypothetical protein CARUB_v10009284mg             214   1e-63   Capsella rubella
ref|XP_001758671.1|  predicted protein                                  213   2e-63   
ref|XP_004155227.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    213   2e-63   
emb|CDX93494.1|  BnaA06g05540D                                          208   1e-61   
ref|XP_009148264.1|  PREDICTED: probable elongation factor 1-gamma 1    208   1e-61   Brassica rapa
ref|XP_008789740.1|  PREDICTED: elongation factor 1-gamma 1 isofo...    206   3e-61   
emb|CDY50887.1|  BnaCnng19790D                                          206   1e-60   Brassica napus [oilseed rape]
ref|XP_001771013.1|  predicted protein                                  206   2e-60   
gb|KEH32761.1|  translation elongation factor EF1B, gamma chain         204   2e-60   Medicago truncatula
gb|AFW76480.1|  elongation factor gamma1                                204   3e-60   
gb|AFW87006.1|  hypothetical protein ZEAMMB73_710904                    201   3e-59   
ref|XP_008452240.1|  PREDICTED: elongation factor 1-gamma-like          202   4e-59   Cucumis melo [Oriental melon]
gb|AFW76477.1|  elongation factor gamma1                                194   2e-57   
ref|XP_002984514.1|  hypothetical protein SELMODRAFT_156635             194   7e-56   Selaginella moellendorffii
ref|XP_002973046.1|  hypothetical protein SELMODRAFT_98733              191   5e-55   
ref|XP_008867564.1|  hypothetical protein H310_04829                    162   7e-44   Aphanomyces invadans
ref|XP_005645852.1|  glutathione S-transferase                          160   6e-43   Coccomyxa subellipsoidea C-169
ref|XP_009825362.1|  hypothetical protein H257_03107                    157   3e-42   Aphanomyces astaci
ref|XP_008605170.1|  hypothetical protein SDRG_01423                    157   3e-42   Saprolegnia diclina VS20
ref|XP_001774148.1|  predicted protein                                  155   2e-41   
ref|XP_009040775.1|  hypothetical protein AURANDRAFT_70385              140   6e-36   Aureococcus anophagefferens
ref|XP_006841161.1|  hypothetical protein AMTR_s00086p00155150          131   3e-35   Amborella trichopoda
ref|XP_009041108.1|  hypothetical protein AURANDRAFT_39051              137   9e-35   Aureococcus anophagefferens
emb|CBJ27519.1|  eukaryotic elongation factor-1 B gamma                 136   2e-34   Ectocarpus siliculosus
ref|XP_009519315.1|  hypothetical protein PHYSODRAFT_284839             136   3e-34   Phytophthora sojae
gb|KDO34814.1|  hypothetical protein SPRG_00875                         135   7e-34   Saprolegnia parasitica CBS 223.65
ref|XP_004341586.1|  elongation factor 1-gamma family protein           134   1e-33   Acanthamoeba castellanii str. Neff
gb|ETI50110.1|  hypothetical protein F443_06278                         129   1e-33   Phytophthora parasitica P1569
ref|XP_004353907.1|  glutathione S-transferase domain-containing ...    134   1e-33   Cavenderia fasciculata
gb|ETP47818.1|  hypothetical protein F442_06319                         129   1e-33   Phytophthora parasitica P10297
emb|CCI44608.1|  unnamed protein product                                133   2e-33   Albugo candida
gb|ETO78833.1|  hypothetical protein F444_06337                         129   2e-33   Phytophthora parasitica P1976
emb|CCA15330.1|  calciumdependent protein 1 putative                    133   3e-33   Albugo laibachii Nc14
ref|XP_008891716.1|  hypothetical protein PPTG_02396                    129   7e-33   Phytophthora parasitica INRA-310
gb|ABB02642.1|  unknown                                                 125   9e-33   Solanum tuberosum [potatoes]
ref|XP_002901767.1|  elongation factor 1-gamma, putative                131   1e-32   Phytophthora infestans T30-4
gb|ETI50094.1|  hypothetical protein F443_06281                         126   1e-32   Phytophthora parasitica P1569
ref|XP_009519320.1|  hypothetical protein PHYSODRAFT_359164             131   1e-32   Phytophthora sojae
gb|ETK89985.1|  hypothetical protein L915_06155                         126   2e-32   Phytophthora parasitica
gb|EFA79702.1|  glutathione S-transferase domain-containing protein     131   2e-32   Heterostelium album PN500
emb|CDY04368.1|  BnaC04g18250D                                          128   2e-32   
gb|ETM49723.1|  hypothetical protein L914_06088                         126   3e-32   Phytophthora parasitica
gb|ETL96579.1|  hypothetical protein L917_05965                         128   9e-32   Phytophthora parasitica
gb|ETP19871.1|  hypothetical protein F441_06281                         128   2e-31   Phytophthora parasitica CJ01A1
gb|ETK89994.1|  hypothetical protein L915_06152                         128   2e-31   Phytophthora parasitica
gb|ETL96570.1|  hypothetical protein L917_05968                         125   3e-31   Phytophthora parasitica
ref|XP_006828297.1|  hypothetical protein AMTR_s00023p00230860          120   3e-31   
gb|EWM21126.1|  elongation factor 1                                     127   4e-31   Nannochloropsis gaditana
ref|XP_005707114.1|  elongation factor EF-1 gamma subunit               130   6e-31   Galdieria sulphuraria
emb|CBK21757.2|  unnamed protein product                                125   1e-30   Blastocystis hominis
ref|XP_008891718.1|  hypothetical protein PPTG_02398                    125   2e-30   Phytophthora parasitica INRA-310
gb|AAL87298.1|  unknown protein                                         124   4e-30   Arabidopsis thaliana [mouse-ear cress]
sp|P12261.3|EF1G_ARTSA  RecName: Full=Elongation factor 1-gamma; ...    124   7e-30   Artemia salina
dbj|GAN05559.1|  hypothetical protein MAM1_0095c05030                   121   8e-30   Mucor ambiguus
ref|NP_001083003.1|  uncharacterized protein LOC100037382               124   8e-30   Danio rerio [leopard danio]
gb|ETM49731.1|  hypothetical protein L914_06086                         118   1e-29   Phytophthora parasitica
gb|EPB85278.1|  hypothetical protein HMPREF1544_07959                   123   1e-29   Mucor circinelloides f. circinelloides 1006PhL
gb|ADV40141.1|  elongation factor-1 gamma                               122   2e-29   Latrodectus hesperus [black widow]
dbj|GAM21220.1|  hypothetical protein SAMD00019534_043950               122   2e-29   Acytostelium subglobosum LB1
ref|XP_005760139.1|  hypothetical protein EMIHUDRAFT_438506             118   2e-29   Emiliania huxleyi CCMP1516
ref|XP_008557385.1|  PREDICTED: elongation factor 1-gamma               122   3e-29   Microplitis demolitor
ref|XP_006392372.1|  hypothetical protein EUTSA_v10023493mg             121   4e-29   
emb|CEI89465.1|  hypothetical protein RMCBS344292_03820                 121   5e-29   Rhizopus microsporus
ref|XP_007439957.1|  PREDICTED: elongation factor 1-gamma-like is...    121   6e-29   Python bivittatus
emb|CEG74026.1|  hypothetical protein RMATCC62417_09299                 121   6e-29   Rhizopus microsporus
ref|XP_007056947.1|  PREDICTED: elongation factor 1-gamma               121   7e-29   Chelonia mydas [green seaturtle]
ref|XP_005988901.1|  PREDICTED: elongation factor 1-gamma-like          121   7e-29   
emb|CEI97373.1|  hypothetical protein RMCBS344292_11508                 121   7e-29   Rhizopus microsporus
ref|XP_011334294.1|  PREDICTED: elongation factor 1-gamma               120   1e-28   
ref|XP_006566786.1|  PREDICTED: elongation factor 1-gamma-like          120   2e-28   
emb|CDS12960.1|  hypothetical protein LRAMOSA05144                      119   2e-28   Lichtheimia ramosa
ref|XP_011162880.1|  PREDICTED: elongation factor 1-gamma               119   2e-28   Solenopsis invicta [imported red fire ant]
gb|EFZ22579.1|  hypothetical protein SINV_13881                         119   2e-28   
ref|XP_006113632.1|  PREDICTED: elongation factor 1-gamma               119   3e-28   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008172336.1|  PREDICTED: elongation factor 1-gamma               119   4e-28   Chrysemys picta bellii
gb|KDR22664.1|  Elongation factor 1-gamma                               119   4e-28   Zootermopsis nevadensis
ref|XP_011152520.1|  PREDICTED: elongation factor 1-gamma               119   4e-28   Harpegnathos saltator
ref|XP_003229963.2|  PREDICTED: elongation factor 1-gamma               119   4e-28   Anolis carolinensis [Carolina anole]
gb|EMP38506.1|  Elongation factor 1-gamma                               120   6e-28   Chelonia mydas [green seaturtle]
ref|XP_011264946.1|  PREDICTED: elongation factor 1-gamma               118   6e-28   Camponotus floridanus
emb|CDH55788.1|  elongation factor 1-gamma                              118   7e-28   Lichtheimia corymbifera JMRC:FSU:9682
gb|EPB91935.1|  hypothetical protein HMPREF1544_01229                   118   9e-28   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_006271018.1|  PREDICTED: elongation factor 1-gamma-like          117   1e-27   
ref|XP_006033236.1|  PREDICTED: elongation factor 1-gamma isoform X1    117   1e-27   
ref|XP_011312957.1|  PREDICTED: elongation factor 1-gamma               116   3e-27   Fopius arisanus
emb|CDH55787.1|  elongation factor 1-gamma                              116   3e-27   Lichtheimia corymbifera JMRC:FSU:9682
gb|ETE60028.1|  Elongation factor 1-gamma                               116   4e-27   Ophiophagus hannah
gb|AJD25298.1|  elongation factor-1 gamma-like protein                  114   4e-27   Plectreurys tristis
gb|KFH74042.1|  hypothetical protein MVEG_01255                         116   5e-27   Mortierella verticillata NRRL 6337
gb|ELK23445.1|  Elongation factor 1-gamma                               116   5e-27   Myotis davidii
gb|ACJ12080.1|  translation elongation factor EF-1 gamma                115   5e-27   Bombina orientalis [Oriental fire-bellied toad]
ref|XP_003487839.1|  PREDICTED: hypothetical protein LOC100743133       119   5e-27   
dbj|BAB29238.3|  unnamed protein product                                113   6e-27   Mus musculus [mouse]
ref|XP_003399098.1|  PREDICTED: hypothetical protein LOC100647544       119   6e-27   
ref|XP_011068058.1|  PREDICTED: elongation factor 1-gamma               115   7e-27   Acromyrmex echinatior
dbj|BAB27948.1|  unnamed protein product                                113   8e-27   Mus musculus [mouse]
ref|XP_007943079.1|  PREDICTED: elongation factor 1-gamma               115   9e-27   Orycteropus afer afer
ref|XP_008210112.1|  PREDICTED: elongation factor 1-gamma               114   1e-26   Nasonia vitripennis
dbj|BAE93064.1|  eukaryotic elongation factor 1 gamma                   114   1e-26   Lethenteron camtschaticum [Japanese lamprey]
ref|XP_006772813.1|  PREDICTED: elongation factor 1-gamma               114   1e-26   Myotis davidii
gb|EFN62393.1|  Elongation factor 1-gamma                               118   2e-26   Camponotus floridanus
dbj|GAN03435.1|  elongation factor 1-gamma family protein               114   2e-26   Mucor ambiguus
dbj|BAC56425.1|  similar to elongation factor-1-gamma                   110   2e-26   Bos taurus [bovine]
ref|XP_006109995.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    114   2e-26   Myotis lucifugus
ref|XP_005857534.1|  PREDICTED: elongation factor 1-gamma               114   2e-26   Myotis brandtii
gb|EPQ02217.1|  Elongation factor 1-gamma                               114   2e-26   Myotis brandtii
ref|XP_003700610.1|  PREDICTED: uncharacterized protein LOC100878621    117   3e-26   
dbj|BAC56575.1|  similar to elongation factor-1-gamma                   110   3e-26   Bos taurus [bovine]
ref|XP_003508788.1|  PREDICTED: elongation factor 1-gamma               114   3e-26   Cricetulus griseus [Chinese hamsters]
ref|XP_011428586.1|  PREDICTED: elongation factor 1-gamma-like          112   3e-26   
ref|XP_002178302.1|  predicted protein                                  113   3e-26   
gb|ABG88952.1|  elongation factor-1 gamma                               113   3e-26   
ref|XP_002901771.1|  elongation factor 1-gamma, putative                113   4e-26   
ref|NP_080283.3|  elongation factor 1-gamma                             113   5e-26   
gb|ERE79389.1|  elongation factor 1-gamma                               113   5e-26   
ref|XP_011505224.1|  PREDICTED: elongation factor 1-gamma               113   5e-26   
gb|AAL23895.1|  elongation factor-like protein                          113   5e-26   
ref|XP_008158973.1|  PREDICTED: elongation factor 1-gamma               112   7e-26   
ref|NP_001004223.1|  elongation factor 1-gamma                          112   7e-26   
dbj|BAE88257.1|  unnamed protein product                                110   8e-26   
ref|XP_010954720.1|  PREDICTED: elongation factor 1-gamma               112   8e-26   
gb|EKC22737.1|  Elongation factor 1-gamma                               110   9e-26   
ref|XP_005351981.1|  PREDICTED: elongation factor 1-gamma               112   1e-25   
sp|P26642.1|EF1GA_XENLA  RecName: Full=Elongation factor 1-gamma-...    112   1e-25   
gb|AAB29957.1|  elongation factor 1 gamma                               112   1e-25   
ref|NP_001079766.1|  elongation factor 1-gamma-A                        112   1e-25   
ref|XP_010730447.1|  PREDICTED: elongation factor 1-gamma               112   1e-25   
ref|XP_002432920.1|  elongation factor 1-gamma, putative                112   1e-25   
ref|XP_006995262.1|  PREDICTED: elongation factor 1-gamma               112   1e-25   
gb|ABS57446.1|  elongation factor 1 gamma                               108   2e-25   
ref|XP_006039986.1|  PREDICTED: elongation factor 1-gamma-like          110   2e-25   
ref|XP_003292098.1|  hypothetical protein DICPUDRAFT_156785             111   2e-25   
ref|XP_001505899.2|  PREDICTED: elongation factor 1-gamma               111   2e-25   
ref|XP_006181822.1|  PREDICTED: elongation factor 1-gamma               111   2e-25   
ref|XP_007526399.1|  PREDICTED: elongation factor 1-gamma               111   2e-25   
ref|XP_004621561.1|  PREDICTED: elongation factor 1-gamma               111   2e-25   
ref|NP_001095173.1|  elongation factor 1-gamma                          111   3e-25   
ref|XP_007462218.1|  PREDICTED: elongation factor 1-gamma               110   3e-25   
ref|XP_006214925.1|  PREDICTED: elongation factor 1-gamma               110   3e-25   
ref|XP_004264257.1|  PREDICTED: elongation factor 1-gamma               110   3e-25   
ref|XP_853577.1|  PREDICTED: elongation factor 1-gamma isoform 1        110   3e-25   
ref|XP_001119776.2|  PREDICTED: elongation factor 1-gamma               110   3e-25   
ref|XP_006730446.1|  PREDICTED: elongation factor 1-gamma               110   4e-25   
sp|Q29387.2|EF1G_PIG  RecName: Full=Elongation factor 1-gamma; Sh...    110   4e-25   
ref|XP_007993749.1|  PREDICTED: elongation factor 1-gamma               110   4e-25   
ref|XP_006875070.1|  PREDICTED: elongation factor 1-gamma               110   4e-25   
ref|XP_005414851.1|  PREDICTED: elongation factor 1-gamma               110   4e-25   
ref|XP_002755470.1|  PREDICTED: elongation factor 1-gamma isoform X1    110   4e-25   
ref|XP_007174472.1|  PREDICTED: elongation factor 1-gamma               110   4e-25   
ref|XP_005331561.1|  PREDICTED: elongation factor 1-gamma               110   4e-25   
ref|XP_003920279.1|  PREDICTED: elongation factor 1-gamma               110   4e-25   
ref|NP_001075254.1|  elongation factor 1-gamma                          110   4e-25   
ref|XP_002925414.1|  PREDICTED: elongation factor 1-gamma               110   4e-25   
ref|XP_008571701.1|  PREDICTED: elongation factor 1-gamma               110   5e-25   
ref|XP_003419695.1|  PREDICTED: elongation factor 1-gamma               110   5e-25   
ref|XP_010383201.1|  PREDICTED: elongation factor 1-gamma               110   5e-25   
ref|XP_008705722.1|  PREDICTED: elongation factor 1-gamma               110   5e-25   
ref|XP_004413812.1|  PREDICTED: elongation factor 1-gamma               110   5e-25   
ref|NP_001182509.1|  eukaryotic translation elongation factor 1 g...    110   5e-25   
ref|XP_004682779.1|  PREDICTED: elongation factor 1-gamma               110   5e-25   
ref|XP_007110004.1|  PREDICTED: elongation factor 1-gamma               110   5e-25   
ref|XP_004656596.1|  PREDICTED: elongation factor 1-gamma               110   5e-25   
ref|XP_006911275.1|  PREDICTED: elongation factor 1-gamma               110   5e-25   
ref|XP_009009109.1|  hypothetical protein HELRODRAFT_105304             110   5e-25   
ref|XP_010852324.1|  PREDICTED: elongation factor 1-gamma               110   6e-25   
ref|NP_001035577.1|  elongation factor 1-gamma                          110   6e-25   
gb|ABF57407.1|  eukaryotic translation elongation factor 1 gamma        110   6e-25   
gb|EFB28168.1|  hypothetical protein PANDA_014932                       110   6e-25   
ref|XP_006043256.1|  PREDICTED: elongation factor 1-gamma               110   6e-25   
ref|XP_005660855.1|  PREDICTED: elongation factor 1-gamma               110   6e-25   
gb|ENN80225.1|  hypothetical protein YQE_03344                          110   6e-25   
gb|AEE62776.1|  unknown                                                 110   6e-25   
gb|ABG88954.1|  elongation factor-1 gamma                               110   6e-25   
ref|XP_005904892.1|  PREDICTED: elongation factor 1-gamma               110   6e-25   
ref|XP_005699833.1|  PREDICTED: elongation factor 1-gamma               110   6e-25   
emb|CEP19706.1|  hypothetical protein                                   110   6e-25   
gb|ABG88957.1|  elongation factor-1 gamma                               109   7e-25   
ref|XP_008060650.1|  PREDICTED: elongation factor 1-gamma isoform X1    110   7e-25   
ref|XP_008530379.1|  PREDICTED: elongation factor 1-gamma               110   7e-25   
gb|ELR49692.1|  Elongation factor 1-gamma                               110   7e-25   
ref|XP_004383908.1|  PREDICTED: elongation factor 1-gamma               109   9e-25   
gb|ABG88953.1|  elongation factor-1 gamma                               109   9e-25   
ref|XP_001366000.1|  PREDICTED: elongation factor 1-gamma               110   9e-25   
emb|CCQ18584.1|  Translation elongation factor EF-1 gamma               109   9e-25   
ref|XP_010631294.1|  PREDICTED: elongation factor 1-gamma isoform X1    109   1e-24   
ref|XP_004437533.1|  PREDICTED: elongation factor 1-gamma               109   1e-24   
ref|XP_010631295.1|  PREDICTED: elongation factor 1-gamma isoform X2    109   1e-24   
ref|XP_005966833.1|  PREDICTED: elongation factor 1-gamma               109   1e-24   
ref|XP_004883303.1|  PREDICTED: elongation factor 1-gamma               109   1e-24   
gb|AAS49527.1|  eukaryotic translation elongation factor 1 gamma        108   1e-24   
ref|XP_008835762.1|  PREDICTED: elongation factor 1-gamma isoform X1    108   1e-24   
gb|EHB02083.1|  Elongation factor 1-gamma                               109   1e-24   
ref|XP_006156649.1|  PREDICTED: elongation factor 1-gamma               109   2e-24   
ref|XP_004644383.1|  PREDICTED: elongation factor 1-gamma-like          108   2e-24   
ref|XP_004646771.1|  PREDICTED: elongation factor 1-gamma               108   2e-24   
ref|XP_003467975.1|  PREDICTED: elongation factor 1-gamma               108   2e-24   
gb|AAH80966.1|  MGC76278 protein                                        108   2e-24   
ref|XP_004770360.1|  PREDICTED: elongation factor 1-gamma isoform X2    109   3e-24   
ref|XP_004449309.1|  PREDICTED: elongation factor 1-gamma               108   3e-24   
gb|ENN82421.1|  hypothetical protein YQE_01203                          108   3e-24   
ref|XP_003828537.1|  PREDICTED: elongation factor 1-gamma               108   3e-24   
ref|NP_001289353.1|  elongation factor 1-gamma                          108   3e-24   
ref|NP_001395.1|  elongation factor 1-gamma                             108   3e-24   
ref|XP_005534461.1|  PREDICTED: elongation factor 1-gamma-like          107   3e-24   
ref|XP_004065457.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    108   3e-24   
gb|AAP36704.1|  Homo sapiens eukaryotic translation elongation fa...    107   4e-24   
gb|AAH07949.2|  EEF1G protein                                           107   4e-24   
ref|XP_002259965.1|  elongation factor 1-gamma                          107   4e-24   
gb|AAL78751.1|  translation elongation factor-1 gamma                   107   4e-24   
emb|CDS05969.1|  hypothetical protein LRAMOSA08497                      107   5e-24   
gb|ACO09775.1|  Elongation factor 1-gamma                               107   5e-24   
ref|XP_010339291.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    107   6e-24   
ref|XP_010900657.1|  PREDICTED: elongation factor 1-gamma               107   6e-24   
gb|EFX73418.1|  hypothetical protein DAPPUDRAFT_200523                  107   6e-24   
ref|XP_003290965.1|  hypothetical protein DICPUDRAFT_49566              107   6e-24   
dbj|BAG61974.1|  unnamed protein product                                107   6e-24   
emb|CDH60277.1|  elongation factor 1 gamma domain-containingprotein     107   6e-24   
ref|XP_008325378.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    107   7e-24   
ref|NP_001133235.1|  elongation factor 1 gamma                          106   8e-24   
ref|XP_004596833.1|  PREDICTED: elongation factor 1-gamma               107   9e-24   
ref|XP_007246522.1|  PREDICTED: elongation factor 1-gamma               106   1e-23   
emb|CDR15964.1|  elongation factor 1-gamma, putative                    106   1e-23   
ref|XP_008281826.1|  PREDICTED: elongation factor 1-gamma               106   1e-23   
gb|AAH13918.1|  Eukaryotic translation elongation factor 1 gamma        106   1e-23   
ref|XP_002610271.1|  hypothetical protein BRAFLDRAFT_115434             106   1e-23   
ref|XP_006781412.1|  PREDICTED: elongation factor 1-gamma-like is...    106   1e-23   
gb|ELW52035.1|  Elongation factor 1-gamma                               108   1e-23   
ref|XP_005723183.1|  PREDICTED: elongation factor 1-gamma-like          106   2e-23   
ref|XP_005913461.1|  PREDICTED: elongation factor 1-gamma-like          106   2e-23   
ref|XP_009244529.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    105   2e-23   
ref|XP_006781411.1|  PREDICTED: elongation factor 1-gamma-like is...    106   2e-23   
ref|XP_004545571.1|  PREDICTED: elongation factor 1-gamma-like          106   2e-23   
ref|XP_004770359.1|  PREDICTED: elongation factor 1-gamma isoform X1    107   2e-23   
gb|ACN10123.1|  Elongation factor 1-gamma                               105   2e-23   
emb|CAF94682.1|  unnamed protein product                                102   2e-23   
gb|ACM08681.1|  Elongation factor 1-gamma                               105   2e-23   
gb|KFO33384.1|  Elongation factor 1-gamma                               105   2e-23   
ref|XP_007565951.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    105   2e-23   
ref|XP_005497725.1|  PREDICTED: elongation factor 1-gamma-like          105   3e-23   
emb|CDS50901.1|  elongation factor 1-gamma, putative                    105   3e-23   
ref|XP_001733005.1|  glutathione S-transferase domain-containing ...    104   4e-23   
ref|XP_003444636.1|  PREDICTED: elongation factor 1-gamma-like          105   4e-23   
ref|NP_001036852.1|  elongation factor 1 gamma                          104   6e-23   
gb|ACH85278.1|  eukaryotic translation elongation factor 1 gamma        104   7e-23   
ref|XP_004073276.1|  PREDICTED: elongation factor 1-gamma               104   7e-23   
ref|XP_008418577.1|  PREDICTED: elongation factor 1-gamma               104   8e-23   
ref|XP_008622446.1|  elongation factor 1-gamma                          103   8e-23   
gb|ABG88919.1|  elongation factor-1 gamma                               103   8e-23   
gb|EUD71702.1|  elongation factor 1-gamma                               103   8e-23   
ref|XP_010704334.1|  elongation factor-1 gamma                          103   8e-23   
gb|ACM09182.1|  Elongation factor 1-gamma                               103   9e-23   
ref|NP_001135112.1|  Elongation factor 1-gamma                          103   9e-23   
ref|XP_745420.1|  elongation factor 1-gamma                             103   9e-23   
gb|ELT98041.1|  hypothetical protein CAPTEDRAFT_173297                  103   9e-23   
ref|XP_005809860.1|  PREDICTED: elongation factor 1-gamma-like          103   1e-22   
ref|XP_004019908.1|  PREDICTED: elongation factor 1-gamma               104   1e-22   
ref|XP_005063341.1|  PREDICTED: uncharacterized protein LOC101830470    104   1e-22   
gb|AJN91131.1|  elongation factor 1-gamma                               103   1e-22   
sp|Q90YC0.1|EF1G_CARAU  RecName: Full=Elongation factor 1-gamma; ...    103   1e-22   
gb|ABG88916.1|  elongation factor-1 gamma                               103   1e-22   
ref|NP_001185679.1|  eukaryotic translation elongation factor 1 g...    103   2e-22   
ref|XP_001562716.1|  elongation factor-1 gamma                          103   2e-22   
ref|XP_009055805.1|  hypothetical protein LOTGIDRAFT_189800             103   2e-22   
ref|XP_003274134.1|  PREDICTED: elongation factor 1-gamma isoform 1     103   2e-22   
ref|XP_002754632.1|  PREDICTED: elongation factor 1-gamma-like          103   2e-22   
gb|EHJ69132.1|  elongation factor 1 gamma                               103   2e-22   
gb|AAU89473.1|  putative translation elongation factor 1 gamma          102   2e-22   
gb|AAH66518.1|  Eef1g protein                                           102   2e-22   
gb|ABG88914.1|  elongation factor-1 gamma                               102   2e-22   
emb|CDO76003.1|  hypothetical protein BN946_scf184780.g10               102   2e-22   
dbj|BAN20579.1|  elongation factor 1 gamma                              102   2e-22   
ref|XP_003970321.1|  PREDICTED: elongation factor 1-gamma-like          102   2e-22   
ref|XP_003274135.1|  PREDICTED: elongation factor 1-gamma isoform 2     103   2e-22   
sp|Q6PE25.1|EF1G_DANRE  RecName: Full=Elongation factor 1-gamma; ...    102   2e-22   
ref|NP_775370.1|  elongation factor 1-gamma                             102   2e-22   
gb|AAH84224.1|  Unknown (protein for MGC:80886)                         102   3e-22   
gb|ABG88915.1|  elongation factor-1 gamma                               102   4e-22   
gb|ABF18271.1|  elongation factor 1-gamma                               102   4e-22   
ref|XP_001661570.1|  AAEL011288-PA                                      102   5e-22   
gb|AAI70047.1|  LOC397861 protein                                       101   6e-22   
gb|KHN39680.1|  Elongation factor 1-gamma                               100   7e-22   
ref|XP_001614168.1|  elongation factor 1-gamma                          101   7e-22   
gb|ETN60121.1|  elongation factor 1-gamma                               101   9e-22   
ref|XP_001865800.1|  elongation factor 1-gamma                          101   9e-22   
ref|XP_008040874.1|  glutathione S-transferase C-terminal-like pr...  99.4    9e-22   
gb|ETB62718.1|  hypothetical protein YYC_00410                          100   9e-22   
ref|XP_001350110.2|  elongation factor 1-gamma, putative                100   9e-22   
gb|ETW47418.1|  hypothetical protein PFMALIP_04497                      100   9e-22   
gb|ETW34692.1|  hypothetical protein PFTANZ_04597                       100   9e-22   
ref|XP_004223626.1|  elongation factor 1-gamma                          100   1e-21   
ref|XP_008060651.1|  PREDICTED: elongation factor 1-gamma isoform X2    100   1e-21   
gb|AAS49528.1|  eukaryotic translation elongation factor 1 gamma        100   1e-21   
gb|KDQ56005.1|  hypothetical protein JAAARDRAFT_180216                  100   1e-21   
gb|EGW02095.1|  Elongation factor 1-gamma                               100   1e-21   
ref|XP_001456169.1|  hypothetical protein                               100   1e-21   
ref|NP_001171816.1|  elongation factor 1-gamma                          100   1e-21   
ref|XP_001809758.1|  PREDICTED: elongation factor 1-gamma               100   1e-21   
ref|XP_010333151.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    100   2e-21   
gb|ABG88951.1|  elongation factor-1 gamma                               100   2e-21   
gb|KFB39640.1|  AGAP000883-PA-like protein                              100   2e-21   
ref|XP_010588872.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    100   2e-21   
ref|XP_006680023.1|  hypothetical protein BATDEDRAFT_37118            99.8    2e-21   
ref|XP_002000755.1|  GI22348                                            100   2e-21   
ref|XP_001996097.1|  GH14004                                            100   3e-21   
ref|XP_682573.1|  hypothetical protein AN9304.2                       97.4    3e-21   
ref|NP_001081481.1|  elongation factor 1-gamma-B                      99.8    3e-21   
gb|ETW55524.1|  hypothetical protein PFUGPA_02286                     99.4    3e-21   
gb|EUR65945.1|  hypothetical protein PFBG_04685                       99.4    3e-21   
ref|XP_001463560.1|  elongation factor-1 gamma                        99.4    4e-21   
emb|CAC35543.1|  elongation factor-1 gamma                            99.4    4e-21   
dbj|BAM17758.1|  elongation factor 1 gamma                            99.4    4e-21   
ref|XP_001681271.1|  elongation factor-1 gamma                        99.0    5e-21   
gb|KDN39258.1|  eEF1-gamma domain-containing protein                  99.0    5e-21   
gb|KFH71059.1|  hypothetical protein MVEG_03905                       99.0    5e-21   
ref|XP_001463559.1|  elongation factor-1 gamma                        99.4    5e-21   
gb|EPY26159.1|  elongation factor 1-gamma                             97.8    5e-21   
ref|XP_003858781.1|  elongation factor-1 gamma                        99.0    7e-21   
ref|XP_001014085.1|  Glutathione S-transferase, N-terminal domain...  98.6    7e-21   
gb|AAI54939.1|  MGC76278 protein                                      98.6    7e-21   
ref|XP_005536940.1|  eukaryotic translation elongation factor 1 g...  98.6    7e-21   
ref|XP_005514198.1|  PREDICTED: elongation factor 1-gamma-like        97.8    7e-21   
gb|EYE98797.1|  translation elongation factor eEF-1B gamma subunit    96.3    8e-21   
ref|XP_727914.1|  elongation factor 1-gamma 1                         98.2    8e-21   
ref|XP_008815696.1|  elongation factor 1-gamma                        98.6    9e-21   
gb|AAM93480.1|  eukaryotic translation elongation factor 1 gamma      97.8    9e-21   
emb|CDO66172.1|  elongation factor 1-gamma, putative                  98.2    9e-21   
gb|ABG88958.1|  elongation factor-1 gamma                             97.4    1e-20   
ref|XP_009269761.1|  Elongation factor 1-gamma                        96.7    1e-20   
gb|EPY28959.1|  elongation factor 1-gamma                             97.8    1e-20   
ref|NP_001020382.1|  translation elongation factor 1B gamma subunit   97.8    1e-20   
gb|EKV18853.1|  Translation elongation factor eEF-1B gamma subuni...  95.5    2e-20   



>ref|XP_011074970.1| PREDICTED: elongation factor 1-gamma-like [Sesamum indicum]
Length=420

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNAFKAL  AEY GVKVELTK+F+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHASSTNKNAFKALIAAEYSGVKVELTKDFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++KPDNPL+GSSLI+YGHIEQW DF+ATEID N A+WLYPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKPDNPLYGSSLIDYGHIEQWMDFSATEIDINIARWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEA IA+LKR+L ALNTHLASNTYLVGH VTLA
Sbjct  121  LYLPPAEEAGIAALKRALEALNTHLASNTYLVGHGVTLA  159



>gb|AGJ83736.1| elongation factor 1-gamma-like protein, partial [Caragana korshinskii]
Length=221

 Score =   270 bits (690),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M+LVLH+ N NKNAFKAL  AEY GV+VEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MSLVLHAGNTNKNAFKALIAAEYSGVQVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GSSLIEY HIEQW DFA+ EIDAN  +W  PR GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIEYAHIEQWIDFASMEIDANIMRWYIPRAGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPPAEEAAISALKRALDALNTHLASNTYLVGHSVTLA  159



>emb|CBI39244.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   265 bits (677),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ N NKNAFKAL  AEY GVKVEL KNF+MGVSNK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNAFKALIAAEYSGVKVELVKNFEMGVSNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GS+LIEY HIEQW DF + EIDAN  +W  PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSTLIEYAHIEQWIDFGSLEIDANILRWFIPRIGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGHS+ L 
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHSLYLG  159



>ref|NP_001046318.1| Os02g0220600 [Oryza sativa Japonica Group]
 sp|Q9ZRI7.1|EF1G1_ORYSJ RecName: Full=Elongation factor 1-gamma 1; Short=EF-1-gamma 1; 
AltName: Full=eEF-1B gamma 1 [Oryza sativa Japonica Group]
 dbj|BAA34206.1| elongation factor 1B gamma [Oryza sativa]
 dbj|BAD17615.1| Elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08232.1| Os02g0220600 [Oryza sativa Japonica Group]
Length=418

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNAFKAL  AEY GVKVEL KNFQMGVSNKTPE+LKMNPIGKVP+LETP
Sbjct  1    MALVLHTFDGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DANT KWL+PRLGF 
Sbjct  61   DGPVFESNAIARYVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWLFPRLGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLA  159



>ref|XP_002278756.2| PREDICTED: elongation factor 1-gamma [Vitis vinifera]
Length=424

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ N NKNAFKAL  AEY GVKVEL KNF+MGVSNK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNAFKALIAAEYSGVKVELVKNFEMGVSNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GS+LIEY HIEQW DF + EIDAN  +W  PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSTLIEYAHIEQWIDFGSLEIDANILRWFIPRIGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHSVTLA  159



>ref|XP_006647077.1| PREDICTED: elongation factor 1-gamma 2-like [Oryza brachyantha]
Length=418

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNAFKAL  AEY GVKVEL KNFQMGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLGF 
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWIDFSATEVDANIGKWLYPRLGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+P  EEAAIA+LKRSL ALNTHLASNTYLVG+SVTLA
Sbjct  121  PYVPMGEEAAIAALKRSLGALNTHLASNTYLVGNSVTLA  159



>ref|XP_007222556.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
 gb|EMJ23755.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
Length=421

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ N NKN FKAL  AEY GVKVEL KNF+MGVSNK+P+FL+MNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNGFKALIAAEYSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPLFGS+LIEY H+EQW DFA  EIDAN  +WL PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLFGSTLIEYAHVEQWIDFATLEIDANILRWLIPRIGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+LTALNTHL+SNTYLVGHSVTLA
Sbjct  121  VYLPPAEEAAISALKRALTALNTHLSSNTYLVGHSVTLA  159



>gb|ACA50518.1| elongation factor 1-gamma [Oryza sativa Japonica Group]
Length=414

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNAFKAL  AEY GVKVEL KNFQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG  
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLA  159



>ref|NP_001046317.1| Os02g0220500 [Oryza sativa Japonica Group]
 dbj|BAD17614.1| putative elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08231.1| Os02g0220500 [Oryza sativa Japonica Group]
 gb|EEC72756.1| hypothetical protein OsI_06401 [Oryza sativa Indica Group]
 gb|EEE56571.1| hypothetical protein OsJ_05922 [Oryza sativa Japonica Group]
Length=414

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNAFKAL  AEY GVKVEL KNFQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG  
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLA  159



>ref|XP_008219063.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=421

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ N NKN FKAL  AEY GVKVEL KNF+MGVSNK+P+FL+MNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNGFKALIAAEYSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPLFGSSLIEY H+EQW DFA  EID+N  +WL PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLFGSSLIEYAHVEQWIDFATLEIDSNILRWLIPRIGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+LTALNTHL+SNTYLVGHS TLA
Sbjct  121  VYLPPAEEAAISALKRALTALNTHLSSNTYLVGHSATLA  159



>sp|Q6YW46.2|EF1G2_ORYSJ RecName: Full=Elongation factor 1-gamma 2; Short=EF-1-gamma 2; 
AltName: Full=eEF-1B gamma 2 [Oryza sativa Japonica Group]
Length=418

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNAFKAL  AEY GVKVEL KNFQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG  
Sbjct  61   DGPVFESNAIARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLA  159



>ref|XP_004294500.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=419

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKN +KAL  AEYCGVKVEL K+FQMGVSNKTPEFLK+NPIGKVPVLETP
Sbjct  1    MALVLHAASNNKNGYKALIAAEYCGVKVELVKDFQMGVSNKTPEFLKLNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K D PLFGSSLIE+  ++QW DFA  EIDAN  +W  PR+GF 
Sbjct  61   DGPVFESNAIARYVARLKADTPLFGSSLIEHALVDQWIDFATLEIDANILRWFIPRIGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI+SLKR+LTALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPPAEEAAISSLKRALTALNTHLASNTYLVGHSVTLA  159



>ref|XP_007041182.1| Elongation factor 1-gamma 3 isoform 2 [Theobroma cacao]
 gb|EOX97013.1| Elongation factor 1-gamma 3 isoform 2 [Theobroma cacao]
Length=309

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNA KAL  A+YC V+V+L +NF+MGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKNNKNAVKALIAAQYCDVEVKLAENFEMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV ++K DNPLFGS+LI+YGHIEQWTDFAA EID N +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRIKADNPLFGSTLIDYGHIEQWTDFAAMEIDVNISKWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            ++LP AEE AIASLKR+L ALNTHLASNTYLVGHSV+LA
Sbjct  121  VHLPLAEEHAIASLKRALDALNTHLASNTYLVGHSVSLA  159



>ref|XP_011099002.1| PREDICTED: elongation factor 1-gamma 2-like [Sesamum indicum]
Length=391

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS + NKNA+KAL  AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGK+PVLETP
Sbjct  1    MALVLHS-SPNKNAYKALVAAEYSGVKVELVKNFEMGVSNKTPEFIKMNPIGKIPVLETP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++ PD  L+GSSLIEYG IEQW DF+ATEID +   WLYPRLG+ 
Sbjct  60   DGPIFESNAIARYVARLNPDGTLYGSSLIEYGQIEQWLDFSATEIDVSLGNWLYPRLGYR  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIASLKR+L ALNTHLASNTYLVGH VTLA
Sbjct  120  VYLPPAEEAAIASLKRALGALNTHLASNTYLVGHGVTLA  158



>ref|XP_007041183.1| Elongation factor 1-gamma 3 isoform 3 [Theobroma cacao]
 gb|EOX97014.1| Elongation factor 1-gamma 3 isoform 3 [Theobroma cacao]
Length=320

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNA KAL  A+YC V+V+L +NF+MGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKNNKNAVKALIAAQYCDVEVKLAENFEMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV ++K DNPLFGS+LI+YGHIEQWTDFAA EID N +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRIKADNPLFGSTLIDYGHIEQWTDFAAMEIDVNISKWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            ++LP AEE AIASLKR+L ALNTHLASNTYLVGHSV+LA
Sbjct  121  VHLPLAEEHAIASLKRALDALNTHLASNTYLVGHSVSLA  159



>gb|KDO42761.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=312

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M LVLH+ N NKNAFKAL  AEY GV VEL KNF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLA  159



>ref|XP_004240589.1| PREDICTED: elongation factor 1-gamma 2-like [Solanum lycopersicum]
Length=413

 Score =   263 bits (673),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LHS + NKNA KAL  AEY GVKV+L K+FQMGVSNKTPEFL+MNPIGKVPVL+TP
Sbjct  1    MALILHSTDNNKNASKALIAAEYTGVKVDLAKDFQMGVSNKTPEFLEMNPIGKVPVLQTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K KP+NPLFGSSLIEY  IEQW DF+ATEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKTKPNNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y+  AEE A+A+LKR+L ALNTHLASNTYLVGH +TLA
Sbjct  121  VYISQAEEGAVAALKRALGALNTHLASNTYLVGHFITLA  159



>emb|CDP10743.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+ + NKNAFKAL  AEY  VKVELTK+FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATSNNKNAFKALIAAEYSDVKVELTKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K+K +NPLFGSSLIEY  IEQW DFA TEID N  +WLYPRLGF+
Sbjct  61   DGPLFESNAIARYVTKLKANNPLFGSSLIEYARIEQWIDFATTEIDVNLGRWLYPRLGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            ++LPPAEEAAIASLKR+L  LN HLASNTYLVG  VTLA
Sbjct  121  VHLPPAEEAAIASLKRALGPLNAHLASNTYLVGDFVTLA  159



>ref|XP_010686883.1| PREDICTED: elongation factor 1-gamma-like [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ N NKNAFKAL  AEY GVKVEL K+F+MGVSN+TPEFLK+NPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNAFKALIAAEYSGVKVELAKDFEMGVSNQTPEFLKINPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYV ++K DNPL+GSSLI+YGHIEQW DFA+ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIQYGHIEQWIDFASLEIDVNILRWFVPRIGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+L A+NTHLA NTYLVG SVTLA
Sbjct  121  VYLPPAEEAAISALKRALEAVNTHLACNTYLVGDSVTLA  159



>emb|CBI29689.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   254 bits (648),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNA+K L  AEY G+KVEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAYKTLIAAEYSGIKVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GSS IEYGHIEQW DFA+ EIDAN   W  PR+G  
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRIGRA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPP EEAAIA+LKR+L ALNTHLASNT+LVGHS+ L 
Sbjct  121  VYLPPFEEAAIAALKRALGALNTHLASNTFLVGHSLYLG  159



>ref|XP_009418787.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=421

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ N NKN FKAL  AEY G++VEL KNF MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGNTNKNGFKALIAAEYSGIQVELVKNFVMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+G SLIEY HIEQW D+A+ EIDAN A+WLYPRLG++
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGCSLIEYAHIEQWIDYASMEIDANLARWLYPRLGYM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YL  AEEAAI+SLKR+L ALNTHLAS+TYLVGHSVTLA
Sbjct  121  PYLAVAEEAAISSLKRALGALNTHLASSTYLVGHSVTLA  159



>gb|EYU28215.1| hypothetical protein MIMGU_mgv1a007176mg [Erythranthe guttata]
Length=416

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNA KAL  AEY G+K+EL K F+MGVSNKTP FLKMNPIGKVPVLETP
Sbjct  1    MALVLHASSTNKNAIKALITAEYSGIKIELAKGFEMGVSNKTPAFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL+GSSLI+YGHIEQW DF+A EIDAN  +WLYPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLYGSSLIDYGHIEQWIDFSANEIDANIGRWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEA I +LKR+L ALN HLAS TYLVGH +TLA
Sbjct  121  LYLPPAEEAGITALKRALEALNIHLASKTYLVGHEITLA  159



>ref|XP_006478210.1| PREDICTED: elongation factor 1-gamma-like [Citrus sinensis]
Length=422

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MA+VLH+ N NKNAFKAL  AEY GV VEL KNF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MAMVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLA  159



>gb|ADR70876.1| eukaryotic translation elongation factor 1B gamma-subunit [Hevea 
brasiliensis]
Length=424

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNAFK+L  AEY GVKVEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKSLIAAEYSGVKVELVENFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+ SSLI+Y HIEQW DFA+ EIDAN   WL PR+GF 
Sbjct  61   DGPLFESNAIARYVTRLKADNPLYDSSLIDYAHIEQWIDFASLEIDANLMAWLRPRMGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPPAEEAAI++LKR L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYLPPAEEAAISALKRGLGALNTHLASNTYLVGHSVTLA  159



>ref|XP_007041181.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
 gb|EOX97012.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
Length=422

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNA KAL  A+YC V+V+L +NF+MGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKNNKNAVKALIAAQYCDVEVKLAENFEMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV ++K DNPLFGS+LI+YGHIEQWTDFAA EID N +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRIKADNPLFGSTLIDYGHIEQWTDFAAMEIDVNISKWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            ++LP AEE AIASLKR+L ALNTHLASNTYLVGHSV+LA
Sbjct  121  VHLPLAEEHAIASLKRALDALNTHLASNTYLVGHSVSLA  159



>ref|XP_002451782.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
 gb|EES04758.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
Length=418

 Score =   261 bits (666),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNAFK L  AEY GVKVEL K+FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSANKNAFKTLIAAEYSGVKVELAKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFA TE+DANT KWLYPR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWMDFATTEVDANTGKWLYPRMGFY  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y    EE+AIA+LKR+  +LNTHLASNT+LVGHSVTLA
Sbjct  121  PYAAVTEESAIAALKRAFGSLNTHLASNTFLVGHSVTLA  159



>gb|KDO42759.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=422

 Score =   261 bits (666),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M LVLH+ N NKNAFKAL  AEY GV VEL KNF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLA  159



>ref|XP_003563720.1| PREDICTED: elongation factor 1-gamma 3 [Brachypodium distachyon]
Length=413

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS + NKNAFKAL  AE+CGVKVEL KNF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEFCGVKVELAKNFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG +FESNAIARYVA+ K D+PLFG SLI+Y H+EQW DF+ATEID N A+WLYPRLG++
Sbjct  61   DGAVFESNAIARYVARSKGDSPLFGGSLIDYAHVEQWMDFSATEIDGNIARWLYPRLGYM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+P +EE  IA LKRSL ALNTHLAS T+LVGHSVTLA
Sbjct  121  PYVPASEEIGIAGLKRSLGALNTHLASTTFLVGHSVTLA  159



>ref|XP_009417204.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=419

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFKAL  AEY GV+VEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAFKALIAAEYSGVQVELAENFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GSSLIEY HIEQW DFA+ E+DAN A+WLYPRLG++
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIEYAHIEQWIDFASMEVDANIARWLYPRLGYM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y   AEE A +SLKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYHAVAEEVAASSLKRALGALNTHLASNTYLVGHSVTLA  159



>ref|XP_006385057.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ABK94655.1| unknown [Populus trichocarpa]
 gb|ADB11387.1| gamma class glutathione transferase EF1Bgamma2 [Populus trichocarpa]
 gb|ERP62854.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=422

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVL++   NKNA+KAL  AEY GV V+L +NF+MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLYAGKTNKNAYKALIAAEYSGVDVKLAENFEMGVTNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFAATEIDA  ++WLYPR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWMDFAATEIDAGISRWLYPRMGFQ  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPPAEEAAI++LKR+L ALN HLASNTYLVGHSVTLA
Sbjct  121  PYLPPAEEAAISALKRALGALNLHLASNTYLVGHSVTLA  159



>ref|XP_008339178.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=313

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKN FKAL  AE+ GVKVEL KNF+MGVSNK+P+FL+MNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNGFKALIAAEFSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP FESNAIARYV ++K DNPL+GSSLIEY  +EQW DFA  EIDAN  +WL P +GF 
Sbjct  61   DGPXFESNAIARYVTRLKADNPLYGSSLIEYARVEQWIDFATLEIDANILRWLIPXIGFS  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPP EEAA+++LKR+LTALNTHL+SNTYLVGHSVTLA
Sbjct  121  VYLPPVEEAAVSALKRALTALNTHLSSNTYLVGHSVTLA  159



>gb|KJB47897.1| hypothetical protein B456_008G046200 [Gossypium raimondii]
Length=421

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNAFKAL  AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYVA+ K +NP+ GS+LI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSTLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPP+EEAAIA+LKR+L ALNTHLASNT+LVGH VTLA
Sbjct  121  VYLPPSEEAAIAALKRALGALNTHLASNTFLVGHFVTLA  159



>ref|XP_010928857.1| PREDICTED: elongation factor 1-gamma 2 [Elaeis guineensis]
Length=419

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+ N NKNAFKAL  AEY GVKVEL KNF++GVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALILHAGNANKNAFKALIAAEYSGVKVELVKNFEIGVSNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYV ++K DNPL+GSSLIEY  IEQW DFA+ EIDAN A+WLYPRLGF+
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIEYARIEQWIDFASMEIDANIARWLYPRLGFL  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   AEE+A+++LKR L ALNTHLA+NTYLVGHSVTLA
Sbjct  121  PFAAVAEESAVSALKRCLGALNTHLATNTYLVGHSVTLA  159



>ref|XP_006441587.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
 gb|ESR54827.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
Length=422

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M LVLH+ N NKNAFK L  AEY GV VEL KNF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MPLVLHAGNTNKNAFKTLITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL GSSLI+  HIEQW DF++ EID N  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLA  159



>ref|XP_006656177.1| PREDICTED: elongation factor 1-gamma 3-like [Oryza brachyantha]
Length=416

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS + NKNAFKAL  AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEYNGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG +FESNAIARYVA++K +N L GSSLIEY HIEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   DGAVFESNAIARYVARLKDNNTLCGSSLIEYAHIEQWMDFSATEVDANIGRWLYPRLGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             ++P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  121  PHVPALEEFAITSLKRSLGALNTHLASNTYLVGHSVTLA  159



>gb|AFW76479.1| elongation factor gamma1 [Zea mays]
Length=309

 Score =   254 bits (650),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFKAL  AEY G+KVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYL  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+   EE AI+SLKRSL ALNTHLASNTYLVGH+VTLA
Sbjct  121  PYVSTTEETAISSLKRSLGALNTHLASNTYLVGHAVTLA  159



>ref|XP_002264400.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
 ref|XP_010657965.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
Length=423

 Score =   258 bits (660),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNA+K L  AEY G+KVEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAYKTLIAAEYSGIKVELVQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GSS IEYGHIEQW DFA+ EIDAN   W  PR+G  
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRIGRA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPP EEAAIA+LKR+L ALNTHLASNT+LVGHSVTLA
Sbjct  121  VYLPPFEEAAIAALKRALGALNTHLASNTFLVGHSVTLA  159



>emb|CAN75785.1| hypothetical protein VITISV_021574 [Vitis vinifera]
Length=423

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNA+K L  AEY G+KVEL +NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGKTNKNAYKTLIAAEYSGIKVELXQNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GSS IEYGHIEQW DFA+ EIDAN   W  PR+G  
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIEQWIDFASLEIDANIGHWFRPRMGRA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPP EEAAIA+LKR+L ALNTHLASNT+LVGHSVTLA
Sbjct  121  VYLPPFEEAAIAALKRALGALNTHLASNTFLVGHSVTLA  159



>ref|XP_003571724.1| PREDICTED: elongation factor 1-gamma 2 [Brachypodium distachyon]
Length=417

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVL++   NKNAFKAL  AEY GVK+EL K+FQMGVSNK+ EFLKMNPIGKVPVLETP
Sbjct  1    MALVLYAGGGNKNAFKALIAAEYSGVKIELVKDFQMGVSNKSAEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYVA+VK DNPL+GSSL+EY HIEQW DF+ATE+D N  KWLYPRLGF 
Sbjct  61   EGPVFESNAIARYVARVKADNPLYGSSLMEYAHIEQWIDFSATEVDVNIGKWLYPRLGFY  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+  +EEA+IA+LKR+L ALNTHLAS+TYLVGHSVTLA
Sbjct  121  HYVAVSEEASIAALKRALGALNTHLASSTYLVGHSVTLA  159



>gb|EYU22759.1| hypothetical protein MIMGU_mgv1a007114mg [Erythranthe guttata]
Length=419

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS + NKNAFK L  AEYCGVK+E+ K FQMGVSNKTPEF+KMNP+GK+PVLETP
Sbjct  1    MALVLHS-SPNKNAFKVLIAAEYCGVKIEMVKEFQMGVSNKTPEFIKMNPLGKIPVLETP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFESNAIARYV +   D+ L+GSSLI+YG IEQW DF+ATEIDA+ A WLYPRLG+ 
Sbjct  60   EGAIFESNAIARYVVRSSADSSLYGSSLIDYGQIEQWMDFSATEIDASIAGWLYPRLGYR  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIASLKR+L ALNTHLASNTYLVGH+VT+A
Sbjct  120  LYLPPAEEAAIASLKRALGALNTHLASNTYLVGHAVTIA  158



>ref|XP_009353791.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
 ref|XP_009353792.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKN +KAL  AEY GVKVEL  NF+MGVSNKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALIAAEYTGVKVELAPNFEMGVSNKTPEYLKLNPIGKVPLLVTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL+GSSLI+Y HIEQW DF   EIDAN +KW YPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLYGSSLIDYAHIEQWIDFGTMEIDANISKWYYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            ++LPPAEEAAI++LKR+L ALNTH+ASNTYLVGHSVTLA
Sbjct  121  VHLPPAEEAAISALKRALGALNTHIASNTYLVGHSVTLA  159



>ref|XP_008339412.1| PREDICTED: elongation factor 1-gamma [Malus domestica]
Length=420

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKN +KAL  AEY GVKVEL  NF MGVSNKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALITAEYTGVKVELAPNFXMGVSNKTPEYLKLNPIGKVPLLVTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL+G SLI+Y HIEQW DF + EIDAN +KW YPRLG+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLYGCSLIDYAHIEQWIDFGSMEIDANISKWYYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+L ALNTH+ASNTYLVGHSVTLA
Sbjct  121  VYLPPAEEAAISALKRALGALNTHIASNTYLVGHSVTLA  159



>ref|XP_009362385.1| PREDICTED: elongation factor 1-gamma-like [Pyrus x bretschneideri]
Length=422

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKN FKAL  AE+ G KVEL KNF+MGVSNK+P+FL MNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNGFKALIAAEFSGAKVELVKNFEMGVSNKSPKFLDMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GSSLIEY  +EQW DFA  EIDAN  +WL PR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIEYARVEQWIDFATLEIDANILRWLIPRIGFS  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPP EEAA+++LKR+LTALNTHL+SNTYLVGHSVTLA
Sbjct  121  VYLPPVEEAAVSALKRALTALNTHLSSNTYLVGHSVTLA  159



>ref|XP_009610261.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=417

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS N NKNA KAL  AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K KPDNPLFGSSLIEY  IEQW DF+ATEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKSKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+PPAEEAA+A+LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  AYIPPAEEAAVAALKRALDALNTHLASNTYLVGHSITLA  159



>gb|AAO72574.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=409

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  143  NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  322
            NKNAFKAL  AEY GVKVEL KNFQMGVSNKTPEFLKMNPIGK+PVLETPDGP+FESNAI
Sbjct  2    NKNAFKALIAAEYSGVKVELVKNFQMGVSNKTPEFLKMNPIGKIPVLETPDGPVFESNAI  61

Query  323  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  502
            ARYV + K DNPL+GSSLIEY HIEQW DF+ATE+DAN  KWLYPRLG   Y+  +EEAA
Sbjct  62   ARYVTRSKADNPLYGSSLIEYAHIEQWNDFSATEVDANIGKWLYPRLGIAPYVAVSEEAA  121

Query  503  IASLKRSLTALNTHLASNTYLVGHSVTLA  589
            IA+LKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  122  IAALKRSLGALNTHLASNTYLVGHSVTLA  150



>ref|XP_004250641.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
lycopersicum]
Length=414

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LHS N NKNA KAL  AEY GVKVE+ K+FQMGVSN TPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHSTNNNKNASKALIAAEYTGVKVEVPKDFQMGVSNNTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   DGPVFESNAIARYVTKLKPNNPLFGSSLIEYSQIEQWNDFSATEVDANIGRWLYPRLGFR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y+P AEEAA+A+LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  VYIPAAEEAAVAALKRALGALNTHLASNTYLVGHSITLA  159



>ref|XP_004951452.1| PREDICTED: elongation factor 1-gamma 2-like [Setaria italica]
Length=417

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNAFKAL  AEY G+KVEL K+FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSGNKNAFKALIAAEYSGIKVELVKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG +FESNAIARYVA++K DNPL+G SLI+Y HIEQW DFAATE+DAN  KWL+PR+GF 
Sbjct  61   DGAVFESNAIARYVARLKADNPLYGFSLIDYAHIEQWMDFAATEVDANIGKWLFPRMGFY  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y   +EE AIA+LKR+L +LNTHLASNT+LVGHSVTLA
Sbjct  121  PYAAVSEETAIAALKRALGSLNTHLASNTFLVGHSVTLA  159



>ref|XP_011028370.1| PREDICTED: elongation factor 1-gamma 2-like [Populus euphratica]
Length=422

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVL++   NKN +KAL  AEY GV V+L +NF+MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLYAGKTNKNGYKALIAAEYSGVDVKLAENFEMGVTNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYV ++K +NPL+GSSLI+Y HIEQW DFAATEIDA  A+WLYPRLGF 
Sbjct  61   DGPIFESNAIARYVTRLKAENPLYGSSLIDYAHIEQWMDFAATEIDAGIARWLYPRLGFQ  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPP EEAAI +LKR+L ALN HLASNTYLVGHSVTLA
Sbjct  121  PYLPPVEEAAITALKRALGALNLHLASNTYLVGHSVTLA  159



>gb|EEE56572.1| hypothetical protein OsJ_05923 [Oryza sativa Japonica Group]
Length=479

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 140/166 (84%), Gaps = 9/166 (5%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            +VLH+ + NKNAFKAL  AEY GVKVEL KNFQMGVSNKTPE+LKMNPIGKVP+LETPDG
Sbjct  55   IVLHTFDGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETPDG  114

Query  299  PIFESNAIARYV---------AKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWL  451
            P+FESNAIARYV          + K DNPL+GSSLIEY HIEQW DF+ATE+DANT KWL
Sbjct  115  PVFESNAIARYVLSSSHFPEVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWL  174

Query  452  YPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +PRLGF  Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  175  FPRLGFAPYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLA  220



>gb|ABA81876.1| unknown [Solanum tuberosum]
Length=413

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LHS N NKN  KAL  AEY GVKV+L K+FQMGVSNKTPEFL+MNPIGKVPVL+T 
Sbjct  1    MALILHSTNNNKNTSKALIAAEYTGVKVDLAKDFQMGVSNKTPEFLEMNPIGKVPVLQTT  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
              P+ ESNAIARYV K KPDNPLFGSSLIEY  IEQW DF+ATE+DAN A+WLYPRLG+ 
Sbjct  61   YEPVLESNAIARYVTKTKPDNPLFGSSLIEYAQIEQWNDFSATEVDANIARWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y+P AEE A+A+LKR+L ALNTHLASNTYLVGH +TLA
Sbjct  121  VYIPQAEEGAVAALKRALGALNTHLASNTYLVGHCITLA  159



>ref|XP_010272550.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Nelumbo 
nucifera]
Length=487

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  107  EAMALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLE  286
            +AM LVLH+ N NKNAFKAL  AEY GV V+L  NF+MGVSNKTP+FLKMNPIGKVPVLE
Sbjct  63   QAMTLVLHAGNTNKNAFKALIAAEYNGVTVKLVPNFEMGVSNKTPQFLKMNPIGKVPVLE  122

Query  287  TPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  466
            TPDGPIFESNAIARYVA++K D PL+GSSLIE+  IEQW DFA+ EIDAN  KW  PR G
Sbjct  123  TPDGPIFESNAIARYVARLKGDTPLYGSSLIEFARIEQWIDFASLEIDANILKWFIPRAG  182

Query  467  FVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            F +YLPPAEEAAI++LKR+L ALN HLASNT+LVGHSVTLA
Sbjct  183  FAVYLPPAEEAAISALKRALDALNKHLASNTFLVGHSVTLA  223



>ref|XP_008643919.1| PREDICTED: uncharacterized protein LOC100381466 isoform X1 [Zea 
mays]
 gb|AFW71313.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=414

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNAFK L  A+Y G+KVEL K+FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSSNKNAFKTLIAADYSGIKVELVKDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K +NPL+GSSLI+Y HIEQW DFAATE+DA+  KWLYPR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKANNPLYGSSLIDYAHIEQWMDFAATEVDASIGKWLYPRMGFY  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y    EE+AIA+LKR+  +LNTHLASNT+LVGHSVTLA
Sbjct  121  PYAAVTEESAIAALKRAFGSLNTHLASNTFLVGHSVTLA  159



>ref|XP_006431568.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
 gb|ESR44808.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
Length=418

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH   ENKN FK L  AEY GV+V+L +NF+MGV+NK+PEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHVGQENKNGFKGLIAAEYAGVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DN L+GSSLI+Y H+EQW DF+A EIDAN ++W+YPRLG++
Sbjct  61   DGPVFESNAIARYVARLKADNQLYGSSLIDYAHVEQWMDFSAMEIDANISRWVYPRLGYM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+P AEE A+A+LKR+L ALN HLASNTYLVGHSVTLA
Sbjct  121  QYIPLAEEGAVAALKRALDALNIHLASNTYLVGHSVTLA  159



>ref|XP_010272551.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Nelumbo 
nucifera]
Length=423

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M LVLH+ N NKNAFKAL  AEY GV V+L  NF+MGVSNKTP+FLKMNPIGKVPVLETP
Sbjct  1    MTLVLHAGNTNKNAFKALIAAEYNGVTVKLVPNFEMGVSNKTPQFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K D PL+GSSLIE+  IEQW DFA+ EIDAN  KW  PR GF 
Sbjct  61   DGPIFESNAIARYVARLKGDTPLYGSSLIEFARIEQWIDFASLEIDANILKWFIPRAGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+L ALN HLASNT+LVGHSVTLA
Sbjct  121  VYLPPAEEAAISALKRALDALNKHLASNTFLVGHSVTLA  159



>ref|XP_002438602.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
 gb|EER89969.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
Length=417

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFKAL  AEY GVKVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGVKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG +FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLGF+
Sbjct  61   DGAVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWVDFAATEVDPGVAWYLYPRLGFI  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y    EE AIASLKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYAHTTEETAIASLKRSLGALNTHLASNTYLVGHSVTLA  159



>ref|XP_008647353.1| PREDICTED: uncharacterized protein LOC100192872 isoform X1 [Zea 
mays]
 gb|AFW76478.1| elongation factor gamma1 [Zea mays]
Length=417

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFKAL  AEY G+KVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYL  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+   EE AI+SLKRSL ALNTHLASNTYLVGH+VTLA
Sbjct  121  PYVSTTEETAISSLKRSLGALNTHLASNTYLVGHAVTLA  159



>gb|EEC72757.1| hypothetical protein OsI_06402 [Oryza sativa Indica Group]
Length=479

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 139/166 (84%), Gaps = 9/166 (5%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            +VLH+ + NKNAFKAL  AEY GVKVEL KNFQMGVSNKTPE+LKMNPIGKVP+LETPDG
Sbjct  55   IVLHTFDGNKNAFKALIAAEYSGVKVELAKNFQMGVSNKTPEYLKMNPIGKVPILETPDG  114

Query  299  PIFESNAIARYV---------AKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWL  451
            P+FESN IARYV          + K DNPL+GSSLIEY HIEQW DF+ATE+DANT KWL
Sbjct  115  PVFESNVIARYVLSSSHFPEVTRSKSDNPLYGSSLIEYAHIEQWIDFSATEVDANTGKWL  174

Query  452  YPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +PRLGF  Y+  +EEAAIA+LKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  175  FPRLGFAPYVAVSEEAAIAALKRSLGALNTHLASNTYLVGHSVTLA  220



>gb|ACG36145.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFKAL  AEY G+KVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYL  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+   EE AI+SLKRSL ALNTHLASNTYLVGH+VTLA
Sbjct  121  PYVSTTEETAISSLKRSLGALNTHLASNTYLVGHAVTLA  159



>ref|XP_006494223.1| PREDICTED: elongation factor 1-gamma 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494224.1| PREDICTED: elongation factor 1-gamma 3-like isoform X2 [Citrus 
sinensis]
 gb|ACP43319.1| translation elongation factor [Citrus maxima]
Length=418

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH   ENKN FK L  AEY GV+V+L +NF+MGV+NK+PEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHVGQENKNGFKGLIAAEYAGVEVKLAENFEMGVTNKSPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DN L GSSLI+Y H+EQW DF+A EIDAN ++WLYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKADNQLCGSSLIDYAHVEQWMDFSAMEIDANISRWLYPRLGYM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+P AEE A+A+LKR+L ALN HLASNTYLVGHSVTLA
Sbjct  121  QYIPLAEEGAVAALKRALDALNIHLASNTYLVGHSVTLA  159



>ref|XP_006339362.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
tuberosum]
Length=416

 Score =   254 bits (648),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  110  AMALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLET  289
            AMAL+LHS N NKNA KAL  AE+ GVKVEL K+FQMGVSN +PEFLKMNPIGKVPVLET
Sbjct  2    AMALILHSTNNNKNASKALIAAEFTGVKVELAKDFQMGVSNNSPEFLKMNPIGKVPVLET  61

Query  290  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
            PDGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLG+
Sbjct  62   PDGPVFESNAIARYVTKLKPNNPLFGSSLIEYAQIEQWNDFSATEVDANIGRWLYPRLGY  121

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +Y+P AEEA +A+LKR+L ALNTHLASNTYLVGH +TLA
Sbjct  122  RVYIPAAEEAVVAALKRALGALNTHLASNTYLVGHLITLA  161



>ref|NP_001057916.1| Os06g0571400 [Oryza sativa Japonica Group]
 sp|Q5Z627.1|EF1G3_ORYSJ RecName: Full=Elongation factor 1-gamma 3; Short=EF-1-gamma 3; 
AltName: Full=eEF-1B gamma 3 [Oryza sativa Japonica Group]
 dbj|BAD61828.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAD61932.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAF19830.1| Os06g0571400 [Oryza sativa Japonica Group]
 dbj|BAG90811.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96325.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH  + NKNAFKAL  AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   EGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYVPVLEEFAITSLKRSLGALNTHLASNTYLVGHSVTLA  159



>ref|XP_008677347.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008677348.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008679834.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 ref|XP_008679835.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 gb|AFW66035.1| elongation factor 1-gamma 2 [Zea mays]
 gb|AFW66036.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M LVLH+ + NKNAFK L  AEY GVKVEL K+FQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MVLVLHANSGNKNAFKTLIAAEYSGVKVELVKDFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFAATEIDAN  KWLYPR+GF 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWIDFAATEIDANIGKWLYPRMGFY  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +    EE+ IA+LKR+L +L+THLASNT+LVGHSVTLA
Sbjct  121  PHAGVVEESTIAALKRALGSLSTHLASNTFLVGHSVTLA  159



>sp|Q9FUM1.1|EF1G_PRUAV RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: 
Full=eEF-1B gamma [Prunus avium]
 gb|AAG17901.1|AF297712_1 translation elongation factor 1-gamma [Prunus avium]
Length=422

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNAFK L VAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP+LETP
Sbjct  1    MALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  PR G+ 
Sbjct  61   DGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGH VTLA
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHFVTLA  159



>ref|XP_008789739.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Phoenix dactylifera]
Length=419

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+ N NKN FKAL  A Y GV+VEL KNF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHAGNTNKNGFKALIAAAYSGVQVELVKNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYV ++K +NPL+GSSLIEY  IEQW DFA+ EIDAN A+WL PRLGFV
Sbjct  61   DGPIFESNAIARYVTRLKAENPLYGSSLIEYARIEQWIDFASMEIDANIARWLLPRLGFV  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   AEE AI +LKRSL ALNTHLA+NTYLVGHSVTLA
Sbjct  121  PFAAVAEEFAITALKRSLGALNTHLATNTYLVGHSVTLA  159



>ref|XP_011047878.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
 ref|XP_011047880.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
Length=421

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+L++   NKNA+K L  AEY GV V+L +NF+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILYAGKTNKNAYKTLIAAEYSGVDVKLAENFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV ++K DNPL+GSSLIEY  IEQW DFAATEIDA  +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRLKADNPLYGSSLIEYARIEQWIDFAATEIDAGISKWLYPRLGYQ  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPPAEEA+I++LKR+L ALN HL SNTYLVGHSVTLA
Sbjct  121  PYLPPAEEASISALKRALGALNLHLTSNTYLVGHSVTLA  159



>ref|XP_009774948.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   253 bits (646),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS + NKNA KAL  AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSGSNNKNALKALIAAEYTGVKVELAKNFEMGVSNKTPEFVKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K+KPDNPLFGSSLIEY  IEQW DF+ATEIDAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIGQWLYPRLGYR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +++PPAEEAA+A+LKR+L ALN HLASNTYLVGHS+TLA
Sbjct  121  VFIPPAEEAAVAALKRALGALNIHLASNTYLVGHSITLA  159



>gb|ACB72462.1| elongation factor 1 gamma-like protein [Nicotiana tabacum]
Length=417

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS + NKNA KAL  AEY G+KVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSGSNNKNAIKALIAAEYTGIKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K+KPDNPLFGSSLIEY  IEQW DF+ATEIDAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIGQWLYPRLGYR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +++PPAEEAA+A+LKR+L ALN HLASNTYLVGHS+TLA
Sbjct  121  VFIPPAEEAAVAALKRALGALNIHLASNTYLVGHSITLA  159



>ref|XP_010242290.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
 ref|XP_010242291.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
Length=424

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M+LVLH+ N NKNAFKAL  AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MSLVLHASNVNKNAFKALIAAEYSGVKVELVPNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF-  469
            DGP+FESNAIARYVA++K D  L+GSSLIEY  +EQW DFA+ E+D N ++WLYPRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDAILYGSSLIEYARVEQWIDFASLEVDTNISRWLYPRLGFG  120

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
              YLPPAEEA+I++LKR+L ALN HLASNTYLVGHS+TLA
Sbjct  121  QPYLPPAEEASISALKRALDALNKHLASNTYLVGHSITLA  160



>gb|EAZ37421.1| hypothetical protein OsJ_21756 [Oryza sativa Japonica Group]
Length=440

 Score =   253 bits (647),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  110  AMALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLET  289
             MALVLH  + NKNAFKAL  AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLET
Sbjct  24   GMALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLET  83

Query  290  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
            P+G +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF
Sbjct  84   PEGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGF  143

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
              Y+P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  144  GPYVPVLEEFAITSLKRSLGALNTHLASNTYLVGHSVTLA  183



>ref|XP_009610260.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=417

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M  VLHS N NKNA KAL  AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MLQVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K KPDNPLFGSSLIEY  IEQW DF+ATEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKSKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIARWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+PPAEEAA+A+LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  AYIPPAEEAAVAALKRALDALNTHLASNTYLVGHSITLA  159



>ref|XP_004250642.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
lycopersicum]
Length=414

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M  +LHS N NKNA KAL  AEY GVKVE+ K+FQMGVSN TPEFLKMNPIGKVPVLETP
Sbjct  1    MLQILHSTNNNKNASKALIAAEYTGVKVEVPKDFQMGVSNNTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   DGPVFESNAIARYVTKLKPNNPLFGSSLIEYSQIEQWNDFSATEVDANIGRWLYPRLGFR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y+P AEEAA+A+LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  VYIPAAEEAAVAALKRALGALNTHLASNTYLVGHSITLA  159



>gb|EMT20600.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=413

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS + NKNAFKAL  AEYCGVKVELTKNF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEYCGVKVELTKNFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG +FESNAIARYVA+ K DN L+G SLIEY  +EQW DF ATE+D N A+WLYPRLG++
Sbjct  61   DGAVFESNAIARYVARSKGDNLLWGGSLIEYARVEQWMDFGATEVDPNIARWLYPRLGYM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y   +EE  IA LKR+L ALNTHLASNT+LVGHSVTLA
Sbjct  121  PYNAQSEEFGIAGLKRALEALNTHLASNTFLVGHSVTLA  159



>gb|EEC80835.1| hypothetical protein OsI_23436 [Oryza sativa Indica Group]
Length=458

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH  + NKNAFKAL  AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF 
Sbjct  61   EGAVFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYVPALEEFAITSLKRSLGALNTHLASNTYLVGHSVTLA  159



>ref|XP_008804357.1| PREDICTED: elongation factor 1-gamma 2-like [Phoenix dactylifera]
Length=461

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  110  AMALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLET  289
            +MAL+LH+ N NKN FKAL  AEY GV+VEL KNF+MGVSNKTPEFLKMNPIGKVPVLET
Sbjct  42   SMALILHAGNTNKNGFKALIAAEYSGVQVELAKNFEMGVSNKTPEFLKMNPIGKVPVLET  101

Query  290  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
            PDGPIFESNAIARYV ++K DNPLFGSSLI+Y  IEQW DFA+ EID N ++WLYPRLG+
Sbjct  102  PDGPIFESNAIARYVTRLKADNPLFGSSLIDYARIEQWIDFASMEIDVNLSRWLYPRLGY  161

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
              +    EE AI++LKRSL AL+THL++NTYLVGHSVTLA
Sbjct  162  FPFTAVGEEFAISALKRSLGALSTHLSTNTYLVGHSVTLA  201



>ref|NP_001148829.1| elongation factor 1-gamma 3 [Zea mays]
 gb|ACG33050.1| elongation factor 1-gamma 3 [Zea mays]
 gb|AFW87009.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFKAL  AEY GVKVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGVKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D     +LYPRLG++
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVGWYLYPRLGYI  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y    EE AIASLKRSL ALNTHLA NTYLVGHSVTLA
Sbjct  121  PYAHTTEETAIASLKRSLGALNTHLALNTYLVGHSVTLA  159



>ref|XP_009759974.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS N NKNA KAL  AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MALVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K+KPDNPLFGSSLI+Y  IEQW DF+ TEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIQYAQIEQWNDFSTTEIDANIARWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+PPAEEAA+A+LKR+L ALNTHLASNTYLVG S+TLA
Sbjct  121  PYIPPAEEAAVAALKRALDALNTHLASNTYLVGESITLA  159



>gb|ACJ84952.1| unknown [Medicago truncatula]
Length=227

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LHS   NKNA+KA   AEY  V+++LT NF+MGVSNKTP+FL MNP+GKVPVLETP
Sbjct  1    MALILHSGEINKNAYKARIAAEYASVQLQLTPNFEMGVSNKTPQFLDMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA+   +N L+GSSLI+Y  IEQW DF++ E+D+N  KWLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVARQNNNNTLYGSSLIQYAQIEQWIDFSSLEVDSNINKWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEE AI  LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPPAEEIAITGLKRALNALNTHLASNTYLVGHSVTLA  159



>ref|NP_001151229.1| elongation factor 1-gamma 2 [Zea mays]
 gb|ACG42059.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   251 bits (640),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M LVLH+ + NKNAFK L  AEY GVKVEL K+FQMGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MVLVLHANSGNKNAFKTLIAAEYSGVKVELVKDFQMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            D P+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DFAATEIDAN  KWLYPR+GF 
Sbjct  61   DDPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWIDFAATEIDANIGKWLYPRMGFY  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +    EE+ IA+LKR+L +L+THLASNT+LVGHSVTLA
Sbjct  121  PHAGVVEESTIAALKRALGSLSTHLASNTFLVGHSVTLA  159



>ref|XP_007222927.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
 gb|EMJ24126.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
Length=472

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  98   F*SEAMALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVP  277
            F ++AMALVLH+   NKNAFK L VAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP
Sbjct  46   FSAKAMALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVP  105

Query  278  VLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  457
            +L TPDGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  P
Sbjct  106  LLVTPDGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRP  165

Query  458  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            R G  +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGH VTLA
Sbjct  166  RFGSAVYLPPAEEAAISALKRALGALNTHLASNTYLVGHFVTLA  209



>ref|XP_004966045.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFKAL  AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGPGNKNAFKALIAAEYSGVKVELTKNFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG IFESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D+  A +LYPRLG++
Sbjct  61   DGAIFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDSGVAWYLYPRLGYI  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y    EE AIASLKR+L +LNTHLAS T+LVGHSVTLA
Sbjct  121  PYAQTTEETAIASLKRALGSLNTHLASKTFLVGHSVTLA  159



>gb|EMS60520.1| Elongation factor 1-gamma 2 [Triticum urartu]
Length=413

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS + NKNAFKAL  AEYCGVKVELTKNF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHSGSGNKNAFKALIAAEYCGVKVELTKNFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG +FESNAIARYVA+ K D+ L+G SLIEY  +EQW DF ATE+D N A+WLYPRLG++
Sbjct  61   DGAVFESNAIARYVARSKGDSLLWGGSLIEYARVEQWMDFGATEVDPNIARWLYPRLGYM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y   +EE  IA LKR+L ALNTHLASNT+LVGHSVTLA
Sbjct  121  PYNAQSEEFGIAGLKRALEALNTHLASNTFLVGHSVTLA  159



>ref|XP_010030200.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 ref|XP_010030201.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 gb|KCW57149.1| hypothetical protein EUGRSUZ_I02782 [Eucalyptus grandis]
Length=419

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALV+H+   NKN +KAL  AEY GVKVEL  NF+MGVSNKTPEF+KMNPIGK+PVLETP
Sbjct  1    MALVVHA-TSNKNVYKALIAAEYTGVKVELAPNFEMGVSNKTPEFIKMNPIGKIPVLETP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL+GSSLI+Y HIEQW DF++ E+DAN   WL PR+G  
Sbjct  60   DGPVFESNAIARYVCRLKADNPLYGSSLIDYAHIEQWIDFSSLEVDANILNWLRPRMGRA  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEA IA+LKR+L ALN HL+SNTYLVGHSVTLA
Sbjct  120  VYLPPAEEAVIAALKRALGALNVHLSSNTYLVGHSVTLA  158



>ref|XP_009774942.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M  VLHS + NKNA KAL  AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MLQVLHSGSNNKNALKALIAAEYTGVKVELAKNFEMGVSNKTPEFVKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K+KPDNPLFGSSLIEY  IEQW DF+ATEIDAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIEYAQIEQWNDFSATEIDANIGQWLYPRLGYR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +++PPAEEAA+A+LKR+L ALN HLASNTYLVGHS+TLA
Sbjct  121  VFIPPAEEAAVAALKRALGALNIHLASNTYLVGHSITLA  159



>ref|XP_008365338.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=331

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKN +KAL VAEY GVKVEL  NF+MGV+NKTPEFLK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALIVAEYSGVKVELAPNFEMGVTNKTPEFLKLNPIGKVPLLVTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL GSSLI+Y  IEQW DF + EIDAN   W  PR+G  
Sbjct  61   DGPIFESNAIARYVARLKXDNPLCGSSLIDYARIEQWIDFGSMEIDANVLNWWVPRMGRR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPPAEE AI+SLKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  AYLPPAEEFAISSLKRALGALNTHLASNTYLVGHSVTLA  159



>ref|XP_004966044.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNA+KAL  AEY GVKVEL KNF+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSFPGNKNAYKALIAAEYSGVKVELNKNFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG +FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A++L+PRLGF+
Sbjct  61   DGAVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWIDFAATEVDPGIARYLFPRLGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+  AEE AIASLKR+L +LNTHLAS T+LVGHSVTLA
Sbjct  121  PYVQTAEETAIASLKRALGSLNTHLASKTFLVGHSVTLA  159



>ref|XP_010683294.1| PREDICTED: elongation factor 1-gamma 2-like [Beta vulgaris subsp. 
vulgaris]
Length=418

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNA+KAL  AEY GVKV++ K+FQMGV+NK+PEFLKMNPIGKVPVL TP
Sbjct  1    MALVLHSGLPNKNAYKALIAAEYSGVKVDVVKDFQMGVTNKSPEFLKMNPIGKVPVLATP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV ++K DNPLFGSS  EY  IEQW DFA+ EIDA+ A+WLYPRLG+ 
Sbjct  61   EGPLFESNAIARYVTRLKADNPLFGSSTYEYALIEQWIDFASLEIDAHIARWLYPRLGYF  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            ++LPPAEE AIA+LKRSL AL+ HLASNTYLVG SVTLA
Sbjct  121  VHLPPAEEGAIAALKRSLEALSKHLASNTYLVGDSVTLA  159



>gb|ADB11388.1| gamma class glutathione transferase EF1Bgamma3 [Populus trichocarpa]
Length=421

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+   NKNA+K L  AEY GV V+L +NF+M V+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHAGKTNKNAYKTLIAAEYSGVDVKLAENFEMRVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV ++K DN L+GSSLIEY  IEQW DFAATEIDA  +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRLKADNHLYGSSLIEYARIEQWIDFAATEIDAGISKWLYPRLGYQ  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPPAEEAAI +LKR+L ALN HL SNTYLVGHSVTLA
Sbjct  121  PYLPPAEEAAIFALKRALGALNLHLTSNTYLVGHSVTLA  159



>gb|AIZ68134.1| translation elongation factor 1-gamma [Ornithogalum saundersiae]
Length=414

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS ++NKNA+K+L  AEY GV+VEL K+FQMGVSNKTPEF+KMNP+GK+PVL+TP
Sbjct  1    MALVLHSTSDNKNAWKSLIAAEYSGVQVELVKDFQMGVSNKTPEFIKMNPLGKIPVLQTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K DNPL GSSLIEY +IEQW DFA TEID++ + WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTRLKADNPLHGSSLIEYANIEQWMDFAVTEIDSSISAWLYPRLGYR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             ++  AEE AIA+LKR+L ALNTHLA+NTYLVGH+VTLA
Sbjct  121  PFIQQAEEIAIANLKRALEALNTHLATNTYLVGHAVTLA  159



>gb|AAO72563.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=413

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            VLH  + NKNAFKAL  AEY GVKVELTKNF+MGVSNKTPEFLKMNP+GK+PVLETP+G 
Sbjct  1    VLHCGSGNKNAFKALIAAEYTGVKVELTKNFEMGVSNKTPEFLKMNPLGKIPVLETPEGA  60

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  481
            +FESNAIARYVA++K ++ L GSSLI+Y HIEQW DF+ATE+DAN  +WLYPRLGF  Y+
Sbjct  61   VFESNAIARYVARLKDNSSLCGSSLIDYSHIEQWMDFSATEVDANIGRWLYPRLGFGPYV  120

Query  482  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            P  EE AI SLKRSL ALNTHLASNTYLVGHSVTLA
Sbjct  121  PVLEEFAITSLKRSLGALNTHLASNTYLVGHSVTLA  156



>ref|XP_006339363.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
tuberosum]
Length=414

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M  +LHS N NKNA KAL  AE+ GVKVEL K+FQMGVSN +PEFLKMNPIGKVPVLETP
Sbjct  1    MLQILHSTNNNKNASKALIAAEFTGVKVELAKDFQMGVSNNSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K+KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPNNPLFGSSLIEYAQIEQWNDFSATEVDANIGRWLYPRLGYR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y+P AEEA +A+LKR+L ALNTHLASNTYLVGH +TLA
Sbjct  121  VYIPAAEEAVVAALKRALGALNTHLASNTYLVGHLITLA  159



>ref|XP_009759973.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M  VLHS N NKNA KAL  AEY GVKVEL KNF+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MLQVLHSTNNNKNASKALIAAEYTGVKVELAKNFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV K+KPDNPLFGSSLI+Y  IEQW DF+ TEIDAN A+WLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVTKLKPDNPLFGSSLIQYAQIEQWNDFSTTEIDANIARWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y+PPAEEAA+A+LKR+L ALNTHLASNTYLVG S+TLA
Sbjct  121  PYIPPAEEAAVAALKRALDALNTHLASNTYLVGESITLA  159



>ref|XP_008218696.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
 ref|XP_008218697.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
Length=422

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNAFK L VAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLVTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESN IARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  PR G  
Sbjct  61   DGPIFESNTIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGHA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGH VTLA
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHFVTLA  159



>gb|KJB47886.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=314

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNAFKAL  AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYVA+ K +NP+ GSSLI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSSLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIA+LKR+L ALNTHLASNT+LVGH VTLA
Sbjct  121  VYLPPAEEAAIAALKRALGALNTHLASNTFLVGHFVTLA  159



>gb|AGC13156.1| EF1Bgamma class glutathione S-transferase, partial [Pinus tabuliformis]
Length=225

 Score =   240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL LH+ + NKNAFKAL  AEY GVKV L  NF+MG   K+PEFLKMNPIGKVPVLETP
Sbjct  1    MALTLHAGSTNKNAFKALISAEYVGVKVSLAPNFEMG-GTKSPEFLKMNPIGKVPVLETP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G +FESNAIARYVA++K  N LFGSS+I+Y H+EQW DF+  EID N  +W YPRLGF 
Sbjct  60   EGAVFESNAIARYVARLKGVNSLFGSSVIDYAHVEQWIDFSTLEIDINITRWFYPRLGFG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEA IA LKRSL ALN+HLA+NTYLVGHS+TLA
Sbjct  120  VYLPPAEEATIAGLKRSLAALNSHLATNTYLVGHSITLA  158



>ref|XP_006389499.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ERP48413.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=421

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+L++   NKNA+K L  AEY GV V+L +NF+M V+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILYAGKTNKNAYKTLIAAEYSGVDVKLAENFEMRVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV ++K DN L+GSSLIEY  IEQW DFAATEIDA  +KWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVTRLKADNHLYGSSLIEYARIEQWIDFAATEIDAGISKWLYPRLGYQ  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPPAEEAAI +LKR+L ALN HL SNTYLVGHSVTLA
Sbjct  121  PYLPPAEEAAIFALKRALGALNLHLTSNTYLVGHSVTLA  159



>gb|KEH32762.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LHS   NKNA+KA   AEY  V+++LT NF+MGVSNKTP+FL MNP+GKVPVLETP
Sbjct  1    MALILHSGEINKNAYKARIAAEYASVQLQLTPNFEMGVSNKTPQFLDMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA+   +N L+GSSLI+Y  IEQW DF++ E+D+N  KWLYPRLG+ 
Sbjct  61   DGPVFESNAIARYVARQNNNNTLYGSSLIQYAQIEQWIDFSSLEVDSNINKWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEE AI  LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPPAEEIAITGLKRALNALNTHLASNTYLVGHSVTLA  159



>ref|XP_009355338.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKN +KAL VAEY GVKVEL  NF+MGV+NKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLHAGKTNKNGYKALIVAEYSGVKVELAPNFEMGVTNKTPEYLKLNPIGKVPLLVTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W   R+G  
Sbjct  61   DGPIFESNAIARYVARLKADNPLCGSSLIDYAHIEQWIDFGSLEIDANILNWWLSRVGRR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPP EEA I++LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  VYLPPDEEATISALKRALGALNTHLASNTYLVGHSVTLA  159



>ref|XP_008456982.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=422

 Score =   243 bits (620),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M LVLH+   NKN+FKAL  AEY GV+V++  +F+MGVSNKTPEF+KMNPIGKVPVLETP
Sbjct  1    MVLVLHAGKTNKNSFKALIAAEYNGVEVKVVPDFEMGVSNKTPEFIKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYVA++K D+PL+GS LI+YGHIEQW +FA+ E+D+N   W  PR+G  
Sbjct  61   NGPIFESNAIARYVARLKADSPLYGSFLIDYGHIEQWIEFASLEVDSNILTWFRPRMGRA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPP EEAAIA+LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  AYLPPVEEAAIAALKRALGALNTHLASNTYLVGHSITLA  159



>ref|XP_008352808.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=424

 Score =   243 bits (620),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            LVLH+ + NKN FKAL  AE+ GVKVEL KNF+MGVSNK+P+FL+MNPIGKVPVLETPDG
Sbjct  5    LVLHAGSTNKNGFKALIAAEFSGVKVELVKNFEMGVSNKSPKFLEMNPIGKVPVLETPDG  64

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
            PIFESNAIARYV ++K DNPL+GSSLIEY  +EQW DFA  EIDAN  +WL P +GF +Y
Sbjct  65   PIFESNAIARYVTRLKADNPLYGSSLIEYARVEQWIDFATLEIDANILRWLIPLIGFSVY  124

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            LPP     I   KR+LTALNTHL+SNTYLVGHSVTLA
Sbjct  125  LPPVSHYCIXXXKRALTALNTHLSSNTYLVGHSVTLA  161



>gb|KHN03584.1| Elongation factor 1-gamma [Glycine soja]
Length=420

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            L+LH+   NKN++K L  AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHAGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
            PIFESNAIARYV ++K DN L+GSSLIEY HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PIFESNAIARYVTRLKGDNTLYGSSLIEYAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  124  LPPAEEAAISALKRALGALNTHLASNTYLVGHSVTLA  160



>ref|XP_006600242.1| PREDICTED: elongation factor 1-gamma isoform X1 [Glycine max]
 gb|AJE59628.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            L+LH+   NKN++K L  AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHAGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
            PIFESNAIARYV ++K DN L+GSSLIEY HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PIFESNAIARYVTRLKGDNTLYGSSLIEYAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  124  LPPAEEAAISALKRALGALNTHLASNTYLVGHSVTLA  160



>gb|KDP42461.1| hypothetical protein JCGZ_00258 [Jatropha curcas]
Length=423

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFK L  AEY GV V+L +NF+MGVSNKTPEFLKMNPIGK+PVLETP
Sbjct  1    MALVLHSGKTNKNAFKTLIAAEYSGVNVKLVENFEMGVSNKTPEFLKMNPIGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYV ++K +NPL GSS  EY  IEQW DFA+ EIDAN   WL PR G  
Sbjct  61   DGPLFESNAIARYVTRLKANNPLLGSSTYEYALIEQWIDFASLEIDANILGWLVPRFGRS  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPPAEE  I++LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYLPPAEEHVISTLKRALNALNTHLASNTYLVGHSVTLA  159



>ref|XP_006845799.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
 gb|ERN07474.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
Length=430

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            +LH+ + NKNAFK L  AEY GV+V+L ++F+MGVSNKTPEFLKMNP+GKVPVLETP GP
Sbjct  11   ILHAGSNNKNAFKPLIAAEYTGVEVKLVESFEMGVSNKTPEFLKMNPMGKVPVLETPKGP  70

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  481
            IFESNAIARYVA++K DN L+GSSL EY  IEQW DFA+ EID +T++W YPRLGF++YL
Sbjct  71   IFESNAIARYVARLKGDNILYGSSLFEYALIEQWIDFASLEIDTHTSRWFYPRLGFMVYL  130

Query  482  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            P  EEAAIA+LKR+L ALNTHLA NTYLVGHSVTLA
Sbjct  131  PLVEEAAIAALKRALGALNTHLALNTYLVGHSVTLA  166



>gb|AHZ94964.1| elongation factor 1, partial [Lilium regale]
Length=405

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +2

Query  143  NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  322
            NKNAFKAL  AEY GVK+EL KNF+MGVSNKTP+FLKMNP+GK+PVLETPDG +FESNAI
Sbjct  1    NKNAFKALIAAEYSGVKIELVKNFEMGVSNKTPDFLKMNPLGKIPVLETPDGAVFESNAI  60

Query  323  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  502
            ARYV + KPDNPL GSSLIEY  IEQW DFA+ EID N  +WLYPRLG+VIY+  AEE A
Sbjct  61   ARYVTRTKPDNPLHGSSLIEYAQIEQWIDFASFEIDINLGRWLYPRLGYVIYIAQAEELA  120

Query  503  IASLKRSLTALNTHLASNTYLVGHSVTLA  589
            I++LKRSL ALNTHLA+ T+LVG SVTLA
Sbjct  121  ISALKRSLGALNTHLATTTFLVGDSVTLA  149



>gb|KHG04277.1| hypothetical protein F383_29497 [Gossypium arboreum]
Length=421

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNAFKAL  AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYVA++K +NP+ GS+LI+YGHIEQW DFAA EIDAN AKW YPRLG+ 
Sbjct  61   EGPVFESNAIARYVARLKVNNPICGSTLIDYGHIEQWIDFAAMEIDANIAKWFYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIA+LKR+L ALNTHLASNT+LVGH+VTLA
Sbjct  121  VYLPPAEEAAIAALKRALGALNTHLASNTFLVGHAVTLA  159



>gb|KJB47883.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47887.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47888.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=421

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNAFKAL  AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALVLHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYVA+ K +NP+ GSSLI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSSLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIA+LKR+L ALNTHLASNT+LVGH VTLA
Sbjct  121  VYLPPAEEAAIAALKRALGALNTHLASNTFLVGHFVTLA  159



>gb|ACU24584.1| unknown [Glycine max]
Length=418

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+   NKNAFK L  AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKTNKNAFKTLIAAEYSGVQVELAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DN LF SS I+  HI+QW DF++ EIDAN  K L PRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDNALFSSSAIDNAHIDQWIDFSSLEIDANLMKLLLPRLGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPP EE A ++LKR+  ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYLPPVEEGANSALKRAFEALNTHLASNTYLVGHSVTLA  159



>ref|XP_003540135.1| PREDICTED: elongation factor 1-gamma-like [Glycine max]
 gb|KHN11054.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59626.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=418

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+   NKNAFK L  AEY GV+VEL  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKTNKNAFKTLIAAEYSGVQVELAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DN LF SS I+  HI+QW DF++ EIDAN  K L PRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDNALFSSSAIDNAHIDQWIDFSSLEIDANLMKLLLPRLGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPP EE A ++LKR+  ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYLPPVEEGANSALKRAFEALNTHLASNTYLVGHSVTLA  159



>gb|KHG12420.1| hypothetical protein F383_17048 [Gossypium arboreum]
Length=421

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+   NKNAFKAL  AEY GV+V++ +NF+MGVSNKTPEF+KMNP+GKVPVLETP
Sbjct  1    MALILHAGKTNKNAFKALIAAEYSGVQVKMVENFEMGVSNKTPEFIKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYVA+ K +NP+ GS+LI+YGHIEQW DFAA EIDAN AKWLYPRLG+ 
Sbjct  61   EGPVFESNAIARYVARSKVNNPICGSTLIDYGHIEQWIDFAAMEIDANIAKWLYPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIA+LKR+L ALNTHLASNT+LVGH+VTLA
Sbjct  121  VYLPPAEEAAIAALKRALGALNTHLASNTFLVGHAVTLA  159



>gb|ABK25057.1| unknown [Picea sitchensis]
Length=424

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL LH+ + NKNAFKAL  AEY GVK+ L  NF+MGV+NK+ +FL MNPIGKVPVLETP
Sbjct  1    MALTLHAGHTNKNAFKALIAAEYVGVKINLAPNFEMGVTNKSQKFLSMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G +FESNAIARYVA++K DN LFGSSLI+YGH+EQW DF++ EID N  +W +PR+G  
Sbjct  61   EGAVFESNAIARYVARLKDDNSLFGSSLIDYGHVEQWIDFSSLEIDINIMRWYFPRMGHG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEA IA LKR L ALN+HLA+NTYLVGHS+TLA
Sbjct  121  LYLPPAEEATIAGLKRGLAALNSHLATNTYLVGHSITLA  159



>ref|XP_002325529.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|EEE99910.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|ADB11386.1| gamma class glutathione transferase EF1Bgamma1 [Populus trichocarpa]
Length=426

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNA K L  AEY GV+VEL KNF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNALKTLIAAEYSGVQVELVKNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYV ++K DNPL+GSSLIEY  IEQW DFA  EIDAN  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLIEYARIEQWIDFATLEIDANILRWFIPRIGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIA+LKR+LTALNTHL+++TYLVGHS+TLA
Sbjct  121  VYLPPAEEAAIAALKRALTALNTHLSTSTYLVGHSLTLA  159



>ref|XP_010907209.1| PREDICTED: elongation factor 1-gamma 2-like [Elaeis guineensis]
Length=419

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+L++ + NKN FKAL  AE  GV+VEL KNF+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALILYAGSTNKNGFKALIAAECSGVQVELAKNFEMGVSNKTPEFLKMNPMGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPI ESNAIARYV ++K DNPLFG SLI+Y  IEQW DFA+ EIDAN + WLYPR+G++
Sbjct  61   DGPISESNAIARYVTRLKADNPLFGYSLIDYARIEQWIDFASIEIDANISWWLYPRMGYI  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +    EE AI++LKRSL ALNTHL++NTYLVGHSVTLA
Sbjct  121  PFTAVVEEFAISALKRSLGALNTHLSTNTYLVGHSVTLA  159



>gb|AHC03515.1| gamma class glutathione S-transferase [Larix kaempferi]
Length=422

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL LH+ N NKNAFKAL  AEY GVK+ L  NF+MGV+NK+PEFL MNPIGKVPVLETP
Sbjct  1    MALTLHAGNGNKNAFKALIAAEYVGVKIGLAPNFEMGVTNKSPEFLNMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G +FESNAIARYVA++K DN LFG SLI+  H+EQW DF++ EID N  +W +PRLG+ 
Sbjct  61   EGTVFESNAIARYVARLKGDNTLFGFSLIDCAHVEQWIDFSSLEIDINITRWYFPRLGYG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEA IA LKR L ALN HLA+NTYLVGHS+TLA
Sbjct  121  LYLPPAEEATIAGLKRGLVALNLHLATNTYLVGHSITLA  159



>gb|KHN40193.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59625.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            L+LH    NKN++K L  AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHGGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
            P+FESNAIARYV ++K DN L+GSSLIE+ HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PVFESNAIARYVTQLKGDNTLYGSSLIEHAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  124  LPPAEEAAISALKRALAALNTHLASNTYLVGHSVTLA  160



>ref|XP_010414808.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=244

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK AFKAL  AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALVAAEYAGVKIEEAADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFESNAIARYV++   +N L GSSLIEY  IEQW DF++ EIDAN  KW  PRLG+ 
Sbjct  61   EGAIFESNAIARYVSRKNGENSLNGSSLIEYAQIEQWIDFSSLEIDANMLKWFAPRLGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLA  159



>ref|XP_010101278.1| Elongation factor 1-gamma [Morus notabilis]
 gb|EXB88213.1| Elongation factor 1-gamma [Morus notabilis]
Length=460

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 132/172 (77%), Gaps = 14/172 (8%)
 Frame = +2

Query  116  ALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPD  295
            + VL++ N NKN FK L  AEY GVK+EL KNF+MG+SNKTPEFLKMNPIGKVPVL+TPD
Sbjct  21   SWVLYAGNTNKNGFKVLIAAEYSGVKIELVKNFEMGISNKTPEFLKMNPIGKVPVLQTPD  80

Query  296  GPIFESNAIARY--------------VAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDA  433
            GPIFESNAIARY                 +K DNPLFGSSLI+Y H+EQW DFA  EID 
Sbjct  81   GPIFESNAIARYGENKLRIPYSAYENFTHLKADNPLFGSSLIDYAHVEQWIDFATLEIDT  140

Query  434  NTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            N  +W  PR+GF +YLPPAEEA IA+LKR+L ALNT+LASNTYLVGHS TLA
Sbjct  141  NILRWFIPRIGFSVYLPPAEEATIAALKRALGALNTYLASNTYLVGHSATLA  192



>ref|NP_001241223.1| uncharacterized protein LOC100787125 [Glycine max]
 gb|ACU24574.1| unknown [Glycine max]
 gb|AJE59627.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=419

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+   NKNAFK L  AEY GV+VEL  NF+MGVSN+TPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKANKNAFKTLIAAEYSGVQVELAPNFEMGVSNRTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DN LF SS I+  HI+QW DF++ EIDAN  K   PRLGF 
Sbjct  61   DGPVFESNAIARYVARLKGDNALFSSSAIDNAHIDQWIDFSSLEIDANIMKLYLPRLGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPP EE A ++LKR+  ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYLPPVEEGANSALKRAFEALNTHLASNTYLVGHSVTLA  159



>ref|XP_011031541.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031542.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031543.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
Length=426

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNA K L  AEY GV+VEL KNF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNALKTLIAAEYSGVQVELVKNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYV ++K DNPL+GSSL+EY  IEQW DFA  EIDAN  +W  PR+GF 
Sbjct  61   DGPIFESNAIARYVTRLKADNPLYGSSLMEYARIEQWIDFATLEIDANILRWFIPRIGFS  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIA+LKR+LTALNTHL+++TYLVGHS+TLA
Sbjct  121  VYLPPAEEAAIAALKRALTALNTHLSTSTYLVGHSLTLA  159



>ref|NP_001242737.1| uncharacterized protein LOC100810452 [Glycine max]
 gb|ACU18062.1| unknown [Glycine max]
Length=420

 Score =   237 bits (605),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            L+LH    NKN++K L  AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHGGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
            P+FESNAIARYV ++K DN L+GSSLIE+ HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PVFESNAIARYVTQLKGDNTLYGSSLIEHAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTL  586
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTL
Sbjct  124  LPPAEEAAISALKRALAALNTHLASNTYLVGHSVTL  159



>ref|NP_001235707.1| elongation factor 1-gamma [Glycine max]
 gb|AAL82617.1|AF475939_1 elongation factor 1-gamma [Glycine max]
Length=420

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            L+LH+   NKN++K L  AEY GV+V+   NF+MGVSNKTPEFLK+NPIGKVPVLETPDG
Sbjct  4    LILHAGKTNKNSYKTLIAAEYAGVQVDFAPNFEMGVSNKTPEFLKINPIGKVPVLETPDG  63

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
            PIFESNAIARYV ++K DN L+GSSLIEY HIEQW DF++ EIDAN  KW  PR+G   Y
Sbjct  64   PIFESNAIARYVTRLKGDNTLYGSSLIEYAHIEQWIDFSSLEIDANIIKWYAPRVGRGPY  123

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            LPP EEA+ +SLKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  124  LPPTEEASNSSLKRALGALNTHLASNTYLVGHSVTLA  160



>ref|XP_010553691.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=415

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALV+H+   NK AFKAL  AEY GVK+E+  +FQMGV+NK+PEFLK+NPIGKVPVLETP
Sbjct  1    MALVMHTYPGNKGAFKALIAAEYTGVKIEVPSDFQMGVTNKSPEFLKLNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++K DN L GSSLIEY  IEQW DFA+ E+D N  +W  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRLKGDNSLVGSSLIEYAQIEQWIDFASMEVDVNILRWFAPRMGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +L PAEEA I++LKR+L  LNTHLASNTYLVGHSVTLA
Sbjct  121  PFLAPAEEATISALKRALDVLNTHLASNTYLVGHSVTLA  159



>ref|XP_008218698.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=420

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVL++   ++  FK   VAEY GVKVEL  +F+MGV+NKTPE+LK+NPIGKVP+L TP
Sbjct  1    MALVLYAVKGHEYGFKTRIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLVTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++K DNPL GSSLI+Y HIEQW DF + EIDAN   W  PR G  
Sbjct  61   DGPIFESNAIARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANVMSWFKPRFGSA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI++LKR+L ALNTHLASNTYLVGH VTLA
Sbjct  121  VYLPPAEEAAISALKRALGALNTHLASNTYLVGHFVTLA  159



>ref|XP_006392370.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 ref|XP_006392371.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29656.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29657.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=414

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK A+KAL  AEY GVK+E   NFQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAYKALIAAEYVGVKIEEPSNFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++  +N L GSSLI+Y HIEQW DFA  EIDAN  +W  PR+GF 
Sbjct  61   EGPIFESNAIARYVSRLNGENSLNGSSLIDYAHIEQWIDFATLEIDANMLRWFAPRMGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +  PAEEAAIA L R L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PFSAPAEEAAIAGLNRGLDALNTHLASNTYLVGHSVTLA  159



>ref|XP_007153909.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
 gb|ESW25903.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
Length=420

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            L+LH    NKN++K L  A+Y GV+VEL  NF+MGVSNKTP+FL+MNPIGKVPVLETPDG
Sbjct  4    LILHGGKTNKNSYKTLIAAQYAGVQVELAPNFEMGVSNKTPQFLQMNPIGKVPVLETPDG  63

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
            P+FESN+IARYVA++  DN L+GSS  EY  IEQW DF++ EIDAN  KW  PR G   Y
Sbjct  64   PVFESNSIARYVARLSGDNTLYGSSFFEYAQIEQWIDFSSLEIDANIIKWYAPRFGRGPY  123

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            LPPAEEAAI++LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  124  LPPAEEAAISALKRALDALNTHLASNTYLVGHSVTLA  160



>ref|XP_009388887.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=290

 Score =   231 bits (589),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            VLH+   NKN  KAL  AEY GV++E+ KNFQMGVSN TPEFLKMNPIGKVP+LETPDGP
Sbjct  32   VLHATRTNKNGIKALIAAEYSGVEIEMAKNFQMGVSNTTPEFLKMNPIGKVPLLETPDGP  91

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  481
            IFESNAIARYVA++K DNPL+GSSL EY  IEQW DFA+TEID N A+W YPR G   Y 
Sbjct  92   IFESNAIARYVARLKADNPLYGSSLFEYALIEQWIDFASTEIDPNIAQWFYPRHGLKPYF  151

Query  482  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
              AEEAA+ +LKR+L ALNTHLAS TYLVGHSVTLA
Sbjct  152  AAAEEAAVRALKRALRALNTHLASKTYLVGHSVTLA  187



>ref|XP_002892012.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68271.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALV+H+   NK A KAL  AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALVAAEYAGVKIEEASDFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV++   DN L GSSLIEY H+EQW DFA+ EIDA+  KW  PRLGF 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHVEQWIDFASLEIDAHMLKWFAPRLGFA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLA  159



>ref|XP_010511351.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=414

 Score =   234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK AFKAL  AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALVAAEYAGVKIEEAADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV++   +N L GSSLIEY  IEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGENSLNGSSLIEYAQIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLA  159



>dbj|BAH56923.1| AT1G57720 [Arabidopsis thaliana]
Length=391

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALV+H+   NK A KAL  AEY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV++   DN L GSSLIEY HIEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +  PAEEAAI++LKR L ALNTHLASNT+LVGHSVTLA
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTFLVGHSVTLA  159



>ref|NP_001274793.1| elongation factor 1-gamma 2-like [Solanum tuberosum]
 gb|ABB87108.1| putative elongation factor 1-gamma-like [Solanum tuberosum]
Length=414

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LHS N NKN  KAL  AEY GVKV+L K+FQMGVSNKTPEFL+MNPIGKVPVL+TP
Sbjct  1    MALILHSTNNNKNTSKALIAAEYTGVKVDLAKDFQMGVSNKTPEFLEMNPIGKVPVLQTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPL-FGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
             GP+FESNAIARYV   +    L FGSS  EY   EQW DF+ATE+DAN A+WLYPRLG+
Sbjct  61   YGPVFESNAIARYVTNNETLTILYFGSSFFEYPLCEQWNDFSATEVDANIARWLYPRLGY  120

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +Y+P AEE A+A+LKR+L ALNTHLASNTYLVGH +TLA
Sbjct  121  GVYIPQAEEGAVAALKRALGALNTHLASNTYLVGHCITLA  160



>ref|XP_004485430.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Cicer arietinum]
 ref|XP_004485431.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Cicer arietinum]
Length=420

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+   NKNA+KAL  AEY GV+VEL  +FQMGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATKGNKNAYKALIAAEYVGVQVELVPDFQMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYVA+   D  LFGSSLI++ +++QW DF++ EID N  K   PRLG+ 
Sbjct  61   EGPVFESNAIARYVARSNGDKTLFGSSLIDHANVDQWIDFSSFEIDTNIMKLYLPRLGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YLPP EEA++ SLKR+  ALNTHLA+NTYLVGHSVTLA
Sbjct  121  PYLPPVEEASLTSLKRAFEALNTHLATNTYLVGHSVTLA  159



>ref|NP_176084.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 ref|NP_001031202.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|Q9FVT2.1|EF1G2_ARATH RecName: Full=Probable elongation factor 1-gamma 2; Short=EF-1-gamma 
2; AltName: Full=eEF-1B gamma 2 [Arabidopsis thaliana]
 gb|AAG50755.1|AC079733_23 elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAK43879.1|AF370502_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL11623.1|AF424630_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL16277.1|AF428347_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL47343.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47351.1| At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAM62488.1| elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAN41373.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
 gb|AEE33455.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 gb|AEE33456.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=413

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALV+H+   NK A KAL  AEY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV++   DN L GSSLIEY HIEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +  PAEEAAI++LKR L ALNTHLASNT+LVGHSVTLA
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTFLVGHSVTLA  159



>gb|AAK59587.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
Length=413

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALV+H+   NK A KAL  AEY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVMHTYKGNKGANKALIAAEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV++   DN L GSSLIEY HIEQW DF++ EIDAN  KW  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDFSSLEIDANMLKWFAPRMGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +  PAEEAAI++LKR L ALNTHLASNT+LVGHSVTLA
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTFLVGHSVTLA  159



>ref|XP_010470318.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=413

 Score =   232 bits (592),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK AFKAL  AEY GVK+E   +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALVAAEYAGVKIEEAADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFESNAIARYV++   +N L GSSLIEY  IEQW DF++ EIDAN  KW  PRLG+ 
Sbjct  61   EGAIFESNAIARYVSRKNGENSLNGSSLIEYAQIEQWIDFSSLEIDANMLKWFAPRLGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLA  159



>ref|XP_010544111.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=416

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK A KAL  AEY GV++E+  +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGANKALIAAEYTGVQIEVPSDFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++K DN L GSSLIEY  IEQW DFA+ E+D N  +W  PR+G+ 
Sbjct  61   EGPIFESNAIARYVSRLKGDNSLVGSSLIEYAQIEQWIDFASMEVDVNILRWFIPRVGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +L P EEA IA+LKR+   LNTHL+SNTYLVGHS+TLA
Sbjct  121  PFLAPVEEATIAALKRAFDVLNTHLSSNTYLVGHSITLA  159



>gb|AGC13144.1| EF1Bgamma class glutathione S-transferase [Pinus tabuliformis]
Length=421

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL LH+ + NKN FKA   AEY GVK+ L  NF MG SNK+PEFLKMNPIGK+PVLETP
Sbjct  1    MALTLHASSINKNGFKARITAEYAGVKLNLAPNFVMGESNKSPEFLKMNPIGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G +FESN IARYVA++K DN LFGSSLI+Y H+EQW DF++ EIDAN  +W +PR+G  
Sbjct  61   EGAVFESNVIARYVARLKGDNTLFGSSLIDYAHVEQWIDFSSIEIDANVMRWYFPRIGSG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAI+ LK  L ALN++LA+NTYLVGHS+TLA
Sbjct  121  VYLPPAEEAAISDLKIGLLALNSYLATNTYLVGHSITLA  159



>ref|XP_006302321.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
 gb|EOA35219.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
Length=413

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK AFKAL   EY GVK+E + +FQMGV+NK+PEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAFKALIAGEYAGVKIEESADFQMGVTNKSPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV++   DN L GSSLIEY  IEQW DF+  EID++  KW  PR G+ 
Sbjct  61   EGPIFESNAIARYVSRKNGDNSLNGSSLIEYAQIEQWIDFSTLEIDSHMLKWFAPRAGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +  PAEEAAI++LKR L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PFSAPAEEAAISALKRGLEALNTHLASNTYLVGHSVTLA  159



>ref|XP_004300001.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=420

 Score =   230 bits (586),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNA+K L  AEY GVKV L  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNAYKTLIAAEYTGVKVALAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYV +++ DNPL+GSS I+Y HIEQW DF + EIDAN   WL PR+G  
Sbjct  61   DGPIFESNAIARYVTRLQADNPLYGSSSIDYAHIEQWIDFGSLEIDANLGNWLRPRMGRG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIA+LKR+L ALNT+LAS+TYLVGHSVTLA
Sbjct  121  VYLPPAEEAAIAALKRALGALNTYLASSTYLVGHSVTLA  159



>ref|XP_011470423.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  95   SF*SEAMALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKV  274
            SF  +AMALVLH+ + NKNA+K L  A Y GV+V L  NF+MGVSNKTPEFLKMNPIGKV
Sbjct  54   SFFPQAMALVLHAGSTNKNAYKTLIAAGYTGVQVALAPNFEMGVSNKTPEFLKMNPIGKV  113

Query  275  PVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLY  454
            PVLETPDGPIFESNAIARYV +++ DNPL+GSS I+Y HIEQW DF + EIDAN   WL 
Sbjct  114  PVLETPDGPIFESNAIARYVTRLQADNPLYGSSSIDYAHIEQWIDFGSLEIDANLGNWLR  173

Query  455  PRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            PR+G  +YLPPAEEAAIA+LKR+L ALNT+LAS+TYLVGHSVTLA
Sbjct  174  PRMGRGVYLPPAEEAAIAALKRALGALNTYLASSTYLVGHSVTLA  218



>emb|CDY22629.1| BnaC08g42630D [Brassica napus]
Length=415

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNA KAL  AEY GVK+++  +F MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHTYKGNKNADKALIAAEYVGVKIDVPSDFAMGVTNKTPEFLKMNPMGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV+++  +N L GSSLIEY H+EQW+DF+  EI  N  KW  PR+GF+
Sbjct  61   EGPVFESNAIARYVSRLNGENSLNGSSLIEYAHVEQWSDFSTLEIYGNILKWFGPRMGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  P EEAAI++LKR L ALNTHL SNTYLVGHS+TLA
Sbjct  121  PYSAPGEEAAISALKRGLDALNTHLTSNTYLVGHSITLA  159



>ref|XP_009118302.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNA KAL  AEY GVK+++  +F MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHTYKGNKNADKALIAAEYVGVKIDVPSDFAMGVTNKTPEFLKMNPMGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV+++  +N L GSSLIEY H+EQW+DF+  EI  N  KW  PR+GF+
Sbjct  61   EGPVFESNAIARYVSRLNGENSLNGSSLIEYAHVEQWSDFSTLEIYGNILKWFGPRMGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  P EEAAI++LKR L ALNTHL SNTYLVGHS+TLA
Sbjct  121  PYSAPGEEAAISALKRGLDALNTHLTSNTYLVGHSITLA  159



>ref|NP_001184949.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 dbj|BAH56947.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28473.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=265

 Score =   222 bits (566),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK+A KAL  AEY GV++++  +FQMGV+NKTP FLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSAEKALIAAEYVGVQIDVPSDFQMGVTNKTPAFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G +FESNAIARYV+++  DN L GSSLIEY  IEQW DF++ EI A+  +W  PR+GF+
Sbjct  61   EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  PAEE AI++LKR+L ALNTHL SNTYLVGHS+TLA
Sbjct  121  PYSAPAEEGAISTLKRALDALNTHLTSNTYLVGHSITLA  159



>gb|EPS67955.1| elongation factor 1 gamma-like protein, partial [Genlisea aurea]
Length=422

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 127/156 (81%), Gaps = 1/156 (1%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            +LHS  +NKN  KAL  AEY GVKVEL K+F+MGVSNKTPEF+KMNPIGK+PVLETPDG 
Sbjct  1    ILHS-TQNKNTNKALIAAEYNGVKVELVKDFEMGVSNKTPEFIKMNPIGKIPVLETPDGA  59

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  481
            IFESNAIARYVA+  P+  LFG++LI+Y HIEQW DF+  EIDAN   WL PR+G   Y 
Sbjct  60   IFESNAIARYVARSNPNTELFGANLIDYAHIEQWIDFSTNEIDANILSWLLPRVGRRPYF  119

Query  482  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            PPAEEA IA+LKR+L AL++HL SNTYLVGH VTLA
Sbjct  120  PPAEEATIAALKRALEALSSHLVSNTYLVGHGVTLA  155



>ref|XP_003592901.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|ABE91935.1| Elongation factor 1, gamma chain; Glutathione S-transferase, 
C-terminal; Thioredoxin-like fold [Medicago truncatula]
 gb|AES63152.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 129/159 (81%), Gaps = 2/159 (1%)
 Frame = +2

Query  116  ALVLHSPNE-NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            AL+LH+PN  NKN +K L  AEY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLETP
Sbjct  3    ALILHAPNNGNKNVYKTLIAAEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETP  62

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y PP EE AI+SLKR+L ALN+HLA NTYLVGHSVTLA
Sbjct  122  TYFPPVEENAISSLKRALEALNSHLAHNTYLVGHSVTLA  160



>ref|XP_004308137.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=420

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+ + NKNA+K L  A Y GV+V L  NF+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHAGSTNKNAYKTLIAAGYTGVQVALAPNFEMGVSNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYV +++ DNPL+GSS I+Y HIEQW DF + EIDAN   WL PR+G  
Sbjct  61   DGPIFESNAIARYVTRLQADNPLYGSSSIDYAHIEQWIDFGSLEIDANLGNWLRPRMGRG  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAAIA+LKR+L ALNT+LAS+TYLVGHSVTLA
Sbjct  121  VYLPPAEEAAIAALKRALGALNTYLASSTYLVGHSVTLA  159



>emb|CDY20681.1| BnaC08g13770D [Brassica napus]
Length=558

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALV+HS   NKN+ KA   AE+ GVK+++   F+MGV+NKTPEFLKMNP+GK+PVLETP
Sbjct  1    MALVMHSYKGNKNSDKAFIAAEFAGVKIDMPSGFEMGVTNKTPEFLKMNPLGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++  DN L GSSLIEY HIEQW DF++ EI  N   W  PR+GF+
Sbjct  61   EGPIFESNAIARYVSRLNGDNSLNGSSLIEYAHIEQWIDFSSLEIYGNIFNWFVPRMGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  P EEAAI++LKR L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYSVPGEEAAISALKRGLEALNTHLASNTYLVGHSVTLA  159



>gb|AFK34308.1| unknown [Medicago truncatula]
Length=418

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = +2

Query  116  ALVLHSPNE-NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            AL+LH+PN  NKN +K L   EY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLETP
Sbjct  3    ALILHAPNNGNKNVYKTLIAVEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETP  62

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y PP EE AI+SLKR+L ALN+HLA NTYLVGHSVTLA
Sbjct  122  TYFPPVEENAISSLKRALEALNSHLAHNTYLVGHSVTLA  160



>ref|XP_003592902.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|AES63153.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 129/159 (81%), Gaps = 2/159 (1%)
 Frame = +2

Query  116  ALVLHSPNE-NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            AL+LH+PN  NKN +K L  AEY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLETP
Sbjct  3    ALILHAPNNGNKNVYKTLIAAEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETP  62

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y PP +E AI+SLKR+L ALN+HLA NTYLVGHSVTLA
Sbjct  122  TYFPPVKENAISSLKRALEALNSHLAHNTYLVGHSVTLA  160



>gb|EMT01475.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=604

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +2

Query  140  ENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  319
            E +   + L  AEY GV VEL K+FQMGVSN TP+FLKMNPIGKVPVLETPDGP+FESNA
Sbjct  191  ETRMRLRHLIAAEYSGVNVELVKDFQMGVSNHTPDFLKMNPIGKVPVLETPDGPVFESNA  250

Query  320  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  499
            IARYVA++K D+PL+GSSL+EY HIEQW DF+ TE+DAN  KWLYPRLGF  Y+   E+ 
Sbjct  251  IARYVARMKADSPLYGSSLMEYSHIEQWIDFSTTEVDANIGKWLYPRLGFYPYVAVIEDT  310

Query  500  AIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             I +LKR+L AL+THLASNTYLVGHSV LA
Sbjct  311  FITALKRALGALDTHLASNTYLVGHSVILA  340



>ref|XP_002889762.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66021.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
Length=414

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK+A KAL  AEY GVK+++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVKIDVPSDFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G +FESNAIARYV+++  DN L GSSLIEY  +EQW+DFA+ EI  N  +W  PR+GF+
Sbjct  61   EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQVEQWSDFASLEIYGNILRWFGPRMGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  PAEE  I++LKR+L ALNTHLASNTYLVGH +TLA
Sbjct  121  PYSAPAEEGTISALKRALDALNTHLASNTYLVGHCITLA  159



>ref|XP_009110814.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=412

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALV+HS   NKN+ KA   AE+ GVK+++   F+MGV+NKTPEFLK+NP+GK+PVLETP
Sbjct  1    MALVMHSYKGNKNSDKAFIAAEFAGVKIDMPSGFEMGVTNKTPEFLKINPLGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++  +N L GSSLIEY HIEQW DF++ EI  N   W  PR+GF+
Sbjct  61   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAHIEQWIDFSSLEIYGNIFNWFVPRMGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  P EEAAI++LKR L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYSVPGEEAAISALKRGLEALNTHLASNTYLVGHSVTLA  159



>ref|XP_006417552.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
 gb|ESQ35905.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
Length=413

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK+A KAL  AEY GVK+++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYAGVKIDVP-DFEMGVTNKTPEFLKMNPIGKVPVLETP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++  DN L GSSLIEY HIEQW+DF++ EI  N  KWL PRLG++
Sbjct  60   EGPIFESNAIARYVSRLNGDNSLNGSSLIEYAHIEQWSDFSSLEIYGNFWKWLGPRLGYM  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y    EEAAI++LKR+L ALNTHL SNTYLVGHS+TLA
Sbjct  120  PYNAQDEEAAISALKRALDALNTHLTSNTYLVGHSITLA  158



>gb|KEH34076.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+   NKNA+K L  AEY G+KVEL  +FQMGVSNK+P+F+ MNPIGKVPVLETP
Sbjct  1    MALILHAQKGNKNAYKTLIAAEYSGIKVELAPDFQMGVSNKSPQFINMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNA+ARYVA++   N LFGSS I+  H+EQW DF++ EID N  K   PR GF 
Sbjct  61   DGPVFESNAMARYVARLGESN-LFGSSPIDQAHVEQWIDFSSMEIDDNIMKLYRPRRGFS  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             YL P EEAAI+SLKR+  ALNTHLA NTYLVGHSVTLA
Sbjct  120  PYLAPVEEAAISSLKRAFEALNTHLAHNTYLVGHSVTLA  158



>emb|CDY06365.1| BnaA09g48380D [Brassica napus]
Length=413

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKNA KAL  AEY GVK+++  +F MGV+NKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHTYKGNKNADKALIAAEYVGVKIDVPSDFAMGVTNKTPEFLKMNPMGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GP+FESNAIARYV+++  +N L GSSLIEY H+EQW+DF+  EI  N  KW  PR+GF+
Sbjct  61   EGPVFESNAIARYVSRLNGENSLNGSSLIEYAHVEQWSDFSTLEIYGNILKWFGPRMGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y    EEAAI++L+R L ALNTHL SNTYLVGHS+TLA
Sbjct  121  PYSALGEEAAISALERGLDALNTHLTSNTYLVGHSITLA  159



>ref|XP_010490215.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK+A KAL  AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVK-PDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DFA+ EI  NT +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFASLEIYGNTLRWFGPRMGF  120

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            + Y  PAEE  I++LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  MPYSAPAEEGTISALKRALDALNTHLASNTYLVGHSITLA  160



>emb|CDY31074.1| BnaA08g26240D [Brassica napus]
Length=412

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALV+HS   NKN+ KA   AE+ GVK+++   F+MGV+NKT EFLKMNP+GK+PVLETP
Sbjct  1    MALVMHSYKGNKNSDKAFIAAEFAGVKIDMPSGFEMGVTNKTTEFLKMNPLGKIPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++  +N L GSSLIEY HIEQW DF++ EI  N   W  PR+GF+
Sbjct  61   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAHIEQWIDFSSLEIYGNIFNWFVPRMGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  P EEAAI++LKR L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYSVPGEEAAISALKRGLEALNTHLASNTYLVGHSVTLA  159



>ref|XP_010458260.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK+A KAL  AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVK-PDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DFA+ EI  NT +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFASLEIYGNTLRWFGPRMGF  120

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            + Y  PAEE  I++LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  MPYSAPAEEGTISALKRALDALNTHLASNTYLVGHSITLA  160



>gb|ACJ85171.1| unknown [Medicago truncatula]
Length=418

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = +2

Query  116  ALVLHSPNE-NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            AL+LH+PN  NKN +K L   EY GV+V+LT +FQMGVSNKTP+F+ MNPIGKVPVLET 
Sbjct  3    ALILHAPNNGNKNVYKTLIAVEYVGVQVQLTPDFQMGVSNKTPQFINMNPIGKVPVLETR  62

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++  +N LFGSSLI    I+QW DF++ EIDAN  K   PRLGF 
Sbjct  63   DGPVFESNAIARYVARLGHNN-LFGSSLIHQAQIDQWIDFSSLEIDANIMKLYLPRLGFA  121

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y PP EE AI+SLKR+L ALN+HLA NTYLVGHSVTLA
Sbjct  122  TYFPPVEENAISSLKRALEALNSHLAHNTYLVGHSVTLA  160



>ref|NP_563848.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|O04487.1|EF1G1_ARATH RecName: Full=Probable elongation factor 1-gamma 1; Short=EF-1-gamma 
1; AltName: Full=eEF-1B gamma 1 [Arabidopsis thaliana]
 gb|AAB60721.1| Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 
come from this gene [Arabidopsis 
thaliana]
 dbj|BAH20206.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28472.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=414

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK+A KAL  AEY GV++++  +FQMGV+NKTP FLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSAEKALIAAEYVGVQIDVPSDFQMGVTNKTPAFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G +FESNAIARYV+++  DN L GSSLIEY  IEQW DF++ EI A+  +W  PR+GF+
Sbjct  61   EGSVFESNAIARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFM  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  PAEE AI++LKR+L ALNTHL SNTYLVGHS+TLA
Sbjct  121  PYSAPAEEGAISTLKRALDALNTHLTSNTYLVGHSITLA  159



>ref|XP_008452241.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=410

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFKAL  AEY GVKV+L+ +F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAFKALIAAEYNGVKVDLSPDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID N +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDNNLSVILRPRFGYA  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y P  EE A A+LKRS  ALN++LASNT+LVGHSVTLA
Sbjct  120  VYHPGVEETANAALKRSFGALNSYLASNTFLVGHSVTLA  158



>ref|XP_007148576.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
 gb|ESW20570.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
Length=419

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH+   NKN +K+L  AEY GV++EL  NF+M V+ KTPEFLKMNPIGKVPVLETP
Sbjct  1    MALILHATRRNKNVYKSLIAAEYSGVELELAPNFEMFVTTKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++  DN L+ S+ I+   I+QW DF++ EIDAN  K   PRLG+ 
Sbjct  61   DGPIFESNAIARYVARLNGDNALYLSTPIDNARIDQWIDFSSLEIDANILKVYIPRLGYT  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y PP EEAA ++LKR+L ALNTHLASNTYLVGHSVTLA
Sbjct  121  PYFPPVEEAANSALKRALGALNTHLASNTYLVGHSVTLA  159



>ref|XP_010475804.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X1 [Camelina 
sativa]
Length=415

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK+A KAL  AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVK-PDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DF++ EI  N  +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFSSLEIYGNILRWFGPRMGF  120

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            + Y  PAEE  I++LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  MPYSAPAEEGTISALKRALDALNTHLASNTYLVGHSITLA  160



>ref|XP_010475805.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X2 [Camelina 
sativa]
Length=435

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK+A KAL  AEY GV++++  +FQMGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFQMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVK-PDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
            +G +FESNAIARYV+++   +N L GSSLIEY  IEQW+DF++ EI  N  +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGGENSLNGSSLIEYAQIEQWSDFSSLEIYGNILRWFGPRMGF  120

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            + Y  PAEE  I++LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  MPYSAPAEEGTISALKRALDALNTHLASNTYLVGHSITLA  160



>gb|KGN56265.1| hypothetical protein Csa_3G110620 [Cucumis sativus]
Length=379

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNA+KAL  AEY GVKV+L+++F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAYKALIAAEYNGVKVDLSQDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID   +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDIPVSTKLRPRFGYA  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             + P  EE A A+LKRS  ALN++LASNT+LVGHSVTLA
Sbjct  120  AFHPGVEETADAALKRSFGALNSYLASNTFLVGHSVTLA  158



>ref|XP_004172027.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like, 
partial [Cucumis sativus]
Length=363

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   +KN +K L  AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAI RYVA++K D+ LFGSS I+YGH+EQW DF++ EID + +  L PR G+ 
Sbjct  61   DGPIFESNAITRYVARLK-DSILFGSSPIDYGHVEQWIDFSSLEIDIHISTILAPRFGYG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y  PAEEAA  +LKRS  AL+++LASNT+LVGHSVTLA
Sbjct  120  VYHAPAEEAANVALKRSFGALDSYLASNTFLVGHSVTLA  158



>ref|XP_004134257.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=364

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNA+KAL  AEY GVKV+L+++F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAYKALIAAEYNGVKVDLSQDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID   +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDIPVSTKLRPRFGYA  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             + P  EE A A+LKRS  ALN++LASNT+LVGHSVTLA
Sbjct  120  AFHPGVEETADAALKRSFGALNSYLASNTFLVGHSVTLA  158



>gb|KGN56266.1| hypothetical protein Csa_3G110630 [Cucumis sativus]
Length=402

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   +KN +K L  AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAI RYVA++K D+ LFGSS I+YGH+EQW DF++ EID + +  L PR G+ 
Sbjct  61   DGPIFESNAITRYVARLK-DSILFGSSPIDYGHVEQWIDFSSLEIDIHISTILAPRFGYG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y  PAEEAA  +LKRS  AL+++LASNT+LVGHSVTLA
Sbjct  120  VYHAPAEEAANVALKRSFGALDSYLASNTFLVGHSVTLA  158



>ref|XP_004133719.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=409

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   +KN +K L  AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAI RYVA++K D+ LFGSS I+YGH+EQW DF++ EID + +  L PR G+ 
Sbjct  61   DGPIFESNAITRYVARLK-DSILFGSSPIDYGHVEQWIDFSSLEIDIHISTILAPRFGYG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y  PAEEAA  +LKRS  AL+++LASNT+LVGHSVTLA
Sbjct  120  VYHAPAEEAANVALKRSFGALDSYLASNTFLVGHSVTLA  158



>ref|XP_008365322.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Malus domestica]
Length=419

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NKN +K L VAEY GVKV L  NF++GV+NKTPE+LK+NPIGK P+L TP
Sbjct  1    MALVLHAGKTNKNGYKVLIVAEYSGVKV-LAPNFEIGVTNKTPEYLKLNPIGKYPLLITP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPIFESNAIARYVA++KPDNPL GSSLI+Y HIEQW DF + EIDAN   W  PR+G  
Sbjct  60   DGPIFESNAIARYVARLKPDNPLCGSSLIDYAHIEQWIDFGSMEIDANVLNWWLPRVGQR  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +YLPPAEEAA  +LKR+L ALNTHLASNT LVGHSVTLA
Sbjct  120  VYLPPAEEAAXXALKRALGALNTHLASNTXLVGHSVTLA  158



>gb|KDO42760.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=387

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  218  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  397
            MGV+NKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVA++K DNPL GSSLI+  HIE
Sbjct  1    MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIE  60

Query  398  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  577
            QW DF++ EID N  +W  PR+GF +YLP AEEAAIASLKR+L ALNTHLASNTYLVGHS
Sbjct  61   QWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHS  120

Query  578  VTLA  589
            VTLA
Sbjct  121  VTLA  124



>ref|XP_006307657.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
 gb|EOA40555.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
Length=415

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK+A KAL  AEY GV++++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKSADKALIAAEYVGVQIDVPSDFEMGVTNKTPEFLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPD-NPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
            +G +FESNAIARYV+++  + N L GSSLIEY  IEQW+DF++ EI  N  +W  PR+GF
Sbjct  61   EGSVFESNAIARYVSRLNGEKNSLNGSSLIEYAQIEQWSDFSSLEIYGNILRWFGPRMGF  120

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            + Y   AEE  I++LKR+L ALNTHLASNTYLVGHS+TLA
Sbjct  121  MPYNASAEEGTISALKRALDALNTHLASNTYLVGHSITLA  160



>ref|XP_001758671.1| predicted protein [Physcomitrella patens]
 gb|EDQ76649.1| predicted protein [Physcomitrella patens]
 gb|AFZ39148.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +2

Query  116  ALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPD  295
             LVLHSP  NKNA+K L  AEY GVKVE T +FQMGV+NKTPEFLK+NPIGKVPVL+TPD
Sbjct  3    GLVLHSPKVNKNAYKTLIAAEYVGVKVETTPDFQMGVTNKTPEFLKLNPIGKVPVLQTPD  62

Query  296  GPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVI  475
            GPIFESNA+ARYVA  K D  L GSS  E   +EQW DF++ E+DAN  +W+YPRLG+  
Sbjct  63   GPIFESNAMARYVAN-KKDVGLTGSSAYEKALVEQWIDFSSLEVDANIGRWVYPRLGYFA  121

Query  476  YLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            ++   E  AI++LKR+LT LN HLAS TYLVG SVTLA
Sbjct  122  FIEEVEAFAISNLKRALTCLNGHLASRTYLVGESVTLA  159



>ref|XP_004155227.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Cucumis sativus]
Length=409

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNA+KAL  AEY GVKV+L+ +F MGV+NK+PE+LKMNPIGKVPVLETP
Sbjct  1    MALVLHSWKTNKNAYKALIAAEYNGVKVDLSPDFTMGVTNKSPEYLKMNPIGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG IFESNAIARYVA++K D+ LFGSS I+ GH+EQW DF+  EID   +  L PR G+ 
Sbjct  61   DGAIFESNAIARYVARLK-DSGLFGSSSIDCGHVEQWIDFSTFEIDIPVSTKLRPRFGYA  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             + P  EE A A+LKRS  ALN++LASNT+LVGHSVTLA
Sbjct  120  AFHPGVEETADAALKRSFGALNSYLASNTFLVGHSVTLA  158



>emb|CDX93494.1| BnaA06g05540D [Brassica napus]
Length=413

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK A KAL  AEY GVK+ +  +F+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAEKALIAAEYTGVKINVP-DFEMGVSNKTPEFLKMNPIGKVPVLETP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++  +N L GSSLIEY  IEQW DF++ EI  +   W   R+G+ 
Sbjct  60   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAQIEQWIDFSSLEIFGSIFMWFGARIGYK  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  P EEAAI++LKR+L ALNTHLAS T+LVGHS+TLA
Sbjct  120  PYSVPGEEAAISALKRALDALNTHLASKTFLVGHSITLA  158



>ref|XP_009148264.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK A KAL  AEY GVK+++  +F+MGV+NKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAEKALIAAEYTGVKIDVP-DFEMGVANKTPEFLKMNPIGKVPVLETP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++  +N L GSSLIEY  IEQW DF++ EI  +   W   R+G+ 
Sbjct  60   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAQIEQWIDFSSLEIFGSIFMWFGARIGYK  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  P EEAAI++LKR+L ALNTHLAS T+LVGHS+TLA
Sbjct  120  PYSVPGEEAAISALKRALDALNTHLASKTFLVGHSITLA  158



>ref|XP_008789740.1| PREDICTED: elongation factor 1-gamma 1 isoform X2 [Phoenix dactylifera]
Length=384

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  218  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  397
            MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYV ++K +NPL+GSSLIEY  IE
Sbjct  1    MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVTRLKAENPLYGSSLIEYARIE  60

Query  398  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  577
            QW DFA+ EIDAN A+WL PRLGFV +   AEE AI +LKRSL ALNTHLA+NTYLVGHS
Sbjct  61   QWIDFASMEIDANIARWLLPRLGFVPFAAVAEEFAITALKRSLGALNTHLATNTYLVGHS  120

Query  578  VTLA  589
            VTLA
Sbjct  121  VTLA  124



>emb|CDY50887.1| BnaCnng19790D [Brassica napus]
Length=413

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLH+   NK A KAL  AEY GV++ +  +F+MGVSNKTPEFLKMNPIGKVPVLETP
Sbjct  1    MALVLHTYKGNKGAEKALIAAEYTGVQINVP-DFEMGVSNKTPEFLKMNPIGKVPVLETP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYV+++  +N L GSSLIEY  IEQW DF++ EI  +   W   R+G+ 
Sbjct  60   EGPIFESNAIARYVSRLNGENSLNGSSLIEYAQIEQWIDFSSLEIFGSIFMWFGARIGYK  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y  P EEAAI++LKR+L ALNTHL S T+LVGHS+TLA
Sbjct  120  PYSVPGEEAAISALKRALDALNTHLTSKTFLVGHSITLA  158



>ref|XP_001771013.1| predicted protein [Physcomitrella patens]
 gb|EDQ64168.1| predicted protein [Physcomitrella patens]
 gb|AFZ39147.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=431

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +2

Query  116  ALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPD  295
             LV+HS   NKN++K+L  AEY GVKVE+  +FQMGV+NK+PEFLKMNPIGKVPVL+TP+
Sbjct  3    GLVIHSQKVNKNSYKSLIAAEYVGVKVEIVPDFQMGVTNKSPEFLKMNPIGKVPVLQTPE  62

Query  296  GPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVI  475
            GPIFESNA+ARYVA  K D  L GSS  E   +EQW DFA  EID N   W+YPRLGF +
Sbjct  63   GPIFESNAMARYVAN-KKDVGLVGSSAYEKALVEQWIDFATMEIDVNAGGWVYPRLGFGL  121

Query  476  YLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            Y    E + I++LKR+LT LN HLAS TYLVG S+TLA
Sbjct  122  YNEEVEASKISNLKRALTFLNAHLASRTYLVGESITLA  159



>gb|KEH32761.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=384

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  218  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  397
            MGVSNKTP+FL MNP+GKVPVLETPDGP+FESNAIARYVA+   +N L+GSSLI+Y  IE
Sbjct  1    MGVSNKTPQFLDMNPLGKVPVLETPDGPVFESNAIARYVARQNNNNTLYGSSLIQYAQIE  60

Query  398  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  577
            QW DF++ E+D+N  KWLYPRLG+ +YLPPAEE AI  LKR+L ALNTHLASNTYLVGHS
Sbjct  61   QWIDFSSLEVDSNINKWLYPRLGYGVYLPPAEEIAITGLKRALNALNTHLASNTYLVGHS  120

Query  578  VTLA  589
            VTLA
Sbjct  121  VTLA  124



>gb|AFW76480.1| elongation factor gamma1 [Zea mays]
Length=382

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  218  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  397
            MGVSNKTPEFLKMNP+GKVPVLETPDGP+FESNAIARYVA++K DNPLFGSS IE  H+E
Sbjct  1    MGVSNKTPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVE  60

Query  398  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  577
            QW DFAATE+D   A +LYPRLG++ Y+   EE AI+SLKRSL ALNTHLASNTYLVGH+
Sbjct  61   QWMDFAATEVDPGVAWYLYPRLGYLPYVSTTEETAISSLKRSLGALNTHLASNTYLVGHA  120

Query  578  VTLA  589
            VTLA
Sbjct  121  VTLA  124



>gb|AFW87006.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
 gb|AFW87007.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
Length=382

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  218  MGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIE  397
            MGVSNKTPEFLKMNP+GKVPVLETPDGP+FESNAIARYVA++K DNPLFGSS IE  H+E
Sbjct  1    MGVSNKTPEFLKMNPLGKVPVLETPDGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVE  60

Query  398  QWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHS  577
            QW DFAATE+D     +LYPRLG++ Y    EE AIASLKRSL ALNTHLA NTYLVGHS
Sbjct  61   QWMDFAATEVDPGVGWYLYPRLGYIPYAHTTEETAIASLKRSLGALNTHLALNTYLVGHS  120

Query  578  VTLA  589
            VTLA
Sbjct  121  VTLA  124



>ref|XP_008452240.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=409

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   +KN +K L  AEY GVKV+L  +F MGVSNK+PEFLKMNPIGKVP+L+TP
Sbjct  1    MALVLHSWTPSKNVYKVLIAAEYNGVKVDLAPDFTMGVSNKSPEFLKMNPIGKVPLLQTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DG IFESNAI RYVA++K D+ L+GSS I+YGHIEQW DF++ EID++ +  L PR G+ 
Sbjct  61   DGAIFESNAITRYVARLK-DSGLYGSSPIDYGHIEQWIDFSSLEIDSHISTILAPRYGYG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +Y  PAEEAA A+LKRSL ALN++LASNT+LVGHSVTLA
Sbjct  120  VYYAPAEEAANAALKRSLGALNSYLASNTFLVGHSVTLA  158



>gb|AFW76477.1| elongation factor gamma1 [Zea mays]
Length=291

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 110/141 (78%), Gaps = 3/141 (2%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MALVLHS   NKNAFKAL  AEY G+KVELTK+F+MGVSNKTPEFLKMNP+GKVPVLETP
Sbjct  1    MALVLHSGAGNKNAFKALIAAEYSGIKVELTKDFEMGVSNKTPEFLKMNPLGKVPVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGP+FESNAIARYVA++K DNPLFGSS IE  H+EQW DFAATE+D   A +LYP+   V
Sbjct  61   DGPVFESNAIARYVARLKDDNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPK---V  117

Query  473  IYLPPAEEAAIASLKRSLTAL  535
            +  P  EEA     K  L  L
Sbjct  118  VEAPAEEEAPKPKPKNPLDLL  138



>ref|XP_002984514.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
 gb|EFJ14564.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
Length=430

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 120/159 (75%), Gaps = 3/159 (2%)
 Frame = +2

Query  116  ALVLH-SPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
             LVLH +   NKNA K L VAE  GVKV+L  +F+MGVSNKTPEFLK+NP+GKVPVLETP
Sbjct  3    GLVLHVNAGINKNAHKVLIVAEIVGVKVDLVPDFEMGVSNKTPEFLKLNPLGKVPVLETP  62

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            DGPI ESNAIARYVA +K    L GS+L +   ++QW DFA TE+D +  +WLYPR G++
Sbjct  63   DGPISESNAIARYVANLK--GKLTGSTLYQTALVDQWIDFATTEVDTSLGRWLYPRFGYL  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y P  EE AI ++KR+  ALN++LAS TYLVGH VTLA
Sbjct  121  PYAPEVEEHAIEAIKRAFGALNSYLASRTYLVGHFVTLA  159



>ref|XP_002973046.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
 gb|EFJ26267.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
Length=418

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = +2

Query  143  NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  322
            NKNA K L VAE  GVKV+L  +F+MGVSNKTPEFLK+NP+GKVPVLETPDGPI ESNAI
Sbjct  1    NKNAHKVLIVAEIVGVKVDLVPDFEMGVSNKTPEFLKLNPLGKVPVLETPDGPISESNAI  60

Query  323  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  502
            ARYVA +K    L GS++ +   ++QW DFA TE+D +  +WLYPR G++ Y P  EE A
Sbjct  61   ARYVANLK--GKLTGSTVYQTALVDQWIDFATTEVDTSLGRWLYPRFGYLPYAPEVEEHA  118

Query  503  IASLKRSLTALNTHLASNTYLVGHSVTLA  589
            I ++KR+  ALN++LAS TYLVGH VTLA
Sbjct  119  IEAIKRAFGALNSYLASRTYLVGHFVTLA  147



>ref|XP_008867564.1| hypothetical protein H310_04829 [Aphanomyces invadans]
 gb|ETW03335.1| hypothetical protein H310_04829 [Aphanomyces invadans]
Length=418

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 102/159 (64%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M+  L  P  +  AFK L  AEY GV +E+ ++FQMGV NK+ EFLK+NP+GKVPVL+TP
Sbjct  1    MSYKLFVPQGSSRAFKILIAAEYNGVNLEIPEHFQMGVDNKSAEFLKLNPLGKVPVLQTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARYVA+++ D  L G +  E G ++QW DF A E++      LYP  G+ 
Sbjct  61   EGPIFESNAIARYVARIRADTGLLGKTFYESGQVDQWVDFVANELEVPLNALLYPIFGYR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +    E+ AI   K+ L  L  HL   TY VG  +TLA
Sbjct  121  KWEAELEKKAIEDTKKVLQILENHLLLRTYFVGEQITLA  159



>ref|XP_005645852.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE21308.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
Length=441

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            L L++   NKNA+KA   AEY GVK+++   F+MG +NK+P+FLK+NP GKVP L+TP+G
Sbjct  4    LRLYTFPGNKNAWKAQIAAEYVGVKLDVPA-FEMGKTNKSPQFLKLNPNGKVPTLQTPEG  62

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
             I+ESNAIARYVA++  D  LFG++  +   +EQW +FA  E+DA  A W YP  G++ Y
Sbjct  63   GIWESNAIARYVARLA-DKGLFGATAYDAALVEQWIEFATGELDAPLASWYYPIAGYMEY  121

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
                EEAAIA++K+SL  LN +LA++T+LVG+SVTLA
Sbjct  122  NKKKEEAAIATVKKSLGVLNEYLATHTFLVGNSVTLA  158



>ref|XP_009825362.1| hypothetical protein H257_03107 [Aphanomyces astaci]
 gb|ETV85344.1| hypothetical protein H257_03107 [Aphanomyces astaci]
Length=419

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 98/159 (62%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MA  L  P     AFK    AEY GV +E+ + F MGV NK+ EFLK+NP+GKVPVL+TP
Sbjct  1    MAYKLFVPQGGARAFKIFIAAEYSGVNLEIPETFVMGVDNKSAEFLKLNPLGKVPVLQTP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPIFESNAIARY+A+++ DN L G +  E G ++QW DF + E++      LYP  G+ 
Sbjct  61   EGPIFESNAIARYIARIRADNGLLGKTFYESGQVDQWVDFVSNELELPLNALLYPIFGYR  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +    E  AI   K+ L  L  HL   TY VG  +TLA
Sbjct  121  KWEAALEAKAIEDTKKVLQILENHLLLRTYFVGEQITLA  159



>ref|XP_008605170.1| hypothetical protein SDRG_01423 [Saprolegnia diclina VS20]
 gb|EQC41456.1| hypothetical protein SDRG_01423 [Saprolegnia diclina VS20]
Length=416

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 98/159 (62%), Gaps = 0/159 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MA  L++P     AFK L  AEY GV + + + F MGV NKTPEFL +NP+GKVPVL TP
Sbjct  1    MAYTLYAPQAGSRAFKILIAAEYNGVDLNVPETFVMGVDNKTPEFLALNPLGKVPVLATP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +GPI+ESNAIARYVA+++ D  L G +  E G ++QW DF   E++      LYP  G+ 
Sbjct  61   EGPIYESNAIARYVARLRADTGLTGKTFYESGQVDQWVDFVTNEMETPLGALLYPIFGYA  120

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y       A+  +K+SL  L  HL   TY VG  VTLA
Sbjct  121  KYNHDVHTKALEDIKKSLHILENHLLLRTYFVGEQVTLA  159



>ref|XP_001774148.1| predicted protein [Physcomitrella patens]
 gb|EDQ61062.1| predicted protein [Physcomitrella patens]
 gb|AFZ39149.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = +2

Query  116  ALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPD  295
             L L++   NKNA+KAL  AEY GVK+E T+      + K+P++L MNP+GKVPVLETP+
Sbjct  3    GLKLYANPVNKNAYKALIAAEYVGVKIEFTEITDWSTT-KSPQYLAMNPMGKVPVLETPE  61

Query  296  GPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVI  475
            G IFESNAIARYVA +K D  L G        I+QW DFAA EID N   W+ P LG   
Sbjct  62   GSIFESNAIARYVAGLK-DVGLLGVPGYNKAQIDQWIDFAALEIDINARAWVLPHLGLGF  120

Query  476  YLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +    E   I +LKR+LT LN++LAS TYLVG SVTLA
Sbjct  121  FNEEVEAFIINNLKRALTTLNSYLASRTYLVGESVTLA  158



>ref|XP_009040775.1| hypothetical protein AURANDRAFT_70385 [Aureococcus anophagefferens]
 gb|EGB04522.1| hypothetical protein AURANDRAFT_70385 [Aureococcus anophagefferens]
Length=421

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 101/159 (64%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M L L++   N  AFKAL  AEY GV +++  +F M  + KTP FL M+P+GKVPVL+TP
Sbjct  1    MTLQLYTYPGNFRAFKALVAAEYVGVDIDVP-DFDMEKTAKTPSFLAMSPMGKVPVLKTP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
             G IFESNAIARYVA+++ D+ ++G +  E   I+ W DF A E++     W+YP +G++
Sbjct  60   QGAIFESNAIARYVARLRKDSEIYGRTFYESALIDSWVDFCAHELELPCTMWVYPIIGYM  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   A   A   +  +L +L  HL   TY+VG ++TLA
Sbjct  120  PFNAAASAKAKEHVTDALDSLERHLVDKTYIVGDAITLA  158



>ref|XP_006841161.1| hypothetical protein AMTR_s00086p00155150 [Amborella trichopoda]
 gb|ERN02836.1| hypothetical protein AMTR_s00086p00155150 [Amborella trichopoda]
Length=124

 Score =   131 bits (330),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            +LH+ N NKN FKAL  AEY GV+V   ++F++GVSNKT +FLKMNP+GK P+L+TP+GP
Sbjct  1    MLHAGNNNKNVFKALIAAEYAGVEVNPIESFEVGVSNKTLKFLKMNPMGKAPMLKTPEGP  60

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDF  412
            IFESNAIAR+VA +K ++ L+G+SL EY  IEQW DF
Sbjct  61   IFESNAIARFVAHLKGNDILYGTSLFEYERIEQWIDF  97



>ref|XP_009041108.1| hypothetical protein AURANDRAFT_39051 [Aureococcus anophagefferens]
 gb|EGB04257.1| hypothetical protein AURANDRAFT_39051 [Aureococcus anophagefferens]
Length=411

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 101/159 (64%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M L L++   N  AFKAL  AEY GV +++  +F M  + KTP FL M+P+GKVPVL+TP
Sbjct  1    MTLQLYTYPGNFRAFKALVAAEYVGVDIDVP-DFDMEKTAKTPSFLAMSPMGKVPVLKTP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
             G IFESNAIARYVA+++ D+ ++G +  E   I+ W DF A E++     W+YP +G++
Sbjct  60   QGAIFESNAIARYVARLRKDSEIYGRTFYESALIDSWVDFCAHELELPCTMWVYPIIGYM  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   A   A   +  +L +L  HL   TY+VG ++TLA
Sbjct  120  PFNAAAFAKAKEHVSDALDSLERHLVDKTYIVGDAITLA  158



>emb|CBJ27519.1| eukaryotic elongation factor-1 B gamma [Ectocarpus siliculosus]
Length=420

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 97/159 (61%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL L +   N  AFK L  AEY GV++E+ + F     +K+P+FL  +P+G+VPVLETP
Sbjct  1    MALKLWTNPANFRAFKVLIAAEYNGVELEVPE-FNHPSDSKSPDFLAKSPLGRVPVLETP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
             G IFESNAIARYVA+++ D  L+G S  E   ++ W DF A EI+     W YP +G++
Sbjct  60   QGSIFESNAIARYVARMRRDTELYGVSFFESAQVDSWIDFCAHEIELPATIWCYPVIGYM  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y   A   A   LK +L AL   L   TYLVG  +TLA
Sbjct  120  PYNDAAVSKAKEDLKIALGALEKALLHRTYLVGDKITLA  158



>ref|XP_009519315.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
 gb|ACH68459.1| calcium-dependent protein 1 [Phytophthora sojae]
 gb|EGZ24027.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
Length=405

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 94/159 (59%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M   L++   N   FK L  AEY GV +EL + F M    K+ EF    P+GKVP+LET 
Sbjct  1    MVFKLYTYPANYRVFKVLIAAEYNGVDIELPE-FDMATDLKSEEFQSKTPVGKVPILETE  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFES AIA+YVA+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGTIFESGAIAKYVARLRNDTGLYGKTFFESGQVDSWIDFSAYELEIPLQAWLYPILGWA  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y   A   A A +K++L  L  HL   TYLVG  +TLA
Sbjct  120  KYNAEALTKAKADVKKALQTLENHLHLRTYLVGEQITLA  158



>gb|KDO34814.1| hypothetical protein SPRG_00875 [Saprolegnia parasitica CBS 223.65]
Length=404

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 89/159 (56%), Gaps = 11/159 (7%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MA  L++P     AFK L  AEY GV + + + F MGV NKTPEFL +NP+GKVP     
Sbjct  1    MAYTLYAPQAGSRAFKILIAAEYNGVDLNVPEKFVMGVDNKTPEFLALNPLGKVP-----  55

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
                  SNAIARYVA+++ D  L G +  E G ++QW DF   E++   A  LYP  G+ 
Sbjct  56   ------SNAIARYVARLRADTGLTGKTFYESGQVDQWVDFVTNEMETPLAALLYPIFGYA  109

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y       AI  LK+SL  L  HL   TY VG  VTLA
Sbjct  110  KYNHDVHTKAIEDLKKSLHILENHLLLRTYFVGEQVTLA  148



>ref|XP_004341586.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19500.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
Length=408

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 95/156 (61%), Gaps = 2/156 (1%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            +   PN N   +KA     + G+++E    FQ+GV NKTPEF    P+ KVP LETP+GP
Sbjct  5    IFSYPN-NHRVWKAQIAGNFTGLQIE-APAFQIGVDNKTPEFAAKFPLQKVPALETPEGP  62

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  481
            +FESNAIARY A+    + ++GSS  E   I+QW DF+A EI+   + WLYP    V + 
Sbjct  63   LFESNAIARYAARYGGSSKIYGSSPYEASLIDQWIDFSANEIELPASAWLYPIFEIVPFN  122

Query  482  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
              A E A A +K++L  LN HL   TYLVG  V+LA
Sbjct  123  AEATERAKADIKKALELLNKHLTYRTYLVGERVSLA  158



>gb|ETI50110.1| hypothetical protein F443_06278, partial [Phytophthora parasitica 
P1569]
Length=173

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = +2

Query  143  NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  322
            N   FK L  AEY GV +EL + F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  12   NYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  70

Query  323  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  502
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +   A   A
Sbjct  71   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNAAALTKA  130

Query  503  IASLKRSLTALNTHLASNTYLVGHSVTLA  589
             A +K++L  L  HL   TYLVG  VTLA
Sbjct  131  KADVKKALQTLENHLHLRTYLVGEQVTLA  159



>ref|XP_004353907.1| glutathione S-transferase domain-containing protein [Dictyostelium 
fasciculatum]
 gb|EGG14498.1| glutathione S-transferase domain-containing protein [Dictyostelium 
fasciculatum]
Length=412

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 104/159 (65%), Gaps = 3/159 (2%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M++ ++S  +N   +KAL  A+Y GV++E+   F     +K+ EFLK+ P GKVPV+ T 
Sbjct  1    MSMKIYSYPQNPRVYKALIAAKYVGVEIEVPA-FDFQKDSKSAEFLKVAPHGKVPVMVTE  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
             G IFESN+IARYVA++     ++GS   E   I+QW DFA  E++A+   WLYP +GFV
Sbjct  60   KGSIFESNSIARYVARL--GGKIYGSDAYEASVIDQWLDFATNEVEASAVAWLYPIMGFV  117

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             + P A + A  ++KR LT L+ HL ++++LVG  V+LA
Sbjct  118  KFNPEATQKAKENVKRLLTTLDNHLKTSSFLVGPRVSLA  156



>gb|ETP47818.1| hypothetical protein F442_06319, partial [Phytophthora parasitica 
P10297]
Length=170

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 92/155 (59%), Gaps = 1/155 (1%)
 Frame = +2

Query  125  LHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPI  304
            L++   N   FK L  AEY GV +EL + F      K+ EF    PIGKVP+LET +G +
Sbjct  3    LYTYPGNYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTL  61

Query  305  FESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  484
            FES AIARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +  
Sbjct  62   FESGAIARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNA  121

Query  485  PAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             A   A A +K++L  L  HL   TYLVG  VTLA
Sbjct  122  AALTKAKADVKKALQTLENHLHLRTYLVGEQVTLA  156



>emb|CCI44608.1| unnamed protein product [Albugo candida]
Length=407

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 94/149 (63%), Gaps = 2/149 (1%)
 Frame = +2

Query  143  NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  322
            N   FK L  AEY G+ +E+ + F M  + K+ EFL  NP+GKVPVLET +G +FESNAI
Sbjct  9    NYRVFKILIAAEYNGIDIEVPE-FDM-TTIKSKEFLAKNPLGKVPVLETENGALFESNAI  66

Query  323  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  502
            ARYVA+++ D  L+G +  E G ++ W DF+A E++     WLYP  G++ +    +  A
Sbjct  67   ARYVARLRADTGLYGQTFFESGQVDSWIDFSAHELEVPLQMWLYPIFGYMKFNAGTKAKA  126

Query  503  IASLKRSLTALNTHLASNTYLVGHSVTLA  589
            +  +K++L  L  HL   TYLVG  +TLA
Sbjct  127  VEDVKKALQVLENHLHLRTYLVGEHITLA  155



>gb|ETO78833.1| hypothetical protein F444_06337, partial [Phytophthora parasitica 
P1976]
Length=190

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 92/155 (59%), Gaps = 1/155 (1%)
 Frame = +2

Query  125  LHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPI  304
            L++   N   FK L  AEY GV +EL + F      K+ EF    PIGKVP+LET +G +
Sbjct  3    LYTYPGNYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTL  61

Query  305  FESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  484
            FES AIARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +  
Sbjct  62   FESGAIARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNA  121

Query  485  PAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             A   A A +K++L  L  HL   TYLVG  VTLA
Sbjct  122  AALTKAKADVKKALQTLENHLHLRTYLVGEQVTLA  156



>emb|CCA15330.1| calciumdependent protein 1 putative [Albugo laibachii Nc14]
Length=422

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 99/160 (62%), Gaps = 2/160 (1%)
 Frame = +2

Query  110  AMALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLET  289
            A  + L+S   N   FK L  AEY GV +E+ + F M  + K+ EFL  NP+GKVPVLET
Sbjct  13   ASKMKLYSYPGNYRVFKILIAAEYNGVDIEVPE-FDM-TTIKSKEFLAKNPLGKVPVLET  70

Query  290  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
             +G +FESNAIARYVA+++ D+ L G +  E G ++ W DF+A E++     WLYP  G+
Sbjct  71   ENGSLFESNAIARYVARLRADSGLSGRTFFESGQVDSWMDFSAHELEVPLQMWLYPVFGY  130

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            + +    +  A+  +K++L  L  HL   TYLVG  +TLA
Sbjct  131  MKFNAGTKAKAMEDVKKALQVLENHLHLRTYLVGEQITLA  170



>ref|XP_008891716.1| hypothetical protein PPTG_02396 [Phytophthora parasitica INRA-310]
 gb|ETN22467.1| hypothetical protein PPTG_02396 [Phytophthora parasitica INRA-310]
Length=229

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 92/155 (59%), Gaps = 1/155 (1%)
 Frame = +2

Query  125  LHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPI  304
            L++   N   FK L  AEY GV +EL + F      K+ EF    PIGKVP+LET +G +
Sbjct  3    LYTYPGNYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTL  61

Query  305  FESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  484
            FES AIARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +  
Sbjct  62   FESGAIARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNA  121

Query  485  PAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             A   A A +K++L  L  HL   TYLVG  VTLA
Sbjct  122  AALTKAKADVKKALQTLENHLHLRTYLVGEQVTLA  156



>gb|ABB02642.1| unknown [Solanum tuberosum]
Length=144

 Score =   125 bits (315),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  332  VAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIAS  511
            +  +KP+NPLFGSSLIEY  IEQW DF+ATE+DAN  +WLYPRLG+ +Y+P AEEA +A+
Sbjct  14   LLNLKPNNPLFGSSLIEYAQIEQWNDFSATEVDANIGRWLYPRLGYRVYIPAAEEAVVAA  73

Query  512  LKRSLTALNTHLASNTYLVGHSVTLA  589
            LKRSL ALNTHL+ NTYLVGH +TLA
Sbjct  74   LKRSLGALNTHLSCNTYLVGHLITLA  99



>ref|XP_002901767.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57157.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=406

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 95/159 (60%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M L L++   N  AFKAL  AE+ GV +EL + F      KT EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRAFKALIAAEFNGVDIELPE-FDFAKDVKTKEFKAKTPAGKVPLLETD  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFES AIA+YVA+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYVARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   A   A A +K++L  L  HL   TYLVG  +TLA
Sbjct  120  QFNAAALTKAKADVKKALQTLENHLHLRTYLVGEQITLA  158



>gb|ETI50094.1| hypothetical protein F443_06281, partial [Phytophthora parasitica 
P1569]
Length=172

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 93/159 (58%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M L L++   N   FKAL  AE+ G+ VEL + F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDVELPE-FDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   A   A   +K++L  L  HL   TYLVG  +TLA
Sbjct  120  KFNAAALTKAKDDVKKALQTLENHLHLRTYLVGEQITLA  158



>ref|XP_009519320.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
 gb|EGZ24032.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
Length=451

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 100/178 (56%), Gaps = 6/178 (3%)
 Frame = +2

Query  56   SQNK*LWWENCVGSF*SEAMALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNK  235
            SQ K L    CV     +A    L++   N   FK L  AEY G+ +EL K F M    K
Sbjct  33   SQAKMLLTSICV-----DAAEQKLYTYPGNYRVFKVLIAAEYNGIHIELPK-FDMAKDLK  86

Query  236  TPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFA  415
            T  F    P+GKVPVLET +G IFES AIARY+A+++PD  L+G +  E G ++ W DF+
Sbjct  87   TKSFKAKTPVGKVPVLETKEGTIFESGAIARYIARLRPDTGLYGKTFFESGQVDSWIDFS  146

Query  416  ATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            A E++     W++P LG   +   A   A A +K++L  L  HL   TYLVG  +TLA
Sbjct  147  AYELEVPLEVWVHPILGVGKFNAAALTKAKADVKKALQTLENHLHLRTYLVGEQITLA  204



>gb|ETK89985.1| hypothetical protein L915_06155, partial [Phytophthora parasitica]
 gb|ETP47804.1| hypothetical protein F442_06322, partial [Phytophthora parasitica 
P10297]
Length=192

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 93/159 (58%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M L L++   N   FKAL  AE+ G+ VEL + F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDVELPE-FDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   A   A   +K++L  L  HL   TYLVG  +TLA
Sbjct  120  KFNAAALTKAKDDVKKALQTLENHLHLRTYLVGEQITLA  158



>gb|EFA79702.1| glutathione S-transferase domain-containing protein [Polysphondylium 
pallidum PN500]
Length=432

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 99/159 (62%), Gaps = 2/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M+  +++  +N  A KAL  A+Y GV +++   F+    NK  E L  NP GKVP   TP
Sbjct  1    MSTTIYTYPQNPRAAKALIAAKYTGVTIDVPA-FEFSPVNKPVELLNANPFGKVPAAMTP  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
             GP+FESN+IARYVA+    + ++GS   E   I+QW DFA  E+++  A WLYP +GFV
Sbjct  60   QGPLFESNSIARYVARAA-GSKIYGSDAYEASVIDQWLDFATNEVESAAAAWLYPIMGFV  118

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +     + A  +LK++LT LNTHL S ++LVG  V+LA
Sbjct  119  PFNAKDTQKAKENLKKTLTTLNTHLQSRSFLVGPRVSLA  157



>emb|CDY04368.1| BnaC04g18250D [Brassica napus]
Length=263

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  311  SNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPA  490
            SNAI +YV +V  DN L GS +I+Y HIEQW DFA+ EIDAN  +W  PR+G+V +  PA
Sbjct  5    SNAITQYVCRVNGDNSLNGSFIIDYAHIEQWIDFASLEIDANMLRWFTPRMGYVAFSAPA  64

Query  491  EEAAIASLKRSLTALNTHLASNTYLVGHSVTL  586
            EEAAI+ LKR L ALNTHLAS+TYLVG S+TL
Sbjct  65   EEAAISGLKRGLDALNTHLASDTYLVGQSITL  96


 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 54/109 (50%), Gaps = 38/109 (35%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG  298
            LVL++   NK A+KAL VAEY  V +E   NFQMGV+NK+PEFLK+NPI +         
Sbjct  193  LVLNTYKGNKEAYKALIVAEYADVMIEEASNFQMGVTNKSPEFLKLNPIRE---------  243

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAK  445
                                          HIEQW DF++ EI+AN  +
Sbjct  244  -----------------------------AHIEQWIDFSSLEINANMLR  263



>gb|ETM49723.1| hypothetical protein L914_06088, partial [Phytophthora parasitica]
Length=215

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 93/159 (58%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M L L++   N   FKAL  AE+ G+ VEL + F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDVELPE-FDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   A   A   +K++L  L  HL   TYLVG  +TLA
Sbjct  120  KFNAAALTKAKDDVKKALQTLENHLHLRTYLVGEQITLA  158



>gb|ETL96579.1| hypothetical protein L917_05965, partial [Phytophthora parasitica]
Length=350

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = +2

Query  143  NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  322
            N   FK L  AEY GV +EL + F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  323  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  502
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +   A   A
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNAAALTKA  127

Query  503  IASLKRSLTALNTHLASNTYLVGHSVTLA  589
             A +K++L  L  HL   TYLVG  VTLA
Sbjct  128  KADVKKALQTLENHLHLRTYLVGEQVTLA  156



>gb|ETP19871.1| hypothetical protein F441_06281 [Phytophthora parasitica CJ01A1]
Length=407

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = +2

Query  143  NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  322
            N   FK L  AEY GV +EL + F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  12   NYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  70

Query  323  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  502
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +   A   A
Sbjct  71   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNAAALTKA  130

Query  503  IASLKRSLTALNTHLASNTYLVGHSVTLA  589
             A +K++L  L  HL   TYLVG  VTLA
Sbjct  131  KADVKKALQTLENHLHLRTYLVGEQVTLA  159



>gb|ETK89994.1| hypothetical protein L915_06152 [Phytophthora parasitica]
 gb|ETL43394.1| hypothetical protein L916_06088 [Phytophthora parasitica]
Length=404

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = +2

Query  143  NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  322
            N   FK L  AEY GV +EL + F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  323  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  502
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +   A   A
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNAAALTKA  127

Query  503  IASLKRSLTALNTHLASNTYLVGHSVTLA  589
             A +K++L  L  HL   TYLVG  VTLA
Sbjct  128  KADVKKALQTLENHLHLRTYLVGEQVTLA  156



>gb|ETL96570.1| hypothetical protein L917_05968, partial [Phytophthora parasitica]
Length=267

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 93/159 (58%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M L L++   N   FKAL  AE+ G+ +EL + F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDIELPE-FDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   A   A   +K++L  L  HL   TYLVG  +TLA
Sbjct  120  KFNAAALTKAKDDVKKALQTLENHLHLRTYLVGEQITLA  158



>ref|XP_006828297.1| hypothetical protein AMTR_s00023p00230860 [Amborella trichopoda]
 gb|ERM95713.1| hypothetical protein AMTR_s00023p00230860 [Amborella trichopoda]
Length=86

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL+LH  N NKNAFK L  AEY GV+V+L + F++ VSNKTPEF+KMNP+ KV VLETP
Sbjct  1    MALILHVGNNNKNAFKVLIAAEYAGVEVKLVEYFEVEVSNKTPEFIKMNPMCKVLVLETP  60

Query  293  DGPIFESNAIARYVAKVKPDNPLFGS  370
            +GPIFESNAIAR+VA++K DN L G+
Sbjct  61   EGPIFESNAIARFVARLKGDNILCGT  86



>gb|EWM21126.1| elongation factor 1 [Nannochloropsis gaditana]
Length=435

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 95/159 (60%), Gaps = 2/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            MAL L++   N  AFK L  A Y GV +++  +  +    +T + L  +P GKVPVLETP
Sbjct  1    MALKLYTNPGNFRAFKILVAALYNGVDIDVV-DLDLAAKKRT-DVLAKSPAGKVPVLETP  58

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
             G +FESNAIARY+A+ + D  L+G S  + G ++ W DFAA E++     W+YP  G++
Sbjct  59   QGLLFESNAIARYIARARRDTDLYGVSFFDSGLVDAWIDFAAQEVELPATLWVYPVFGYL  118

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +     E A A L  ++  L+ HLA  TYLVG  VTLA
Sbjct  119  PHNAAVTEKAKADLGAAMEILDNHLADKTYLVGEKVTLA  157



>ref|XP_005707114.1| elongation factor EF-1 gamma subunit [Galdieria sulphuraria]
 gb|EME30594.1| elongation factor EF-1 gamma subunit [Galdieria sulphuraria]
Length=1284

 Score =   130 bits (328),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 74/154 (48%), Positives = 90/154 (58%), Gaps = 4/154 (3%)
 Frame = +2

Query  134   PNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  313
             PN N  A KAL  AEY  V V++ K F+MG  NK+PEFLK+ P+GK+P LETP GP+ ES
Sbjct  895   PN-NPRAQKALIAAEYAQVSVQVPK-FEMGKDNKSPEFLKLFPLGKIPALETPQGPVSES  952

Query  314   NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRL--GFVIYLPP  487
              AIA Y AK++PD  L G+SL E   ++QW  FA      +    LYP    G   +   
Sbjct  953   PAIAWYFAKLRPDKGLCGNSLYEECQVQQWISFAEDAFAKHYPVLLYPYFMPGNFSFQEQ  1012

Query  488   AEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
               E A   +KR L  L  HL  NTYLVG  VTLA
Sbjct  1013  EAEKAKQQIKRYLDVLELHLLHNTYLVGERVTLA  1046



>emb|CBK21757.2| unnamed protein product [Blastocystis hominis]
Length=392

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 92/143 (64%), Gaps = 13/143 (9%)
 Frame = +2

Query  161  ALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVAK  340
            AL  A+Y  V + + K F+MGV NK+ EFLKMNP GKVPVL+TP+G IFES AIARYVA+
Sbjct  3    ALIAAQYNNVYIHVPK-FEMGVENKSEEFLKMNPNGKVPVLKTPEGAIFESTAIARYVAR  61

Query  341  VKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLKR  520
            ++ D  L G +  E G ++QW D+ AT I           +GF    P   E +  +LKR
Sbjct  62   MRNDTGLLGRTFFEEGKVDQWIDW-ATFI-----------MGFAPPNPKMVEQSKEALKR  109

Query  521  SLTALNTHLASNTYLVGHSVTLA  589
             L ALNT+LAS+T+L G  +TLA
Sbjct  110  PLAALNTYLASHTFLAGERITLA  132



>ref|XP_008891718.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETL43385.1| hypothetical protein L916_06090 [Phytophthora parasitica]
 gb|ETN22469.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETO78816.1| hypothetical protein F444_06339 [Phytophthora parasitica P1976]
 gb|ETP19873.1| hypothetical protein F441_06283 [Phytophthora parasitica CJ01A1]
Length=406

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 93/159 (58%), Gaps = 1/159 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETP  292
            M L L++   N   FKAL  AE+ G+ +EL + F      K+ EF    P GKVP+LET 
Sbjct  1    MVLKLYTYPGNYRVFKALIAAEFNGIDIELPE-FDFAKDIKSKEFKAKTPAGKVPLLETE  59

Query  293  DGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            +G IFES AIA+Y+A+++ D  L+G +  E G ++ W DF+A E++     WLYP LG+ 
Sbjct  60   EGCIFESGAIAKYIARLRADTGLYGKTFFESGQVDAWIDFSAYELEIPLEAWLYPILGWG  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             +   A   A   +K++L  L  HL   TYLVG  +TLA
Sbjct  120  KFNAAALTKAKDDVKKALQTLENHLHLRTYLVGEQITLA  158



>gb|AAL87298.1| unknown protein [Arabidopsis thaliana]
Length=345

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  320  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  499
            IARYV+++  DN L GSSLIEY  IEQW DF++ EI A+  +W  PR+GF+ Y  PAEE 
Sbjct  1    IARYVSRLNGDNSLNGSSLIEYAQIEQWIDFSSLEIYASILRWFGPRMGFMPYSAPAEEG  60

Query  500  AIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            AI++LKR+L ALNTHL SNTYLVGHS+TLA
Sbjct  61   AISTLKRALDALNTHLTSNTYLVGHSITLA  90



>sp|P12261.3|EF1G_ARTSA RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: 
Full=eEF-1B gamma [Artemia salina]
 pir||S00162 translation elongation factor eEF-1 gamma chain - brine shrimp
 gb|AAC83401.1| elongation factor 1-gamma [Artemia sp.]
Length=430

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 5/156 (3%)
 Frame = +2

Query  125  LHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG-P  301
            L++  EN  AFKAL  A+Y G K+E+ K+F  G +NK+  FLK  P+GKVP  E+ DG  
Sbjct  6    LYTYPENFRAFKALIAAQYSGAKLEIAKSFVFGETNKSDAFLKSFPLGKVPAFESADGHC  65

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  481
            I ESNAIA YVA    +  L GSS +E   I QW  FA TEI   +  W++P LG + + 
Sbjct  66   IAESNAIAYYVA----NETLRGSSDLEKAQIIQWMTFADTEILPASCTWVFPVLGIMQFN  121

Query  482  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
              A   A   + ++L AL+ HL + TYLVG  +TLA
Sbjct  122  KQATARAKEDIDKALQALDDHLLTRTYLVGERITLA  157



>dbj|GAN05559.1| hypothetical protein MAM1_0095c05030 [Mucor ambiguus]
Length=275

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 90/150 (60%), Gaps = 2/150 (1%)
 Frame = +2

Query  140  ENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  319
            +N    KA   AE  GV+  + + F +   + TPEFL   P+GK+PV E+ +  +FES++
Sbjct  12   QNPRVAKAQIAAELSGVEFNV-EAFDLA-KDATPEFLAKFPLGKIPVFESSEVNLFESSS  69

Query  320  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  499
            IA Y A  K +NPL G++ +E   + QWT F   EI  N   W+YP LG+  Y+ P  +A
Sbjct  70   IAYYAAAQKENNPLLGATAVEKAEVFQWTLFGENEIVTNLGGWVYPLLGYGPYMKPNVDA  129

Query  500  AIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            A   LKR+LTALN  L S TYLVGH VT A
Sbjct  130  ATDKLKRALTALNKVLESKTYLVGHQVTFA  159



>ref|NP_001083003.1| uncharacterized protein LOC100037382 [Danio rerio]
Length=430

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 93/156 (60%), Gaps = 5/156 (3%)
 Frame = +2

Query  125  LHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG-P  301
            L++  EN  AFKAL  A+Y G K+E+ K F  G +NK+  FLK  P+GKVP  E+ DG  
Sbjct  6    LYTYPENFRAFKALIAAQYSGAKLEIAKGFVFGETNKSDAFLKKFPLGKVPAFESADGHC  65

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  481
            I ESNAIA YVA    +  L GSS +E   I QW  FA TEI   +  W++P LG + + 
Sbjct  66   IAESNAIAYYVA----NETLRGSSDLEKAQIIQWMTFADTEILPASCTWVFPVLGIMQFN  121

Query  482  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
              A   A   + ++L AL+ HL + TYLVG  +TLA
Sbjct  122  KQATARAKEDIDKALQALDDHLLTRTYLVGERITLA  157



>gb|ETM49731.1| hypothetical protein L914_06086, partial [Phytophthora parasitica]
Length=148

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 83/141 (59%), Gaps = 1/141 (1%)
 Frame = +2

Query  143  NKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAI  322
            N   FK L  AEY GV +EL + F      K+ EF    PIGKVP+LET +G +FES AI
Sbjct  9    NYRVFKVLIAAEYNGVDIELPE-FDFAKDIKSKEFKAKTPIGKVPILETEEGTLFESGAI  67

Query  323  ARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAA  502
            ARYVA+++PD  L+G +  E G ++ W DF+A E++     W++P LG   +   A   A
Sbjct  68   ARYVARLRPDTGLYGKTFFESGQVDAWIDFSAYELEVPLEVWVHPILGVGKFNAAALTKA  127

Query  503  IASLKRSLTALNTHLASNTYL  565
             A +K++L  L  HL   TYL
Sbjct  128  KADVKKALQTLENHLHLRTYL  148



>gb|EPB85278.1| hypothetical protein HMPREF1544_07959 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=408

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 94/150 (63%), Gaps = 2/150 (1%)
 Frame = +2

Query  140  ENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNA  319
            +N    KA   AE  GV+  + + F +   + +PEFL   P+GK+PVLE+ +  +FES++
Sbjct  12   QNPRVAKAQITAELSGVEFNV-EAFDLA-KDASPEFLTKFPLGKIPVLESSEVNLFESSS  69

Query  320  IARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEA  499
            IA Y A  K +NPL G++  E   I QWT F+  EI+AN A W+YP +G++ Y+ P  +A
Sbjct  70   IAYYAAAQKENNPLLGATAAEKAEIFQWTLFSENEINANIAGWVYPLMGYMNYMKPNVDA  129

Query  500  AIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            A   +KR+L ALN  L S TYLVGH +T A
Sbjct  130  ATERVKRALAALNKILESKTYLVGHQITFA  159



>gb|ADV40141.1| elongation factor-1 gamma [Latrodectus hesperus]
Length=321

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 92/159 (58%), Gaps = 5/159 (3%)
 Frame = +2

Query  116  ALVLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPD  295
            A  LH+   N  A K L  A+Y G K+ ++ +F +G +N+T EFLK  P GKVP LETPD
Sbjct  4    ACTLHTYPNNFRAQKILIAAQYSGTKINVSDDFTLGQTNQTTEFLKKFPNGKVPALETPD  63

Query  296  GP-IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
               I ESNAIA YV     ++ L G ++++   I+ W DF   EI  +   W++P LG +
Sbjct  64   NKYISESNAIAHYVG----NDQLRGENVLQQSLIKMWIDFGDHEILPSACTWVFPCLGIL  119

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y     E A   +KR+L  LN HL +NTYLVG  +T A
Sbjct  120  QYNKQNTEKAKEQIKRTLKILNDHLLTNTYLVGERITQA  158



>dbj|GAM21220.1| hypothetical protein SAMD00019534_043950 [Acytostelium subglobosum 
LB1]
Length=416

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 97/160 (61%), Gaps = 2/160 (1%)
 Frame = +2

Query  113  MALVLHSPNENKNAFKALTVAEYCGVKVELTK-NFQMGVSNKTPEFLKMNPIGKVPVLET  289
            M++ + +   N  A K+L  A+Y GV +E+   +     +NK  E +  NP GKVP   T
Sbjct  1    MSVSIITYPSNPRACKSLIAAKYTGVNIEIPNVDLSQLATNKPVELMNANPFGKVPAAMT  60

Query  290  PDGPIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGF  469
            P GP+FESN+IARYVA+ +  N ++G+   E   I+QW DF++ EI++    WLYP LG+
Sbjct  61   PQGPLFESNSIARYVAR-QGGNKIYGNDAYEASVIDQWLDFSSNEIESAAVAWLYPILGY  119

Query  470  VIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
              +     + A  ++K++LT LNTHL S ++L G  VTLA
Sbjct  120  GQFNAKETQKAKDNIKKTLTTLNTHLQSRSFLCGARVTLA  159



>ref|XP_005760139.1| hypothetical protein EMIHUDRAFT_438506 [Emiliania huxleyi CCMP1516]
 gb|EOD07710.1| hypothetical protein EMIHUDRAFT_438506 [Emiliania huxleyi CCMP1516]
Length=189

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 97/155 (63%), Gaps = 1/155 (1%)
 Frame = +2

Query  125  LHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPI  304
            L++   N +A + L VA Y GV +E+   F+MG  NK+  FLK +P+GKVPVLET  G I
Sbjct  3    LYTFAGNTHALQTLIVARYNGVDIEVPA-FEMGKDNKSAAFLKKSPLGKVPVLETASGCI  61

Query  305  FESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLP  484
             E+ A+ARYVA+++ D  +FG++  E G ++ W +FA  E+D     W++P LGF+    
Sbjct  62   CEAAAVARYVARMRADTNMFGATFFEAGQVDMWVEFAKNELDLPVGMWVFPILGFIASNA  121

Query  485  PAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
               + A   + R+L  +N HL S T+LVG +VTLA
Sbjct  122  ANTKQAQEDIARALGVMNEHLQSRTFLVGDAVTLA  156



>ref|XP_008557385.1| PREDICTED: elongation factor 1-gamma [Microplitis demolitor]
Length=427

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 95/157 (61%), Gaps = 5/157 (3%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG-  298
             L++  EN  A+KAL  A+Y G ++++  NF  G SNK+ EFL+  P+GKVP  E+ DG 
Sbjct  5    TLYTYAENFRAYKALIAAQYSGAQIKVADNFVFGESNKSKEFLQKFPLGKVPAFESKDGV  64

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
             + ESNAIA YVA    +  L G S  E   + QW DFA +EI  ++   ++P LG + Y
Sbjct  65   RLTESNAIAYYVA----NEQLRGKSDKEKAEVIQWLDFADSEILPSSCACVFPLLGIMPY  120

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
                 E A   L +SL+ALNTHL S TYLVG  +TLA
Sbjct  121  NKQTVENAKEDLAKSLSALNTHLLSKTYLVGERITLA  157



>ref|XP_006392372.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29658.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=350

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  332  VAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIAS  511
            V+++  +N L GSSLI+Y HIEQW DFA  EIDAN  +W  PR+GF  +  PAEEAAIA 
Sbjct  10   VSRLNGENSLNGSSLIDYAHIEQWIDFATLEIDANMLRWFAPRMGFAPFSAPAEEAAIAG  69

Query  512  LKRSLTALNTHLASNTYLVGHSVTLA  589
            L R L ALNTHLASNTYLVGHSVTLA
Sbjct  70   LNRGLDALNTHLASNTYLVGHSVTLA  95



>emb|CEI89465.1| hypothetical protein RMCBS344292_03820 [Rhizopus microsporus]
Length=407

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = +2

Query  134  PNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  313
            PN N    KA   A Y G++  + + F +   ++TPEF    P+GK+PVLE+    +FES
Sbjct  11   PN-NARVAKACIAAAYNGLEFNV-EEFDLA-KDRTPEFYAKFPLGKIPVLESAQVDLFES  67

Query  314  NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAE  493
            +AI  Y A +K D+PL G + +E   I QW  F  TE++ N   WLYP LGF+ YL P+ 
Sbjct  68   SAIGYYAAALKEDSPLLGKNAVEKALILQWVLFCETELNTNLGGWLYPLLGFMPYLKPSV  127

Query  494  EAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            + A A+ KR+L ALN+ L + TYLVG+ VT A
Sbjct  128  DTATANFKRALGALNSVLLTKTYLVGNDVTYA  159



>ref|XP_007439957.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Python 
bivittatus]
Length=432

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 97/164 (59%), Gaps = 8/164 (5%)
 Frame = +2

Query  110  AMALVLHSPNENKNAFKALTVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPV  280
            A+A  L++  EN  AFKAL  A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AVAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  281  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  457
             E  DG  IFESNAIA YV+    +  L G++      + QW  FA ++I    + W++P
Sbjct  62   FEGDDGFCIFESNAIAHYVS----NEELRGATKESAAQVLQWVSFADSDIVPPASTWVFP  117

Query  458  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             LG + Y   A E+A   +KR L+ L+ HL + T+LVG  +TLA
Sbjct  118  TLGIMQYNKQATESAKEEVKRILSLLDIHLKTRTFLVGERITLA  161



>emb|CEG74026.1| hypothetical protein RMATCC62417_09299 [Rhizopus microsporus]
Length=407

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = +2

Query  134  PNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFES  313
            PN N    KA   A Y G++  + + F +   ++TPEF    P+GK+PVLE+    +FES
Sbjct  11   PN-NARVAKACIAAAYNGLEFNV-EEFDLA-KDRTPEFYAKFPLGKIPVLESAQVDLFES  67

Query  314  NAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAE  493
            +AI  Y A +K D+PL G + +E   I QW  F  TE++ N   WLYP LGF+ YL P+ 
Sbjct  68   SAIGYYAAALKEDSPLLGKNAVEKALILQWVLFCETELNTNLGGWLYPLLGFMPYLKPSV  127

Query  494  EAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
            + A A+ KR+L ALN+ L + TYLVG+ VT A
Sbjct  128  DTATANFKRALGALNSVLLTKTYLVGNDVTYA  159



>ref|XP_007056947.1| PREDICTED: elongation factor 1-gamma [Chelonia mydas]
Length=432

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 96/164 (59%), Gaps = 8/164 (5%)
 Frame = +2

Query  110  AMALVLHSPNENKNAFKALTVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPV  280
            A A  L++  EN  AFKAL  A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AAAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  281  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  457
             E  DG  +FESNAIA YV+    ++ L GS+      I QW  FA ++I    + W++P
Sbjct  62   FEGADGFCVFESNAIAHYVS----NDDLRGSTKETAAQIIQWVSFADSDIVPPASTWVFP  117

Query  458  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             LG + Y   A E A   +KR L  L++HL + T+LVG  +TLA
Sbjct  118  TLGIMHYNKQATEYAKEEVKRVLGILDSHLKTQTFLVGERITLA  161



>ref|XP_005988901.1| PREDICTED: elongation factor 1-gamma-like [Latimeria chalumnae]
Length=436

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 95/159 (60%), Gaps = 8/159 (5%)
 Frame = +2

Query  125  LHSPNENKNAFKALTVAEYCG--VKVELTK-NFQMGVSNKTPEFLKMNPIGKVPVLETPD  295
            L++  EN  AFKAL  A+Y G  VKV+ T   F  G SNKTPEFL+  P+GKVP  E  D
Sbjct  6    LYTYPENWRAFKALIAAQYSGATVKVQSTPPQFHFGQSNKTPEFLQKFPLGKVPAFEGDD  65

Query  296  G-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFV  472
            G  +FESNAIA YV+    ++ L GSS +    + QW  FA +EI    + W++P LG +
Sbjct  66   GFCVFESNAIAHYVS----NDELRGSSKVAAAQVIQWMSFADSEIVPPASTWVFPTLGIM  121

Query  473  IYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             Y   A E A   +K+ L  L+ HL + T+LVG  VTLA
Sbjct  122  QYNKQATEHAKEEVKKVLGVLDLHLQTRTFLVGERVTLA  160



>emb|CEI97373.1| hypothetical protein RMCBS344292_11508 [Rhizopus microsporus]
Length=407

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 91/144 (63%), Gaps = 2/144 (1%)
 Frame = +2

Query  158  KALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVA  337
            KA   A Y G++  + + F +   ++TPEF    P+GK+PVLE+    +FES+AI  Y A
Sbjct  18   KACIAAAYNGLEFNV-EQFDLA-KDRTPEFYARFPLGKIPVLESAQVNLFESSAIGYYAA  75

Query  338  KVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYLPPAEEAAIASLK  517
             +K D+PL G + +E   I QW  F  TE+++N   WLYP +GF+ YL P+ + A A+ K
Sbjct  76   ALKEDSPLLGKNAVEKALIMQWVLFCETELNSNLGGWLYPLMGFMPYLKPSVDTATANFK  135

Query  518  RSLTALNTHLASNTYLVGHSVTLA  589
            R+L ALN+ L + TYLVG+ VT A
Sbjct  136  RALGALNSVLLTKTYLVGNDVTYA  159



>ref|XP_011334294.1| PREDICTED: elongation factor 1-gamma [Cerapachys biroi]
 gb|EZA57052.1| Elongation factor 1-gamma [Cerapachys biroi]
Length=429

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 95/157 (61%), Gaps = 5/157 (3%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
             L++  EN  A+KAL  A++ GV++++ ++F  G +NKT  FLK  P+GKVP  ET DG 
Sbjct  5    TLYTYPENFRAYKALIAAQFSGVQIKIAEDFVFGQTNKTEAFLKKFPLGKVPAFETDDGK  64

Query  302  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
             I ESNAIA YVA    +  L G S +E   I QW  FA +EI   +  W++P LG + Y
Sbjct  65   YITESNAIAYYVA----NEQLRGKSDVERALILQWLGFADSEILPASCAWVFPLLGIMSY  120

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
                 E A   + ++LT LN+HL + TYLVG  +TLA
Sbjct  121  NKQTIEHAKEDVYKALTTLNSHLLTRTYLVGERLTLA  157



>ref|XP_006566786.1| PREDICTED: elongation factor 1-gamma-like [Apis mellifera]
 ref|XP_006621654.1| PREDICTED: elongation factor 1-gamma-like [Apis dorsata]
Length=425

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 95/157 (61%), Gaps = 5/157 (3%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
             L++  EN  A+K L  A+Y G ++++  +F  G +NKT  FLK  P+GKVP  ET DG 
Sbjct  5    TLYTYPENFRAYKVLIAAQYSGAQIKIADDFVFGETNKTEAFLKKFPLGKVPAFETCDGK  64

Query  302  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
             I ESNAIA YVA    ++ L G + +E   I QW  FA +EI   +  W++P LG + Y
Sbjct  65   YITESNAIAYYVA----NDQLKGKTDLERAEIIQWFGFADSEILPASCAWVFPLLGIMPY  120

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
                 E A   +K++LTALN+HL + TYLVG  +TLA
Sbjct  121  NKQNVEHAKDDVKKALTALNSHLLTRTYLVGERLTLA  157



>emb|CDS12960.1| hypothetical protein LRAMOSA05144 [Absidia idahoensis var. thermophila]
Length=401

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 93/156 (60%), Gaps = 2/156 (1%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            V+ S  EN N +KA   A Y GVKV+  ++F + +  +   F +  P GKVPV E  +  
Sbjct  5    VIKSYPENPNVYKAQIAAAYSGVKVDF-QSFDI-MKERDEAFWQRFPFGKVPVFEGKEAN  62

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  481
            +FES+AIA Y+   + D+PL G + +E   I+QW  F+  EI  + + W+ P LG+  Y+
Sbjct  63   LFESSAIALYILAQQQDSPLLGKTPLEQAEIQQWVLFSENEISQHVSGWVAPLLGYSPYI  122

Query  482  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             P+ ++AI  L+RSL ALN  L S TYLVG  VT A
Sbjct  123  KPSVDSAIQKLQRSLGALNKSLESKTYLVGERVTYA  158



>ref|XP_011162880.1| PREDICTED: elongation factor 1-gamma [Solenopsis invicta]
Length=438

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 94/157 (60%), Gaps = 5/157 (3%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            +L++  EN  A+KAL  A++ G ++++  +F  G SNK+  FLK  P+GKVP  ET DG 
Sbjct  5    ILYTYPENFRAYKALIAAQFSGTQIKVADDFVFGESNKSATFLKKFPLGKVPAFETCDGK  64

Query  302  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
             I ESNAIA YVA    +  L G + IE   I QW  FA +EI   +  W++P LG + Y
Sbjct  65   YITESNAIAYYVA----NEQLRGKTDIERALIIQWLGFADSEILPASCAWVFPLLGLMAY  120

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
                 E A   + ++L ALN+HL + TYLVG  +TLA
Sbjct  121  HKQTVENAKEDINKALAALNSHLLTRTYLVGERLTLA  157



>gb|EFZ22579.1| hypothetical protein SINV_13881 [Solenopsis invicta]
Length=434

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 94/157 (60%), Gaps = 5/157 (3%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            +L++  EN  A+KAL  A++ G ++++  +F  G SNK+  FLK  P+GKVP  ET DG 
Sbjct  1    ILYTYPENFRAYKALIAAQFSGTQIKVADDFVFGESNKSATFLKKFPLGKVPAFETCDGK  60

Query  302  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
             I ESNAIA YVA    +  L G + IE   I QW  FA +EI   +  W++P LG + Y
Sbjct  61   YITESNAIAYYVA----NEQLRGKTDIERALIIQWLGFADSEILPASCAWVFPLLGLMAY  116

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
                 E A   + ++L ALN+HL + TYLVG  +TLA
Sbjct  117  HKQTVENAKEDINKALAALNSHLLTRTYLVGERLTLA  153



>ref|XP_006113632.1| PREDICTED: elongation factor 1-gamma [Pelodiscus sinensis]
Length=432

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 95/164 (58%), Gaps = 8/164 (5%)
 Frame = +2

Query  110  AMALVLHSPNENKNAFKALTVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPV  280
            A A  L++  EN  AFKAL  A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AAAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  281  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  457
             E  DG  +FESNAIA YV+    ++ L GS+      I QW  FA ++I    + W++P
Sbjct  62   FEGADGFCVFESNAIAHYVS----NDELRGSTKETAAQIIQWVSFADSDIVPPASTWVFP  117

Query  458  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             LG + Y   A E A   +KR L  L+ HL + T+LVG  +TLA
Sbjct  118  TLGIMHYNKQATEYAKEEVKRILGILDFHLKTRTFLVGERITLA  161



>ref|XP_008172336.1| PREDICTED: elongation factor 1-gamma [Chrysemys picta bellii]
Length=432

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 96/164 (59%), Gaps = 8/164 (5%)
 Frame = +2

Query  110  AMALVLHSPNENKNAFKALTVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPV  280
            A A  L++  EN  AFKAL  A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AAAGTLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  281  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  457
             E  DG  +FESNAI+ YV+    ++ L GS+      I QW  FA ++I    + W++P
Sbjct  62   FEGADGFCVFESNAISHYVS----NDELRGSTKEIAAQIIQWVSFADSDIVPPASTWVFP  117

Query  458  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             LG + Y   A E A   +KR L  L++HL + T+LVG  +TLA
Sbjct  118  TLGIMHYNKQATEYAKEEVKRVLGILDSHLKTQTFLVGERITLA  161



>gb|KDR22664.1| Elongation factor 1-gamma, partial [Zootermopsis nevadensis]
Length=435

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 91/157 (58%), Gaps = 5/157 (3%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
             L++  EN  A+K L  A+Y G  V++   F  G +NKT  FLK  P+GKVP  ET DG 
Sbjct  1    TLYTYPENFRAYKVLIAAQYAGGNVKVAPGFVFGETNKTEAFLKKFPLGKVPAFETADGQ  60

Query  302  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
             + ESNAIA YVA    D  L G S +E   + QW  FA +EI   +  W++P LG + Y
Sbjct  61   YLTESNAIAYYVA----DARLRGQSDLEKAQVIQWLGFADSEILPASCAWVFPCLGIMQY  116

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
               + E A   +K +L ALNTHL   TYLVG ++TLA
Sbjct  117  NKQSTERAKEDVKSALQALNTHLLPRTYLVGETITLA  153



>ref|XP_011152520.1| PREDICTED: elongation factor 1-gamma [Harpegnathos saltator]
 gb|EFN75715.1| Elongation factor 1-gamma [Harpegnathos saltator]
Length=433

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 95/157 (61%), Gaps = 5/157 (3%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDG-  298
             L++  EN  A+KAL  A++ G ++++ ++F  G +NK+  FLK  P+GKVP  ET DG 
Sbjct  5    TLYTYPENFRAYKALIAAQFSGARIKVAEDFVFGETNKSEAFLKKFPLGKVPAFETCDGN  64

Query  299  PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
             I ESNAIA YVA    +  L G + IE   + QW DFA +EI   +  W++P LG + Y
Sbjct  65   CITESNAIAYYVA----NEQLKGKTDIERALVIQWLDFADSEILPASCAWVFPLLGIMPY  120

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
                 E A   + ++LT LN+HL + TYLVG  +TLA
Sbjct  121  HKQTVEHAKEDINKALTVLNSHLLTRTYLVGERLTLA  157



>ref|XP_003229963.2| PREDICTED: elongation factor 1-gamma [Anolis carolinensis]
 ref|XP_003230803.2| PREDICTED: elongation factor 1-gamma [Anolis carolinensis]
Length=432

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 96/164 (59%), Gaps = 8/164 (5%)
 Frame = +2

Query  110  AMALVLHSPNENKNAFKALTVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPV  280
            A A  L++  EN  AFK L  A+Y G K+++      F  G +NKTPEFLK  P+GKVP 
Sbjct  2    AAAGTLYTYPENWRAFKVLIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPA  61

Query  281  LETPDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYP  457
             E  DG  +FESNAIA YV+    +  L G++      + QW  FA ++I    + W++P
Sbjct  62   FEGDDGFCVFESNAIAHYVS----NEELRGATKEAAAQVLQWVSFADSDIVPPASTWVFP  117

Query  458  RLGFVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             LG + Y   A E+A   +KR L+ L++HL + T+LVG  VTLA
Sbjct  118  TLGIMHYNKQATESAKDEVKRILSLLDSHLKTRTFLVGERVTLA  161



>gb|EMP38506.1| Elongation factor 1-gamma [Chelonia mydas]
Length=622

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 95/161 (59%), Gaps = 8/161 (5%)
 Frame = +2

Query  119  LVLHSPNENKNAFKALTVAEYCGVKVELTK---NFQMGVSNKTPEFLKMNPIGKVPVLET  289
            + L++  EN  AFKAL  A+Y G K+++      F  G +NKTPEFLK  P+GKVP  E 
Sbjct  195  ITLYTYPENWRAFKALIAAQYSGAKIKVLSTPPQFHFGQTNKTPEFLKKFPVGKVPAFEG  254

Query  290  PDG-PIFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLG  466
             DG  +FESNAIA YV+    ++ L GS+      I QW  FA ++I    + W++P LG
Sbjct  255  ADGFCVFESNAIAHYVS----NDDLRGSTKETAAQIIQWVSFADSDIVPPASTWVFPTLG  310

Query  467  FVIYLPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             + Y   A E A   +KR L  L++HL + T+LVG  +TLA
Sbjct  311  IMHYNKQATEYAKEEVKRVLGILDSHLKTQTFLVGERITLA  351



>ref|XP_011264946.1| PREDICTED: elongation factor 1-gamma [Camponotus floridanus]
Length=438

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 94/157 (60%), Gaps = 5/157 (3%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
             L++  EN  A+KAL  A++ G +V++ ++F  G +NKT  FLK  P+GKVP  ET DG 
Sbjct  5    TLYTYPENFRAYKALIAAQFSGAQVKVAEDFIFGETNKTEAFLKKFPLGKVPAFETTDGK  64

Query  302  -IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIY  478
             I ESNAIA YVA    +  L G + IE   I QW  FA +EI   +  W++P LG + Y
Sbjct  65   YITESNAIAYYVA----NEQLRGKTDIERALIIQWLGFADSEILPASCAWVFPLLGIMPY  120

Query  479  LPPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
                 E A   + ++L ALN+HL + TYLVG  +TLA
Sbjct  121  HKQTVEHAKEDINKALNALNSHLLTRTYLVGERLTLA  157



>emb|CDH55788.1| elongation factor 1-gamma [Lichtheimia corymbifera JMRC:FSU:9682]
Length=403

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 91/156 (58%), Gaps = 2/156 (1%)
 Frame = +2

Query  122  VLHSPNENKNAFKALTVAEYCGVKVELTKNFQMGVSNKTPEFLKMNPIGKVPVLETPDGP  301
            V+ S  EN N +K    A Y GVKV+  ++F + +  +   F +  P GKVPV E  +  
Sbjct  5    VIKSYPENPNVYKVQIAAAYSGVKVDF-QSFDI-MKERDEAFWQRFPFGKVPVFEGKEAN  62

Query  302  IFESNAIARYVAKVKPDNPLFGSSLIEYGHIEQWTDFAATEIDANTAKWLYPRLGFVIYL  481
            +FES+AI  YV   + D+PL G + +E   I+QW  F+  EI  + + W+ P LG+  Y+
Sbjct  63   LFESSAITLYVLAQQKDSPLLGKTPLEQAEIQQWVLFSENEISQHVSGWVAPLLGYAQYI  122

Query  482  PPAEEAAIASLKRSLTALNTHLASNTYLVGHSVTLA  589
             P  E++I  L+RSL+ALN  L S TYLVG  VT A
Sbjct  123  KPNVESSIQKLQRSLSALNKSLESKTYLVGEDVTYA  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925