BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF007A24

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             250   5e-78   Nicotiana benthamiana
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   7e-78   Nicotiana sylvestris
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   9e-78   Nicotiana tomentosiformis
emb|CDP18560.1|  unnamed protein product                                244   3e-76   Coffea canephora [robusta coffee]
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                241   2e-74   Arachis hypogaea [goober]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   5e-74   Nelumbo nucifera [Indian lotus]
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   1e-73   Fragaria vesca subsp. vesca
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   9e-73   Solanum tuberosum [potatoes]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         236   1e-72   Morus notabilis
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         236   1e-72   Medicago truncatula
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    235   2e-72   Nicotiana tabacum [American tobacco]
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    234   4e-72   Solanum lycopersicum
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   1e-71   Eucalyptus grandis [rose gum]
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   2e-71   Solanum lycopersicum
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       232   4e-71   Medicago sativa [alfalfa]
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    232   5e-71   Nelumbo nucifera [Indian lotus]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   9e-71   Sesamum indicum [beniseed]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    230   2e-70   Theobroma cacao [chocolate]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    230   2e-70   Cucumis melo [Oriental melon]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              230   2e-70   Scoparia dulcis [escobilla]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   4e-70   Prunus mume [ume]
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    229   4e-70   Pyrus x bretschneideri [bai li]
gb|EPS59235.1|  hypothetical protein M569_15573                         229   6e-70   Genlisea aurea
gb|KJB70723.1|  hypothetical protein B456_011G088800                    229   7e-70   Gossypium raimondii
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    228   8e-70   Gossypium arboreum [tree cotton]
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   8e-70   Malus domestica [apple tree]
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   1e-69   Cicer arietinum [garbanzo]
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             228   1e-69   Citrus clementina [clementine]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             228   1e-69   Prunus persica
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   2e-69   Malus domestica [apple tree]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    228   3e-69   Ricinus communis
gb|KJB11771.1|  hypothetical protein B456_001G276400                    227   3e-69   Gossypium raimondii
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    226   3e-69   Gossypium arboreum [tree cotton]
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             227   5e-69   Cucumis sativus [cucumbers]
emb|CAA33264.1|  unnamed protein product                                226   5e-69   Pisum sativum [garden pea]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    226   6e-69   Pisum sativum [garden pea]
tpg|DAA37468.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         222   6e-69   
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   7e-69   Citrus sinensis [apfelsine]
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   7e-69   
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         226   9e-69   Jatropha curcas
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   226   1e-68   Citrus sinensis [apfelsine]
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   227   1e-68   Citrus sinensis [apfelsine]
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   1e-68   
gb|ABK96233.1|  unknown                                                 225   2e-68   Populus trichocarpa x Populus deltoides
emb|CBI21236.3|  unnamed protein product                                222   2e-68   Vitis vinifera
gb|ABK96725.1|  unknown                                                 225   2e-68   Populus trichocarpa x Populus deltoides
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   2e-68   Cucumis melo [Oriental melon]
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   2e-68   Populus euphratica
gb|AGJ50596.1|  GAPDH                                                   225   2e-68   Pericallis cruenta
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                224   4e-68   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   5e-68   Populus euphratica
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             224   5e-68   Populus trichocarpa [western balsam poplar]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                224   5e-68   Mangifera indica
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    224   5e-68   Arabis alpina [alpine rockcress]
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             223   8e-68   Eutrema salsugineum [saltwater cress]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   9e-68   Brassica rapa
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               223   9e-68   Brassica rapa subsp. chinensis [bok-choy]
emb|CDY19412.1|  BnaC05g09210D                                          223   1e-67   Brassica napus [oilseed rape]
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             223   2e-67   
emb|CDY26599.1|  BnaA09g46780D                                          223   2e-67   Brassica napus [oilseed rape]
gb|ABK94956.1|  unknown                                                 222   2e-67   Populus trichocarpa [western balsam poplar]
emb|CAN78872.1|  hypothetical protein VITISV_021726                     222   3e-67   Vitis vinifera
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   3e-67   Vitis vinifera
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    222   4e-67   Spinacia oleracea
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         221   5e-67   
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   5e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   5e-67   Setaria italica
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   6e-67   Brassica rapa
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    221   8e-67   Zea mays [maize]
emb|CAA30152.1|  GADPH (383 AA)                                         220   9e-67   Zea mays [maize]
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             220   1e-66   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   1e-66   
emb|CDY16038.1|  BnaC08g40850D                                          220   1e-66   Brassica napus [oilseed rape]
ref|XP_002892719.1|  GAPA-2                                             220   2e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   2e-66   
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    220   2e-66   Glycine soja [wild soybean]
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                221   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   3e-66   Oryza brachyantha
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    219   3e-66   Arabis alpina [alpine rockcress]
ref|NP_001052984.1|  Os04g0459500                                       219   3e-66   
gb|AGV54738.1|  glyceraldehyde-3-phosphate dehydrogenase A chloro...    217   3e-66   Phaseolus vulgaris [French bean]
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   3e-66   
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             219   3e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   4e-66   
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    220   6e-66   
gb|ACU21011.1|  unknown                                                 218   7e-66   Glycine max [soybeans]
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    218   8e-66   Glycine soja [wild soybean]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        218   8e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          218   8e-66   Amborella trichopoda
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   1e-65   Camelina sativa [gold-of-pleasure]
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              218   1e-65   Phaseolus vulgaris [French bean]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             218   2e-65   Phaseolus vulgaris [French bean]
dbj|BAJ34149.1|  unnamed protein product                                217   2e-65   Eutrema halophilum
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    217   2e-65   
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    217   2e-65   Brachypodium distachyon [annual false brome]
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               217   3e-65   Marchantia polymorpha
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    215   4e-65   Marchantia polymorpha
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    215   5e-65   Triticum urartu
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             216   7e-65   Capsella rubella
dbj|BAJ90885.1|  predicted protein                                      216   7e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   7e-65   
ref|XP_002875330.1|  gapa                                               216   8e-65   Arabidopsis lyrata subsp. lyrata
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                216   8e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   9e-65   Camelina sativa [gold-of-pleasure]
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    215   9e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    214   2e-64   Camelina sativa [gold-of-pleasure]
dbj|BAJ90530.1|  predicted protein                                      214   2e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX83635.1|  BnaC07g23750D                                          214   2e-64   
emb|CDY28536.1|  BnaC02g36240D                                          214   2e-64   Brassica napus [oilseed rape]
emb|CDY13649.1|  BnaA06g32740D                                          213   3e-64   Brassica napus [oilseed rape]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    214   4e-64   Brassica rapa
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    214   4e-64   Tarenaya hassleriana [spider flower]
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             210   2e-63   
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    209   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_001779769.1|  predicted protein                                  210   1e-62   
ref|XP_001771209.1|  predicted protein                                  209   3e-62   
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     207   6e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             208   8e-62   Selaginella moellendorffii
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             208   8e-62   Selaginella moellendorffii
gb|ABK25233.1|  unknown                                                 208   1e-61   Picea sitchensis
gb|ACN40000.1|  unknown                                                 207   1e-61   Picea sitchensis
gb|ABK24313.1|  unknown                                                 207   1e-61   Picea sitchensis
gb|ACN40537.1|  unknown                                                 207   1e-61   Picea sitchensis
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    207   2e-61   
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    207   2e-61   
ref|XP_010458726.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    203   4e-61   Camelina sativa [gold-of-pleasure]
dbj|BAH57068.1|  AT1G12900                                              204   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    201   6e-60   
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      201   8e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    202   2e-59   
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  202   2e-59   Pinus sylvestris [Scotch pine]
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              199   3e-59   Brassica rapa subsp. chinensis [bok-choy]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                199   5e-59   Lilium regale
ref|XP_001771246.1|  predicted protein                                  200   9e-59   
gb|AAB82133.1|  glyceralehyde-3-phosphate dehydrogenase subunit         197   2e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_001766703.1|  predicted protein                                  198   3e-58   
ref|XP_001779753.1|  predicted protein                                  196   2e-57   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    195   3e-57   
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               194   3e-57   Capsicum annuum
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    196   5e-57   Zea mays [maize]
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    193   6e-57   Arabidopsis thaliana [mouse-ear cress]
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    193   1e-56   Spinacia oleracea
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    193   1e-56
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    193   1e-56   Spinacia oleracea
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               192   1e-56   Capsicum annuum
emb|CDY48981.1|  BnaA02g28150D                                          192   3e-56   Brassica napus [oilseed rape]
ref|XP_001753934.1|  predicted protein                                  193   3e-56   
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     192   3e-56   Physcomitrella patens
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    192   3e-56   Spinacia oleracea
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    191   7e-56   Spinacia oleracea
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                189   9e-55   Syntrichia caninervis
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               185   7e-54   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              186   8e-54   Volvox carteri f. nagariensis
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               183   4e-53   Spirogyra sp.
gb|KDO85183.1|  hypothetical protein CISIN_1g012940mg                   181   5e-53   Citrus sinensis [apfelsine]
gb|KDO85177.1|  hypothetical protein CISIN_1g012940mg                   182   8e-53   Citrus sinensis [apfelsine]
ref|XP_006383782.1|  hypothetical protein POPTR_0005s27550g             182   8e-53   
gb|KDO85181.1|  hypothetical protein CISIN_1g012940mg                   181   9e-53   Citrus sinensis [apfelsine]
gb|KDO85176.1|  hypothetical protein CISIN_1g012940mg                   182   1e-52   Citrus sinensis [apfelsine]
ref|XP_006435407.1|  hypothetical protein CICLE_v10001114mg             182   1e-52   
gb|KDO85179.1|  hypothetical protein CISIN_1g012940mg                   180   1e-52   Citrus sinensis [apfelsine]
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               186   1e-52   Chara vulgaris
ref|XP_003603852.1|  Glyceraldehyde-3-phosphate dehydrogenase           180   2e-52   
gb|KDO85175.1|  hypothetical protein CISIN_1g012940mg                   181   2e-52   Citrus sinensis [apfelsine]
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               181   3e-52   Sphagnum cuspidatum
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   3e-52   Cucumis melo [Oriental melon]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   3e-52   
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   4e-52   Setaria italica
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    183   8e-52   
gb|KJB57937.1|  hypothetical protein B456_009G186400                    178   9e-52   Gossypium raimondii
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    182   1e-51   
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    182   1e-51   Populus euphratica
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    182   1e-51   Nicotiana tomentosiformis
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    179   2e-51   Spinacia oleracea
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    182   2e-51   Ricinus communis
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   181   2e-51   Citrus sinensis [apfelsine]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             182   2e-51   Prunus persica
gb|KJB57939.1|  hypothetical protein B456_009G186400                    178   3e-51   Gossypium raimondii
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   3e-51   Nicotiana sylvestris
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             181   4e-51   Phaseolus vulgaris [French bean]
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   4e-51   
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   4e-51   Solanum tuberosum [potatoes]
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                179   4e-51   Vicia sativa [spring vetch]
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               181   4e-51   Solanum tuberosum [potatoes]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             180   4e-51   
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    181   5e-51   Populus trichocarpa [western balsam poplar]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   5e-51   Solanum lycopersicum
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   5e-51   Citrus sinensis [apfelsine]
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    181   5e-51   Nicotiana tabacum [American tobacco]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             181   5e-51   Citrus clementina [clementine]
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           179   5e-51   Chlamydomonas reinhardtii
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   6e-51   Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   6e-51   Nicotiana tomentosiformis
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   6e-51   
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   6e-51   Prunus mume [ume]
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             180   8e-51   Selaginella moellendorffii
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              179   8e-51   Medicago truncatula
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    177   8e-51   Chlamydomonas incerta
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             180   9e-51   
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    178   1e-50   Chlamydomonas incerta
emb|CAN69459.1|  hypothetical protein VITISV_021576                     180   1e-50   Vitis vinifera
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             180   1e-50   Eutrema salsugineum [saltwater cress]
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      177   1e-50   Coleochaete scutata
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    180   1e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    180   1e-50   Populus euphratica
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    180   1e-50   Vitis vinifera
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    180   1e-50   Populus euphratica
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    180   1e-50   Spinacia oleracea
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   2e-50   Cucumis sativus [cucumbers]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   2e-50   Brassica rapa
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    179   2e-50   Arabis alpina [alpine rockcress]
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    179   2e-50   Gossypium arboreum [tree cotton]
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              179   2e-50   Scoparia dulcis [escobilla]
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      176   2e-50   Chara vulgaris
gb|ACJ84309.1|  unknown                                                 179   2e-50   Medicago truncatula
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           179   2e-50   Medicago truncatula
gb|EYU41183.1|  hypothetical protein MIMGU_mgv1a025772mg                172   2e-50   Erythranthe guttata [common monkey flower]
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    179   2e-50   Gossypium arboreum [tree cotton]
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             179   3e-50   
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         179   3e-50   Jatropha curcas
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   3e-50   Fragaria vesca subsp. vesca
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   3e-50   Malus domestica [apple tree]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    179   3e-50   Pyrus x bretschneideri [bai li]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              179   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   3e-50   Sesamum indicum [beniseed]
ref|NP_001048847.1|  Os03g0129300                                       179   3e-50   
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    179   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               175   3e-50   Klebsormidium flaccidum
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          178   4e-50   
emb|CAA33262.1|  unnamed protein product                                179   4e-50   Pisum sativum [garden pea]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    179   4e-50   Pisum sativum [garden pea]
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    178   4e-50   
ref|NP_001240080.1|  uncharacterized protein LOC100806482               178   4e-50   Glycine max [soybeans]
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    178   4e-50   Glycine max [soybeans]
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    178   5e-50   
gb|ABR16095.1|  unknown                                                 172   5e-50   Picea sitchensis
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    178   5e-50   Triticum urartu
dbj|BAJ86633.1|  predicted protein                                      178   5e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87214.1|  predicted protein                                      178   5e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    178   5e-50   
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    178   6e-50   
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    178   6e-50   Camelina sativa [gold-of-pleasure]
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            178   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    178   6e-50   
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      177   6e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    178   6e-50   Glycine soja [wild soybean]
gb|KJB14201.1|  hypothetical protein B456_002G114000                    178   6e-50   Gossypium raimondii
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase                173   6e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           179   6e-50   
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      175   7e-50   Mesostigma viride
gb|KJB57936.1|  hypothetical protein B456_009G186400                    178   7e-50   Gossypium raimondii
emb|CDY69523.1|  BnaC08g46180D                                          177   7e-50   Brassica napus [oilseed rape]
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   8e-50   
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   9e-50   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                174   1e-49   Klebsormidium flaccidum
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      176   1e-49   Mesostigma viride
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             177   1e-49   Capsella rubella
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   1e-49   Eucalyptus grandis [rose gum]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    175   2e-49   Mesostigma viride
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   2e-49   
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   3e-49   Cicer arietinum [garbanzo]
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                173   3e-49   Mesostigma viride
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    176   3e-49   Elaeis guineensis
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             174   3e-49   Micromonas pusilla CCMP1545
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    176   4e-49   Phoenix dactylifera
gb|EPS70760.1|  hypothetical protein M569_03997                         174   1e-48   Genlisea aurea
gb|ACU20783.1|  unknown                                                 175   1e-48   Glycine max [soybeans]
emb|CDP07271.1|  unnamed protein product                                174   1e-48   Coffea canephora [robusta coffee]
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                172   2e-48   Ulva linza
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    172   2e-48   
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    172   3e-48   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    174   3e-48   
gb|ABK24645.1|  unknown                                                 173   5e-48   
gb|ACN40006.1|  unknown                                                 173   6e-48   
gb|ACN40526.1|  unknown                                                 173   7e-48   
gb|KIY96104.1|  hypothetical protein MNEG_11860                         165   7e-48   
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    171   1e-47   
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    171   1e-47   
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      171   1e-47   
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               168   2e-47   
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    170   2e-47   
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         177   2e-47   
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           170   2e-47   
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              169   2e-47   
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      169   2e-47   
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    169   2e-47   
gb|ACJ85309.1|  unknown                                                 163   2e-46   
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           167   3e-46   
ref|XP_001420043.1|  predicted protein                                  166   4e-46   
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                165   1e-45   
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      166   3e-45   
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    164   4e-45   
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               165   4e-45   
gb|ACN39951.1|  unknown                                                 162   5e-45   
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    163   1e-44   
gb|KHN13412.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    159   2e-44   
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      160   3e-44   
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                159   1e-43   
ref|XP_005843104.1|  hypothetical protein CHLNCDRAFT_49269              157   2e-43   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    159   5e-43   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    159   6e-43   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    159   6e-43   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    158   8e-43   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      158   8e-43   
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    158   9e-43   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           158   9e-43   
ref|XP_001415434.1|  predicted protein                                  157   1e-42   
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         157   3e-42   
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    157   4e-42   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    154   5e-42   
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             155   8e-42   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     153   1e-41   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    155   3e-41   
gb|ADB81486.1|  glyceraldehyde-3-phosphate dehydrogenase                151   9e-41   
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               150   1e-40   
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      151   2e-40   
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    148   1e-39   
gb|AAA33484.1|  glyceraldehyde-3-phosphate dehydrogenase precursor      141   4e-39   
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           147   2e-38   
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      146   2e-38   
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                144   3e-38   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           144   8e-38   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           143   1e-37   
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           141   6e-37   
gb|ACN41006.1|  unknown                                                 143   9e-37   
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           140   9e-37   
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           140   1e-36   
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    139   3e-36   
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           139   3e-36   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           139   4e-36   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           139   5e-36   
gb|AAF03099.1|AF162198_1  NADP-dependent glyceraldehyde phosphate...    132   5e-36   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    139   6e-36   
pdb|2D2I|A  Chain A, Crystal Structure Of Nadp-Dependent Glyceral...    139   7e-36   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           138   8e-36   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           138   1e-35   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           138   1e-35   
gb|AAF19788.1|AF162202_1  NADP-dependent glyceraldehyde phosphate...    132   1e-35   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           138   1e-35   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    137   2e-35   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    137   3e-35   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    137   3e-35   
gb|ABR18416.1|  unknown                                                 138   4e-35   
gb|ABF93790.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    133   4e-35   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           136   4e-35   
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           136   6e-35   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           136   6e-35   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           135   7e-35   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         135   8e-35   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           135   1e-34   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    135   1e-34   
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    135   1e-34   
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    135   2e-34   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    135   2e-34   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    134   2e-34   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    134   2e-34   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           134   3e-34   
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         134   4e-34   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    134   4e-34   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           134   4e-34   
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             134   4e-34   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           134   5e-34   
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             134   5e-34   
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             134   5e-34   
ref|WP_011433307.1|  glyceraldehyde-3-phosphate dehydrogenase           133   5e-34   
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           133   5e-34   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           133   6e-34   
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    133   6e-34   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           133   6e-34   
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             134   6e-34   
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           133   7e-34   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    133   8e-34   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           132   1e-33   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           132   1e-33   
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    132   1e-33   
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    132   1e-33   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    132   2e-33   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           132   2e-33   
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    132   2e-33   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    132   2e-33   
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           132   2e-33   
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase                133   2e-33   
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        132   2e-33   
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           131   4e-33   
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           131   4e-33   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    131   4e-33   
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    131   4e-33   
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               131   4e-33   
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    130   8e-33   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           130   8e-33   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    130   8e-33   
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           130   9e-33   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           130   1e-32   
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           130   1e-32   
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        130   2e-32   
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           129   2e-32   
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase           129   2e-32   
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    129   2e-32   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           129   2e-32   
gb|ADB81484.1|  glyceraldehyde-3-phosphate dehydrogenase                128   2e-32   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    129   3e-32   
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           129   3e-32   
ref|WP_011429234.1|  glyceraldehyde-3-phosphate dehydrogenase           129   3e-32   
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase           129   4e-32   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    128   4e-32   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    128   4e-32   
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           128   4e-32   
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        129   5e-32   
gb|ABK00066.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    127   5e-32   
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           128   5e-32   
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           128   5e-32   
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    127   7e-32   
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase           127   8e-32   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           127   9e-32   
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase           127   1e-31   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    127   1e-31   
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase                127   1e-31   
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           127   1e-31   
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    127   1e-31   
emb|CAB41845.1|  glyceraldehyde-3-phosphate dehydrogenase               126   1e-31   
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           127   2e-31   
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    127   2e-31   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    127   2e-31   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           127   2e-31   
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           127   2e-31   
ref|WP_010475353.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
ref|WP_012164673.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    126   2e-31   
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    126   2e-31   
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                126   2e-31   
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        126   2e-31   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    126   2e-31   
ref|WP_017327507.1|  glyceraldehyde-3-phosphate dehydrogenase           126   2e-31   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           126   3e-31   
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    126   3e-31   
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    126   3e-31   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           126   3e-31   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    126   3e-31   
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           126   3e-31   
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    126   4e-31   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           125   4e-31   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           125   4e-31   
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    125   5e-31   
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           126   5e-31   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           125   5e-31   
ref|WP_015125741.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    125   5e-31   
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    125   6e-31   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           125   6e-31   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           125   7e-31   
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    124   7e-31   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           125   9e-31   
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase           125   9e-31   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           124   1e-30   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    124   1e-30   
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           124   1e-30   
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase           124   1e-30   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         124   2e-30   
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase           124   2e-30   
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase           124   2e-30   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           123   3e-30   
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                123   3e-30   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           123   3e-30   
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...    123   4e-30   
ref|XP_010270465.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   4e-30   
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                123   5e-30   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    122   5e-30   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           122   7e-30   
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase           122   7e-30   
ref|WP_038650443.1|  glyceraldehyde-3-phosphate dehydrogenase           122   9e-30   
ref|WP_036906091.1|  glyceraldehyde-3-phosphate dehydrogenase           122   9e-30   
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      121   1e-29   
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    121   1e-29   
ref|WP_011293983.1|  glyceraldehyde-3-phosphate dehydrogenase           122   1e-29   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           122   1e-29   
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           121   1e-29   
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           121   2e-29   
emb|CAC80999.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    120   2e-29   
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           121   2e-29   
ref|WP_011822824.1|  glyceraldehyde-3-phosphate dehydrogenase           121   2e-29   
gb|ADB81488.1|  glyceraldehyde-3-phosphate dehydrogenase                120   2e-29   
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    120   3e-29   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    120   3e-29   
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          121   3e-29   



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 145/171 (85%), Gaps = 4/171 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  215
            MASAALSVANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  216  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  395
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  396  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GIFDADVKPVG DGISVDGKVI+VVS RNP+NLPWG+LGIDLVIEGTGVFV
Sbjct  118  GIFDADVKPVGTDGISVDGKVIQVVSDRNPVNLPWGDLGIDLVIEGTGVFV  168



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   249 bits (637),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 145/171 (85%), Gaps = 4/171 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  215
            MASAALSVANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  216  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  395
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   SKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  396  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GIFDADVKPVG DGISVDGKVI+VVS RNP+NLPWG+LGIDLVIEGTGVFV
Sbjct  118  GIFDADVKPVGTDGISVDGKVIQVVSDRNPVNLPWGDLGIDLVIEGTGVFV  168



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   249 bits (636),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  215
            MASAAL+VANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALTVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  216  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  395
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  396  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GIFDADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFV
Sbjct  118  GIFDADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFV  168



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 145/171 (85%), Gaps = 6/171 (4%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  215
            MASAALSVANS+L QVSNKG S       SS      A    DDL SVV+FQTSV+GG K
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFAGLRSSSLPFARKAS---DDLLSVVAFQTSVIGGGK  56

Query  216  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  395
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDSTL
Sbjct  57   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTL  116

Query  396  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GIF+ADVKP  D+GISVDGKVIKVV++RNP+NLPWGE+GIDLVIEGTGVFV
Sbjct  117  GIFEADVKP-ADEGISVDGKVIKVVTNRNPVNLPWGEMGIDLVIEGTGVFV  166



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA   L     KG S       SSSS LPF+R++ DD HS++SFQTS VG  G
Sbjct  1    MASATLSVAKPALQGNGGKGFSEFSGLRNSSSSYLPFSRKTSDDFHSIISFQTSAVGSSG  60

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  61   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  120

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKPVG+D ISVDGKVIKVVS+RNP NLPW ELG+DLVIEGTGVFV
Sbjct  121  LGIFDADVKPVGEDAISVDGKVIKVVSNRNPANLPWKELGVDLVIEGTGVFV  172



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 143/171 (84%), Gaps = 3/171 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  215
            MASA LSVANS L Q + KG S       SS+S     + S DDL SV++FQTSVVGG  
Sbjct  1    MASATLSVANSAL-QANGKGFSEFSGLRNSSASLPFARKAS-DDLLSVIAFQTSVVGGNG  58

Query  216  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  395
            Q+R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  59   QKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  118

Query  396  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GIF+ADVKP GD+ ISVDGK+IKVVS RNP+NLPW +LGIDLVIEGTGVFV
Sbjct  119  GIFEADVKPAGDNAISVDGKIIKVVSDRNPVNLPWKDLGIDLVIEGTGVFV  169



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 145/172 (84%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA  +  Q + KG +       SS++SL F RR+ DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPS-PQANGKGFAEFAGLRNSSAASLCFGRRTSDDLFSVIAFQTSAVGTNG  59

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              +R + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  60   GYKRGITEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  119

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDA+VKPVGDDGISVDGKVIKVVSSRNPLNLPW ++GIDLVIEGTGVFV
Sbjct  120  LGIFDAEVKPVGDDGISVDGKVIKVVSSRNPLNLPWKDMGIDLVIEGTGVFV  171



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   236 bits (602),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 139/168 (83%), Gaps = 4/168 (2%)
 Frame = +3

Query  48   AALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-KQRR  224
            AALSVAN++L +VSNKG S       SS+          DDL SV   QTS +GG K +R
Sbjct  2    AALSVANTSL-KVSNKGFSEFSGLRTSSAVPFGRKTN--DDLFSVAGLQTSAIGGRKNKR  58

Query  225  AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  404
             V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF
Sbjct  59   IVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  118

Query  405  DADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            DADVKPVG DGISVDGK+I+VVS+R+P+NLPWGELGIDLVIEGTGVFV
Sbjct  119  DADVKPVGTDGISVDGKIIQVVSNRDPVNLPWGELGIDLVIEGTGVFV  166



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 141/172 (82%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA  +L Q S KG S       S++S     + S DD  SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QASGKGFSEFSGLRSSTASLPFARKASSDDFLSVIAFQTSAVGSSG  59

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG+KQASHLLKYDST
Sbjct  60   GYKKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGIKQASHLLKYDST  119

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIF+ADVKPVG DGISVDGKVIKVVS+RNP+NLPW +LGIDLVIEGTGVFV
Sbjct  120  LGIFNADVKPVGTDGISVDGKVIKVVSNRNPVNLPWKDLGIDLVIEGTGVFV  171



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 137/173 (79%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  218
            MASA  SVAN  L +V+ KG S       SS       + S DD HSV+SFQT+ VG   
Sbjct  1    MASATFSVANPAL-KVNGKGFSEFSGLRNSSGYLPFSRKTS-DDFHSVISFQTNAVGSSG  58

Query  219  RR---AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            R     VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   RSKKGVVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKPVG DGISVDGKVIKVVS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  119  TLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWGELGIDLVIEGTGVFV  171



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            DDL SVV+FQTSV+GG   +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  31   DDLLSVVAFQTSVIGGGNSKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  90

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDSTLGIFDADVKPVG DGISVDGKVI+VVS RNP+NLPWG+LGIDL
Sbjct  91   DTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQVVSDRNPVNLPWGDLGIDL  150

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  151  VIEGTGVFV  159



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 139/168 (83%), Gaps = 4/168 (2%)
 Frame = +3

Query  48   AALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-KQRR  224
            AALSVAN++L +V+NKG S       SS+          DDL SV   QTS +GG K +R
Sbjct  2    AALSVANTSL-KVNNKGFSEFSGLRTSSAVPFGRKTN--DDLFSVAGLQTSAIGGRKNKR  58

Query  225  AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  404
             V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF
Sbjct  59   IVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  118

Query  405  DADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            DADVKPVG DGISVDGKVI+VVS+R+P+NLPWGELG+DLVIEGTGVFV
Sbjct  119  DADVKPVGTDGISVDGKVIQVVSNRDPVNLPWGELGVDLVIEGTGVFV  166



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 139/172 (81%), Gaps = 5/172 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASAALSVA  +L Q + KG +       S+S S        +D  SV++FQTS VG  G
Sbjct  1    MASAALSVAKPSL-QANGKGFAEFSGLRNSASVSFGRKNS--EDFLSVIAFQTSAVGSNG  57

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGG+KQASHLLKYDST
Sbjct  58   GYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGIKQASHLLKYDST  117

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIF+ADVKPVG DGISVDGKVIKVVS RNPLNLPW E+GIDLVIEGTGVFV
Sbjct  118  LGIFEADVKPVGTDGISVDGKVIKVVSDRNPLNLPWKEMGIDLVIEGTGVFV  169



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 147/176 (84%), Gaps = 6/176 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYD-DLHSVVSFQTSVVGGK  215
            MASAALSVANS++H   NKG  SEF+GLR+SS+         + DL S+V++QTSV+ G 
Sbjct  1    MASAALSVANSSVHVSKNKGSFSEFTGLRTSSAVPFGVGWKTNVDLLSLVAYQTSVISGA  60

Query  216  QRR-----AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  380
             +       VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND+GGVKQASHLLK
Sbjct  61   GKNNNNNSRVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDSGGVKQASHLLK  120

Query  381  YDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            YDSTLGIFDADVKPVG DGISVDGK+IKVVS RNP+NLPW +LG+DLVIEGTGVFV
Sbjct  121  YDSTLGIFDADVKPVGTDGISVDGKIIKVVSDRNPINLPWKDLGVDLVIEGTGVFV  176



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   232 bits (592),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 138/173 (80%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVAN  L +V+ KG S       SS       + S DD HSV+S QT+ VG  G
Sbjct  1    MASATFSVANPAL-KVNGKGFSEFSGLRNSSGYLPFSRKTS-DDFHSVISVQTNAVGSSG  58

Query  213  KQRRAVV-EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            + R+ VV EAK+KVAINGFGR GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   RSRKGVVVEAKIKVAINGFGRTGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKPVG DGISVDGKVIKVVS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  119  TLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWGELGIDLVIEGTGVFV  171



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 139/171 (81%), Gaps = 3/171 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  215
            MAS  LSVAN +L Q + KG S       SS+S     + S DD  SV++FQTS VGG  
Sbjct  1    MASTTLSVANPSL-QANGKGFSDFSGLRISSASLPFARKTS-DDFLSVIAFQTSAVGGSG  58

Query  216  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  395
            Q+R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDSTL
Sbjct  59   QKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTL  118

Query  396  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GIF+ADVKP GDD ISVDGK+IKVVS+RNP NLPW +LGIDLVIEGTGVFV
Sbjct  119  GIFEADVKPAGDDAISVDGKIIKVVSNRNPANLPWKDLGIDLVIEGTGVFV  169



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   231 bits (589),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            DD  SV++FQTSVVGG K +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  38   DDFVSVIAFQTSVVGGGKNKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  97

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDSTLGIF+ADVKPVG+DGISVDGKVIKVVS RNP NLPW ++GIDL
Sbjct  98   DTGGVKQASHLLKYDSTLGIFEADVKPVGNDGISVDGKVIKVVSDRNPSNLPWKDMGIDL  157

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  158  VIEGTGVFV  166



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 139/173 (80%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA +SVA  TL Q + KG         SSSS     + S DD  SVV+FQTS +G   
Sbjct  1    MASATVSVAKPTL-QANGKGFGEFSGLRNSSSSLPFPRKTS-DDFLSVVAFQTSALGSNN  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKP GDD ISVDGK+IKVVS+RNP+NLPW +LGIDLVIEGTGVFV
Sbjct  119  TLGIFDADVKPAGDDAISVDGKIIKVVSNRNPVNLPWKDLGIDLVIEGTGVFV  171



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MA+A LSVA  ++ Q + KG         SS+      R S DD  S+++FQTS VG  G
Sbjct  1    MATATLSVAKPSIQQANGKGFGEFSGLRNSSTCLPFARRTS-DDFLSIIAFQTSAVGSNG  59

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  60   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  119

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW +L IDLVIEGTGVFV
Sbjct  120  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDLEIDLVIEGTGVFV  171



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  344
            +D  SV++FQTS +  K +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND
Sbjct  38   EDFLSVIAFQTSAIDSKNKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  97

Query  345  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  524
            TGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVI+VVS RNP NLPWG+LGIDLV
Sbjct  98   TGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIQVVSDRNPSNLPWGDLGIDLV  157

Query  525  IEGTGVFV  548
            IEGTGVFV
Sbjct  158  IEGTGVFV  165



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 139/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV+SFQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVISFQTSAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKPVGD+GISVDGKVIKVVSSRNPL+LPW +L IDLVIEGTGVFV
Sbjct  119  LGIFDADVKPVGDNGISVDGKVIKVVSSRNPLDLPWKDLEIDLVIEGTGVFV  170



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVIAFQTSAVGSNG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKPVGD+G+SVDGK+IKVVSSRNP++LPW +L IDLVIEGTGVFV
Sbjct  119  LGIFDADVKPVGDNGLSVDGKIIKVVSSRNPIDLPWKDLEIDLVIEGTGVFV  170



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            DD  SV++FQTS VGG K  R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  34   DDFFSVIAFQTSSVGGDKNSRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  93

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDSTLGIFDADVKPVG+D ISVDGKVIKVV+ RNP NLPW +LGIDL
Sbjct  94   DTGGVKQASHLLKYDSTLGIFDADVKPVGNDAISVDGKVIKVVTDRNPANLPWKDLGIDL  153

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  154  VIEGTGVFV  162



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 140/175 (80%), Gaps = 5/175 (3%)
 Frame = +3

Query  39   MASAALSVANSTLH-QVSNKGlssefsglrssssslp-farrsYDDLHSVVSFQTSVVG-  209
            MASA +SVA   L  Q   KG+         +SS+   FAR++ DD HS+V+FQTS +G 
Sbjct  1    MASATVSVAKPNLQIQAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGS  60

Query  210  --GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  383
              G  R+ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY
Sbjct  61   NNGGYRKGMAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  120

Query  384  DSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            DSTLGIF ADVKPVG DGISVDGKVIKVVS RNP NLPWG+LGIDLVIEGTGVFV
Sbjct  121  DSTLGIFAADVKPVGTDGISVDGKVIKVVSDRNPSNLPWGDLGIDLVIEGTGVFV  175



>gb|KHG21941.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=363

 Score =   228 bits (580),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 140/175 (80%), Gaps = 5/175 (3%)
 Frame = +3

Query  39   MASAALSVANSTLH-QVSNKGlssefsglrssssslp-farrsYDDLHSVVSFQTSVVG-  209
            MASA +SVA   L  Q   KG+         +SS+   FAR++ DD HS+V+FQTS +G 
Sbjct  1    MASATVSVAKPNLQIQAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGS  60

Query  210  --GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  383
              G  R+ + EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY
Sbjct  61   NNGGYRKGMAEAKVKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  120

Query  384  DSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            DSTLGIF ADVKPVG DGISVDGKVIKVVS RNP NLPWG+LGIDLVIEGTGVFV
Sbjct  121  DSTLGIFAADVKPVGTDGISVDGKVIKVVSDRNPSNLPWGDLGIDLVIEGTGVFV  175



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   229 bits (583),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVIAFQTSSVGSNG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKPVGD+G+SVDGK+IKVVSSRNP++LPW +L IDLVIEGTGVFV
Sbjct  119  LGIFDADVKPVGDNGLSVDGKIIKVVSSRNPIDLPWKDLEIDLVIEGTGVFV  170



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 148/174 (85%), Gaps = 6/174 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA  TL    N    SEFSGLR+S+  LPF+R++ DD HSVVSFQT+ VG  G
Sbjct  1    MASATLSVAKPTLK--GNGKGFSEFSGLRNSTGYLPFSRKTSDDFHSVVSFQTNAVGSNG  58

Query  213  KQRRA--VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
              +R   VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYD
Sbjct  59   GYKRGGVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYD  118

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            STLGIFDADVKPVG+D ISVDGKVI+VVS+RNP NLPW ELGIDLVIEGTGVFV
Sbjct  119  STLGIFDADVKPVGNDAISVDGKVIQVVSNRNPSNLPWKELGIDLVIEGTGVFV  172



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  218
            MASA LSVA STL      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSTLQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  219  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIF+ADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFV
Sbjct  118  TLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFV  170



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV+SFQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVISFQTSAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD+GISVDGKVIKVVSSRNPL+LPW +L IDLVIEGTGVFV
Sbjct  119  LGIFDADVKPAGDNGISVDGKVIKVVSSRNPLDLPWKDLEIDLVIEGTGVFV  170



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 141/172 (82%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            M+SA LSVA  +L Q + KGL+       SS+      + S DDL SV++FQTS +G  G
Sbjct  1    MSSAILSVAKPSL-QANGKGLAEFSGLRTSSACLPFGKKTS-DDLFSVITFQTSALGSNG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKPVGD+G+SVDGK++KVVSSRNPL+LPW +L IDLVIEGTGVFV
Sbjct  119  LGIFDADVKPVGDNGLSVDGKIVKVVSSRNPLDLPWKDLEIDLVIEGTGVFV  170



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 139/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA  +L Q + KG +       S +      + S DDL SV++FQTS +G  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSLACLPFGRKTS-DDLFSVIAFQTSALGSNG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   VYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKPVGD+G+SVDGK++KVVSSRNPL+LPW +L IDLVIEGTGVFV
Sbjct  119  LGIFDADVKPVGDNGLSVDGKIVKVVSSRNPLDLPWKDLEIDLVIEGTGVFV  170



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA  SVA  +L Q + KG         SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATFSVAKPSL-QGNGKGFQEFSGLRNSSAFLPFSKKTS-DDFLSVVAFQTSAVGSSN  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKTVAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKPVG DGISVDGKVI+VVS RNP NLPW +LGIDLVIEGTGVFV
Sbjct  119  TLGIFDADVKPVGTDGISVDGKVIQVVSDRNPANLPWKDLGIDLVIEGTGVFV  171



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 136/173 (79%), Gaps = 6/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            M S  +SVA  TL Q + KG +       S+S +        DD  SV++FQTS +G   
Sbjct  1    MVSVTVSVAKPTL-QANAKGFAEFSGLRNSASLTFARKTS--DDFQSVIAFQTSALGINN  57

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  58   GGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  117

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIF+ADVKPVGD+ ISVDGKVIKVVS RNP+NLPW +LGIDLVIEGTGVFV
Sbjct  118  TLGIFEADVKPVGDNAISVDGKVIKVVSDRNPVNLPWKDLGIDLVIEGTGVFV  170



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  335
            DD  SV++FQTS +G   G  ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA
Sbjct  40   DDFQSVIAFQTSALGINNGGYQKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  99

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIF+ADVKPVGD+ ISVDGKVIKVVS RNP+NLPW +LGI
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFEADVKPVGDNAISVDGKVIKVVSDRNPVNLPWKDLGI  159

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  160  DLVIEGTGVFV  170



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 139/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MA+A LSVA  ++ Q + KG +       SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFAEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW ++ IDLVIEGTGVFV
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDMEIDLVIEGTGVFV  170



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   226 bits (577),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 119/132 (90%), Gaps = 4/132 (3%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG---GKQRRAVVEAK-LKVAINGFGRIGRNFLRCWHGRKDSPLDVI  332
            DD HS+V+FQT+ VG   G ++  VVEAK LKVAINGFGRIGRNFLRCWHGRKDSPLDVI
Sbjct  41   DDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVI  100

Query  333  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  512
            AINDTGGVKQASHLLKYDSTLGIFDADVKPVG DGISVDGKVIKVVS RNP NLPW ELG
Sbjct  101  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWKELG  160

Query  513  IDLVIEGTGVFV  548
            IDLVIEGTGVFV
Sbjct  161  IDLVIEGTGVFV  172



>sp|P12858.2|G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Pisum sativum]
 emb|CAA36396.1| glyceraldehyde-3-phosphate dehydrogenase [Pisum sativum]
Length=405

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 119/132 (90%), Gaps = 4/132 (3%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG---GKQRRAVVEAK-LKVAINGFGRIGRNFLRCWHGRKDSPLDVI  332
            DD HS+V+FQT+ VG   G ++  VVEAK LKVAINGFGRIGRNFLRCWHGRKDSPLDVI
Sbjct  41   DDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVI  100

Query  333  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  512
            AINDTGGVKQASHLLKYDSTLGIFDADVKPVG DGISVDGKVIKVVS RNP NLPW ELG
Sbjct  101  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWKELG  160

Query  513  IDLVIEGTGVFV  548
            IDLVIEGTGVFV
Sbjct  161  IDLVIEGTGVFV  172



>tpg|DAA37468.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=252

 Score =   222 bits (565),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  335
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  159

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  160  DLVIEGTGVFV  170



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 139/173 (80%), Gaps = 6/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  218
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  219  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIF+ADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFV
Sbjct  118  TLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFV  170



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   226 bits (576),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 139/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MA+A LSVA  ++ Q + KG +       SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFAEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW ++ IDLVIEGTGVFV
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDMEIDLVIEGTGVFV  170



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 138/180 (77%), Gaps = 12/180 (7%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV-----  203
            MASA LSVA  +L Q + KG         SS+      + S DD  SVV+FQTS      
Sbjct  1    MASATLSVAKPSL-QGNGKGFQEFSGLRNSSAFLPFAKKTS-DDFLSVVAFQTSAKRILT  58

Query  204  --VG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  368
              VG   G  R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS
Sbjct  59   VKVGSNNGGYRKTAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  118

Query  369  HLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            HLLKYDSTLGIF+ADVKPVGD+GISVDGKVIKVVS RNP+NLPWGELGIDLVIEGTGVFV
Sbjct  119  HLLKYDSTLGIFEADVKPVGDNGISVDGKVIKVVSDRNPVNLPWGELGIDLVIEGTGVFV  178



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 139/173 (80%), Gaps = 6/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  218
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  219  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIF+ADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFV
Sbjct  118  TLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFV  170



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 139/173 (80%), Gaps = 6/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  218
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  219  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIF+ADVKPVG DGISVDGKVI+VVS+RNP+NLPWG+LGIDLVIEGTGVFV
Sbjct  118  TLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFV  170



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MA+A LSVA  ++ Q + KG         SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFGEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW ++ IDLVIEGTGVFV
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDMEIDLVIEGTGVFV  170



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 137/173 (79%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSAMGNSS  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFV
Sbjct  119  TLGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFV  171



>emb|CBI21236.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
             LG F+ADVK VGDD ISVDGKVIK+VSSRNPL+LPWG+L IDLVIEGTGVFV
Sbjct  119  ILGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFV  171



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 137/173 (79%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSAMGNSS  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFV
Sbjct  119  TLGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFV  171



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 137/172 (80%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MA+A LSVA  ++ Q + KG         SS+      R S DD  S+++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFGEFSGLRNSSTCLPFARRTS-DDFLSIIAFQTSAVGSNG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIF+ADVKP GD+ ISVDGK+IKVVSSRNPLNLPW +L IDLVIEGTGVFV
Sbjct  119  LGIFEADVKPAGDEAISVDGKIIKVVSSRNPLNLPWKDLEIDLVIEGTGVFV  170



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 136/173 (79%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS  G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSATGNSS  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFV
Sbjct  119  TLGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFV  171



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  51   ALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQRRAV  230
            A ++ANS+L QV+ KG S       SS+S   F  +S DD  S+V+ QTS VG K  +  
Sbjct  2    AFTMANSSL-QVNGKGFSEFAGLRSSSASLPAFQMKSCDDFVSMVALQTSFVG-KNSKGP  59

Query  231  VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDA  410
            VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI INDTGGVKQASHLLKYDSTLGIFDA
Sbjct  60   VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVINDTGGVKQASHLLKYDSTLGIFDA  119

Query  411  DVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            DVKP GD  ISVDGK+IKVVS RNP NLPWGE+GIDLVIEGTGVFV
Sbjct  120  DVKPSGDQAISVDGKIIKVVSDRNPSNLPWGEMGIDLVIEGTGVFV  165



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 134/172 (78%), Gaps = 5/172 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA L+ AN+ L     KG S       +SSS       S DD  SVV+F+TS VG  G
Sbjct  1    MASATLTAANACLQ---GKGFSDFSGLRSASSSIPLRRINSSDDFLSVVAFRTSAVGSSG  57

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQASHLLKYDST
Sbjct  58   GYRKGAAEAKVKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQASHLLKYDST  117

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIF+A+VKP GD  ISVDGKVIKVVS+RNP NLPWGELGIDLVIEGTGVFV
Sbjct  118  LGIFEANVKPEGDSAISVDGKVIKVVSNRNPANLPWGELGIDLVIEGTGVFV  169



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 133/173 (77%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA LSVA  +  Q + KG +       SS+      + S DD  SVV+FQTS +    
Sbjct  1    MASATLSVAKPSHLQANGKGFTEFSGLRNSSAFLPFAKKTS-DDFLSVVAFQTSALASSS  59

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  RRA  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  60   GGYRRAAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  119

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIF+ADVKP GD  ISVDGK+IKV S+RNP+NLPW E+ IDLVIEGTGVFV
Sbjct  120  TLGIFEADVKPAGDSAISVDGKIIKVASNRNPVNLPWKEMEIDLVIEGTGVFV  172



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA  SVA  +L Q S KG +       SS+      + S DD  S VS QTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSAVSLQTSALGSSS  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIF+ADVKPVGD+GISVDGKVIKVVSSRNPL+LPW +L +DLVIEGTGVFV
Sbjct  119  TLGIFEADVKPVGDNGISVDGKVIKVVSSRNPLDLPWKDLEVDLVIEGTGVFV  171



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA  SVA  +L Q S KG +       SS+      + S DD  S VS QTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSAVSLQTSALGSSS  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R++  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIF ADVKPVGD+GISVDGKVIKVVSSRNPL+LPW +L IDLVIEGTGVFV
Sbjct  119  TLGIFAADVKPVGDNGISVDGKVIKVVSSRNPLDLPWKDLEIDLVIEGTGVFV  171



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 135/171 (79%), Gaps = 4/171 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  215
            MASA  SVA  +L Q + KG +       S+S          +D  SV++FQTS VG   
Sbjct  1    MASATFSVAKPSL-QANGKGFTDFSGLRNSASLPFSRKTS--EDFLSVIAFQTSAVGNSG  57

Query  216  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  395
             R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   YRKGAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  396  GIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GIFDA+VKPVGD+ ISVDGKVIKVV++RNPL+LPWG+LG+DLVIEGTGVFV
Sbjct  118  GIFDANVKPVGDNAISVDGKVIKVVTNRNPLDLPWGDLGVDLVIEGTGVFV  168



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 136/172 (79%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA  +L   S       FSGLR+SS+     R S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMGSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  55   AYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  166



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   223 bits (569),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  96

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGID
Sbjct  97   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGID  156

Query  519  LVIEGTGVFV  548
            LVIEGTGVFV
Sbjct  157  LVIEGTGVFV  166



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   223 bits (569),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  96

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGID
Sbjct  97   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGID  156

Query  519  LVIEGTGVFV  548
            LVIEGTGVFV
Sbjct  157  LVIEGTGVFV  166



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   223 bits (569),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 137/172 (80%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  166



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 137/172 (80%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  166



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 136/172 (79%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  212
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS+    G
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSMGNSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFV
Sbjct  119  LGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFV  170



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 137/172 (80%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  55   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  166



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 136/172 (79%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  212
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS+    G
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSMGNSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKPVGD+ ISVDGKVIKVVSSRNPL+LPW ++ +DLVIEGTGVFV
Sbjct  119  LGIFDADVKPVGDNAISVDGKVIKVVSSRNPLDLPWKDMEVDLVIEGTGVFV  170



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
             LG F+ADVK VGDD ISVDGKVIK+VSSRNPL+LPWG+L IDLVIEGTGVFV
Sbjct  119  ILGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFV  171



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDS  118

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
             LG F+ADVK VGDD ISVDGKVIK+VSSRNPL+LPWG+L IDLVIEGTGVFV
Sbjct  119  ILGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFV  171



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 133/172 (77%), Gaps = 6/172 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  218
            MAS  LS+AN +L +V NKG S       SS           DDL + VSFQT+ VGGK+
Sbjct  1    MASNMLSIANPSL-RVYNKGFSEFSGLHTSSLPFGRKGS---DDLMAFVSFQTNAVGGKR  56

Query  219  --RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              +  VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS 
Sbjct  57   SSQNGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSI  116

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDADVK  GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFV
Sbjct  117  LGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFV  168



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  335
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  159

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  160  DLVIEGTGVFV  170



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 132/172 (77%), Gaps = 3/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  212
            MASA L+ AN+ L Q S KG S       +S S       S DD  S V+F+T+     G
Sbjct  1    MASATLTAANACL-QASGKGFSDFSGLRSASCSIPLRKIHSSDDFLSTVAFRTAAESSSG  59

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGG+KQASHLLKYDST
Sbjct  60   GYRKGAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGIKQASHLLKYDST  119

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIF+ADVKP G   ISVDGKVIKVVS+RNPL+LPWGELG+DLVIEGTGVFV
Sbjct  120  LGIFEADVKPEGQSAISVDGKVIKVVSNRNPLDLPWGELGVDLVIEGTGVFV  171



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            DD  + VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DSPL+VIAI
Sbjct  39   DDFVNAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRDDSPLEVIAI  98

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+G+D
Sbjct  99   NDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGVD  158

Query  519  LVIEGTGVFV  548
            LVIEGTGVFV
Sbjct  159  LVIEGTGVFV  168



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 137/172 (80%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+IK+VS RNP +LPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSSLPWGELGIDLVIEGTGVFV  166



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   221 bits (563),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  335
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  159

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  160  DLVIEGTGVFV  170



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   220 bits (561),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  335
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  20   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  79

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  80   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  139

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  140  DLVIEGTGVFV  150



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 136/172 (79%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSSMGSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQATHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDAALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  166



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 137/179 (77%), Gaps = 7/179 (4%)
 Frame = +3

Query  24   PVNPAMASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV  203
            P   AMASA L+VAN++L Q + KG S       SS           DD  SV++F+TS 
Sbjct  37   PDTKAMASATLAVANASL-QANGKGFSEFSGLRSSSLPLRKINTS--DDFLSVIAFKTSA  93

Query  204  VGGKQ----RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  371
            V G      R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGG+KQASH
Sbjct  94   VAGGGGGGYRKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGIKQASH  153

Query  372  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LLKYDSTLGIF+ADVKP GD GISVDGKVIKVV++RNP++LPW ELGIDLVIEGTGVFV
Sbjct  154  LLKYDSTLGIFEADVKPAGDAGISVDGKVIKVVTNRNPVSLPWKELGIDLVIEGTGVFV  212



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 135/172 (78%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
               + V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYSKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  166



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 135/172 (78%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDAALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  166



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDADVKPVG D ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFV
Sbjct  119  LGTFDADVKPVGSDIISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFV  170



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDADVKPVG D ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFV
Sbjct  119  LGTFDADVKPVGSDIISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFV  170



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 117/128 (91%), Gaps = 1/128 (1%)
 Frame = +3

Query  168  DLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  344
            D  S VSFQTS+VGG K ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND
Sbjct  106  DFVSFVSFQTSLVGGEKNQKVVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  165

Query  345  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  524
            TGGVKQA+HLLKYDSTLGIFDA VKPVG D ISVDGK+I+VVS RNP NLPWG++GIDLV
Sbjct  166  TGGVKQAAHLLKYDSTLGIFDAVVKPVGTDAISVDGKIIQVVSDRNPSNLPWGDMGIDLV  225

Query  525  IEGTGVFV  548
            IEGTGVFV
Sbjct  226  IEGTGVFV  233



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 135/172 (78%), Gaps = 6/172 (3%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  218
            MAS  LS+AN +L +VSNKG S       SS           DDL ++V+FQT+ + GK+
Sbjct  1    MASNMLSIANPSL-RVSNKGFSEFAGLHTSSLPFARRGS---DDLVALVAFQTNALAGKR  56

Query  219  --RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              +  VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ IND+GGVKQASHLLKYDS 
Sbjct  57   STQNGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVINDSGGVKQASHLLKYDSI  116

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDADVKP G+D ISVDGKVIKVVS RNPLNLPW +LGIDLVIEGTGVFV
Sbjct  117  LGTFDADVKPEGNDAISVDGKVIKVVSDRNPLNLPWKDLGIDLVIEGTGVFV  168



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  335
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  38   DDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  98   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  157

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  158  DLVIEGTGVFV  168



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  SVV+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+I+VVS+RNP NLPW E+GID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKIIQVVSNRNPSNLPWKEMGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  335
            DD  + VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PLDVIA
Sbjct  39   DDFMNAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVIA  98

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  99   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  158

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  159  DLVIEGTGVFV  169



>gb|AGV54738.1| glyceraldehyde-3-phosphate dehydrogenase A chloroplastic-like 
protein [Phaseolus vulgaris]
Length=316

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 133/172 (77%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSI  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDA VKPVG D ISVDGK IKVVS RNP NLPW ELGIDLVIEGTGVFV
Sbjct  119  LGTFDAVVKPVGSDIISVDGKEIKVVSDRNPANLPWKELGIDLVIEGTGVFV  170



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  335
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  99

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGELGI
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGI  159

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  160  DLVIEGTGVFV  170



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  SVV+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+I+VVS+RNP NLPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIQVVSNRNPSNLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 134/172 (78%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  212
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTSV    G
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSVGSNSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS 
Sbjct  59   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSI  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG F+ADVK VGDD ISVDGKVIK+VSSRNPL+LPWG+L IDLVIEGTGVFV
Sbjct  119  LGTFEADVKAVGDDAISVDGKVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFV  170



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 135/172 (78%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+I++VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDAALSVDGKIIQIVSDRNPSNLPWGELGIDLVIEGTGVFV  166



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 135/179 (75%), Gaps = 7/179 (4%)
 Frame = +3

Query  24   PVNPAMASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV  203
            P    MASA L+VAN++L Q + KG S       SS           DD  SV+SF+TS 
Sbjct  37   PETKTMASATLAVANASL-QANGKGFSEFSGLRSSSLPLRRINTS--DDFISVISFKTSA  93

Query  204  VGGKQ----RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  371
            V G      R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQASH
Sbjct  94   VAGGSGGGYRKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQASH  153

Query  372  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LLKYDSTLGIF+ADVKP G+  ISVDGKVIKVV++RNPL+LPW ELGIDLVIEGTGVFV
Sbjct  154  LLKYDSTLGIFEADVKPAGNAAISVDGKVIKVVTNRNPLDLPWKELGIDLVIEGTGVFV  212



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   218 bits (556),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDADVKPVG + ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFV
Sbjct  119  LGTFDADVKPVGSNVISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFV  170



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   218 bits (556),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDADVKPVG + ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFV
Sbjct  119  LGTFDADVKPVGSNVISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFV  170



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   218 bits (556),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 134/172 (78%), Gaps = 8/172 (5%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVV--GG  212
            MASA  SVA  +L   S       FSGLR+SS+     R S D+  S VSFQTS +   G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMRSNG  54

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  114

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  115  LGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  166



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            +D  SVV+FQTSVV G   +R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  37   EDFLSVVAFQTSVVWGSGYKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  96

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDSTLGIFDADVK  G D ISVDGKVI+VVS+RNP+NLPW +LGIDL
Sbjct  97   DTGGVKQASHLLKYDSTLGIFDADVKVAGVDAISVDGKVIRVVSNRNPVNLPWKDLGIDL  156

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  157  VIEGTGVFV  165



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S VSFQTS +G  G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ I
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVI  96

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+I++VS RNP NLPWGELGID
Sbjct  97   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIQIVSDRNPSNLPWGELGID  156

Query  519  LVIEGTGVFV  548
            LVIEGTGVFV
Sbjct  157  LVIEGTGVFV  166



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 133/172 (77%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSI  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDA VKPVG D ISVDGK IKVVS RNP NLPW ELGIDLVIEGTGVFV
Sbjct  119  LGTFDAVVKPVGSDIISVDGKEIKVVSDRNPANLPWKELGIDLVIEGTGVFV  170



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 133/172 (77%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSI  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDA VKPVG D ISVDGK IKVVS RNP NLPW ELGIDLVIEGTGVFV
Sbjct  119  LGTFDAVVKPVGSDIISVDGKEIKVVSDRNPANLPWKELGIDLVIEGTGVFV  170



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  SVV+FQTS +G  G  R+ V EAKLKVAI+GFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAISGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+I+VVS+RNP NLPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIQVVSNRNPSNLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  212
            MASA  SVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATFSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  213  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  392
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  393  LGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LG FDADVKPVG + ISVDGK IKVVS RNP NLPW +LGIDLVIEGTGVFV
Sbjct  119  LGTFDADVKPVGSNVISVDGKEIKVVSDRNPANLPWKDLGIDLVIEGTGVFV  170



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 114/132 (86%), Gaps = 4/132 (3%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGK---QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVI  332
            +D  S VSF+T  VG      RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PLDVI
Sbjct  39   EDFMSAVSFRTYAVGTSGSGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVI  98

Query  333  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  512
            AINDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+G
Sbjct  99   AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMG  158

Query  513  IDLVIEGTGVFV  548
            IDLVIEGTGVFV
Sbjct  159  IDLVIEGTGVFV  170



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSV-VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            DDL + V+ Q++V V G Q+RAVVEAK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+ IN
Sbjct  37   DDLLTRVAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVIN  96

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDS LGIFDA VK VGDD ISVDGK+IK+VS RNPLNLPWGE+G+DL
Sbjct  97   DTGGVKQASHLLKYDSMLGIFDAYVKAVGDDAISVDGKIIKIVSDRNPLNLPWGEMGVDL  156

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  157  VIEGTGVFV  165



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 1/123 (1%)
 Frame = +3

Query  183  VSFQTSV-VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVK  359
            V+ Q++V V G Q+RAVVEAK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+ INDTGGVK
Sbjct  2    VAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVINDTGGVK  61

Query  360  QASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTG  539
            QASHLLKYDS LGIFDADVK VGDD ISVDGK+IK+VS RNPLNLPWGE+G+DLVIEGTG
Sbjct  62   QASHLLKYDSMLGIFDADVKAVGDDAISVDGKIIKIVSDRNPLNLPWGEMGVDLVIEGTG  121

Query  540  VFV  548
            VFV
Sbjct  122  VFV  124



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 114/131 (87%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  335
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  29   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  88

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+GI
Sbjct  89   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGI  148

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  149  DLVIEGTGVFV  159



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 114/131 (87%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  335
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  38   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+GI
Sbjct  98   INDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGI  157

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  158  DLVIEGTGVFV  168



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  94   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  153

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  154  IVIEGTGVFV  163



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  94   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  153

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  154  IVIEGTGVFV  163



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   216 bits (549),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   215 bits (548),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  94   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  153

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  154  IVIEGTGVFV  163



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 114/130 (88%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSFVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 113/131 (86%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  335
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  38   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGG KQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP NLPWGE+GI
Sbjct  98   INDTGGAKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGEMGI  157

Query  516  DLVIEGTGVFV  548
            DLVIEGTGVFV
Sbjct  158  DLVIEGTGVFV  168



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 112/130 (86%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S VSFQTS +G     R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP D+IAI
Sbjct  38   DEFVSAVSFQTSAMGSSSGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDIIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IKVVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKVVSNRNPSLLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S ++FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAITFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IKVVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKVVSNRNPSLLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S V+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IK+VS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKIVSNRNPSLLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            D+  S V+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IKVVS+RNP  LPW ELGID
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKVVSNRNPSLLPWKELGID  157

Query  519  LVIEGTGVFV  548
            +VIEGTGVFV
Sbjct  158  IVIEGTGVFV  167



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 136/173 (79%), Gaps = 7/173 (4%)
 Frame = +3

Query  39   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  209
            MASA LSVA S+L         SEFSGLRSSS      + S D+  S V+FQT  +G   
Sbjct  1    MASATLSVAKSSLQLQG----FSEFSGLRSSSGLPFAKKPSSDEFVSFVTFQTKALGNNN  56

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDS
Sbjct  57   GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAAHLLKYDS  116

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKP GD  +SVDGK+I+VVS RNP NLPW +LGIDLVIEGTGVFV
Sbjct  117  TLGIFDADVKPSGDKALSVDGKIIQVVSDRNPANLPWKDLGIDLVIEGTGVFV  169



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +3

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  64

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  65   TLGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  117



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  10   GGYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  69

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKPVGD+G+SVDGK++KVVSSRNPL+LPW +L IDLVIEGTGVFV
Sbjct  70   TLGIFDADVKPVGDNGLSVDGKIVKVVSSRNPLDLPWKDLEIDLVIEGTGVFV  122



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            DDL ++V+ QT V       RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ IN
Sbjct  38   DDLSTIVAAQTVVAASSGASRAVTEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVIN  97

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDS LG F+ADVK  G+D ISVDGKVIKVVS RNPLNLPWGE+GIDL
Sbjct  98   DTGGVKQASHLLKYDSMLGTFNADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGEMGIDL  157

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  158  VIEGTGVFV  166



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  YDDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            +DDL ++V+ Q++V      +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ I
Sbjct  36   HDDLTTIVTAQSAVAASSGAKRAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVI  95

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDS LG FDADVK  G+D ISVDGKVIKVVS RNPLNLPWG++ ID
Sbjct  96   NDTGGVKQASHLLKYDSMLGTFDADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDID  155

Query  519  LVIEGTGVFV  548
            LVIEGTGVFV
Sbjct  156  LVIEGTGVFV  165



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDS  64

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  65   TLGIFDADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  117



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 111/130 (85%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            +DL S V+ QT  V   G  +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDVI I
Sbjct  40   EDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVIVI  99

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDS LG FDADVK  GD  ISVDGKVIKVVS+R+PL LPWGELG+D
Sbjct  100  NDTGGVKQASHLLKYDSMLGTFDADVKVSGDSAISVDGKVIKVVSNRDPLKLPWGELGVD  159

Query  519  LVIEGTGVFV  548
            LVIEGTGVFV
Sbjct  160  LVIEGTGVFV  169



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 111/130 (85%), Gaps = 2/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  338
            +DL S V+ QT  V   G  +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDVI I
Sbjct  40   EDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVIVI  99

Query  339  NDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGID  518
            NDTGGVKQASHLLKYDS LG FDADVK  GD  ISVDGKVIKVVS+R+PL LPWGELG+D
Sbjct  100  NDTGGVKQASHLLKYDSMLGTFDADVKVSGDSAISVDGKVIKVVSNRDPLKLPWGELGVD  159

Query  519  LVIEGTGVFV  548
            LVIEGTGVFV
Sbjct  160  LVIEGTGVFV  169



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDS LG FD +VK  G DGISV GKVIKVVSSRNP NLPW +  IDL
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIKVVSSRNPQNLPWKDYEIDL  167

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  168  VIEGTGVFV  176



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDS LG FD +VK  G DGISV GKVIKVVSSRNP NLPW +  IDL
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIKVVSSRNPQNLPWKDYEIDL  167

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  168  VIEGTGVFV  176



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDS LG FD +VK  G DGISV GKVIKVVSSRNP NLPW +  IDL
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIKVVSSRNPQNLPWKDYEIDL  167

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  168  VIEGTGVFV  176



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            DTGGVKQASHLLKYDS LG FD +VK  G DGISV GKVIKVVSSRNP NLPW +  IDL
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIKVVSSRNPQNLPWKDYEIDL  167

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  168  VIEGTGVFV  176



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 114/141 (81%), Gaps = 13/141 (9%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLR----------CWHGR  308
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLR          CWHGR
Sbjct  29   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRAQRIGRNFLRCWHGR  88

Query  309  KDS-PLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNP  485
             DS PL+VIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGD+ ISVDGKVIKVVS RNP
Sbjct  89   GDSSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNP  148

Query  486  LNLPWGELGIDLVIEGTGVFV  548
             NLPWGE+GIDLVIEGTGVFV
Sbjct  149  SNLPWGEMGIDLVIEGTGVFV  169



>ref|XP_008663264.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58480.1| hypothetical protein ZEAMMB73_511551 [Zea mays]
Length=401

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 111/132 (84%), Gaps = 4/132 (3%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  332
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRIGRNFLRCWHGR  DSPLDVI
Sbjct  37   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIGRNFLRCWHGRDNDSPLDVI  96

Query  333  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  512
            AINDTG +KQASHLLKYDS LGIFDADV+PVGD+ ISVDGKVIKVVS RNP NLPWGEL 
Sbjct  97   AINDTGDIKQASHLLKYDSMLGIFDADVEPVGDNAISVDGKVIKVVSDRNPSNLPWGELS  156

Query  513  IDLVIEGTGVFV  548
            +DL IEGTGVFV
Sbjct  157  VDLFIEGTGVFV  168



>ref|XP_010458726.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010458727.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=283

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +3

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDS  64

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKP GD  +SVD K+I++VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  65   TLGIFDADVKPSGDAALSVDEKIIQIVSDRNPSNLPWGELGIDLVIEGTGVFV  117



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +3

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDS  64

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIF ADVKP GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  65   TLGIFGADVKPSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  117



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 108/117 (92%), Gaps = 3/117 (3%)
 Frame = +3

Query  204  VGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  377
            VGG++  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  8    VGGREGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  67

Query  378  KYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            KYDSTLGIFDADVKPVGD  IS+DGKVIKVVS  NP+NLPW +L IDLVIEGTGVFV
Sbjct  68   KYDSTLGIFDADVKPVGDI-ISIDGKVIKVVSDHNPVNLPWKDLEIDLVIEGTGVFV  123



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  210  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  389
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDS  64

Query  390  TLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            TLGIFDADVKP G+  ISVDGK+I+VVS+RNP  LPW ELGID+VIEGTGVFV
Sbjct  65   TLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFV  117



>ref|XP_008663258.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58475.1| hypothetical protein ZEAMMB73_739238 [Zea mays]
Length=401

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 110/132 (83%), Gaps = 4/132 (3%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  332
            D+  S VSF+   +G   G+ RRA  EAKLKVA+NGFGRIGRN +RCWHGR  DSPLDVI
Sbjct  37   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAMNGFGRIGRNLMRCWHGRDNDSPLDVI  96

Query  333  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  512
            AINDTG VKQAS+LLKYDS LGIFDADV+PVGD+ ISVDGKVIKVVS RNP NLPWGEL 
Sbjct  97   AINDTGDVKQASYLLKYDSMLGIFDADVEPVGDNAISVDGKVIKVVSDRNPSNLPWGELS  156

Query  513  IDLVIEGTGVFV  548
            +DL IEGTGVFV
Sbjct  157  VDLFIEGTGVFV  168



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = +3

Query  180  VVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGV  356
            +V+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGV
Sbjct  54   LVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGV  113

Query  357  KQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGT  536
            KQASHLLKYDS LG FD DV+  G+DGISVDGKVIKVVS RNP+NLPW +  IDLVIEG 
Sbjct  114  KQASHLLKYDSILGTFDPDVQVAGNDGISVDGKVIKVVSDRNPVNLPWKDYEIDLVIEGP  173

Query  537  GVFV  548
            GVFV
Sbjct  174  GVFV  177



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  240  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  419
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGV+QASHLLKYDSTLGIFDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVEQASHLLKYDSTLGIFDADVK  60

Query  420  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            P GD  +SVDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  61   PSGDSALSVDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  103



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   199 bits (506),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  219  RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLG  398
            R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPL++IAINDTGGVKQASHLLKYDSTLG
Sbjct  2    RKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLEIIAINDTGGVKQASHLLKYDSTLG  61

Query  399  IFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            IF ADVK VGDD ISVDGK I+VVS+RNP NLPWGELGIDLVIEGTGVFV
Sbjct  62   IFGADVKAVGDDVISVDGKPIQVVSNRNPANLPWGELGIDLVIEGTGVFV  111



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   200 bits (509),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  219  RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLG  398
            +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG
Sbjct  63   KRAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLG  122

Query  399  IFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
             FDADVK  G+D ISVDGKVIKVVS RNPLNLPWG++ IDLVIEGTGVFV
Sbjct  123  TFDADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFV  172



>gb|AAB82133.1| glyceralehyde-3-phosphate dehydrogenase subunit [Oryza sativa 
Indica Group]
Length=343

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVIA  335
            D+  + VSF+T  VG  G  RRA  EAKLKVAINGFGR GRNFLRCWHGR  DSPL++I 
Sbjct  39   DNFMNPVSFRTHAVGTNGGARRAPTEAKLKVAINGFGRFGRNFLRCWHGRGDDSPLNIIP  98

Query  336  INDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGI  515
            INDTGGVKQASH LKY+STLGIFDADVKPVG++ +SV+G+VIKVVS RNP NLPWGELGI
Sbjct  99   INDTGGVKQASHRLKYNSTLGIFDADVKPVGENPLSVEGEVIKVVSDRNPSNLPWGELGI  158

Query  516  DLVIEGTGVF  545
            +L+IEGTG+F
Sbjct  159  ELLIEGTGLF  168



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLD++ INDTGGVKQASHLLKYDS LG 
Sbjct  34   RAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDIVVINDTGGVKQASHLLKYDSMLGT  93

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            FDADVK  G+D ISVDGKVIKVVS RNPLNLPWG++ IDLVIEGTGVFV
Sbjct  94   FDADVKVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFV  142



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +3

Query  234  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDAD  413
            EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG F+AD
Sbjct  68   EAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFNAD  127

Query  414  VKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            VK  G+D ISVDGKVIKVVS RNPLNLPWGE+GIDLVIEGTGVFV
Sbjct  128  VKVEGNDAISVDGKVIKVVSDRNPLNLPWGEMGIDLVIEGTGVFV  172



>gb|AFW58485.1| hypothetical protein ZEAMMB73_956640 [Zea mays]
Length=372

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 107/132 (81%), Gaps = 4/132 (3%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVI  332
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRI RNFLRCWHGR D SPLDVI
Sbjct  8    DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIRRNFLRCWHGRDDDSPLDVI  67

Query  333  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  512
            AINDTG VKQASHLLKYDS LGIFDAD + VGD+ ISVD KVIKVVS RNP NLPWGEL 
Sbjct  68   AINDTGDVKQASHLLKYDSLLGIFDADAELVGDNAISVDDKVIKVVSDRNPSNLPWGELS  127

Query  513  IDLVIEGTGVFV  548
            +DL IEGTGVFV
Sbjct  128  VDLFIEGTGVFV  139



>emb|CAC80372.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=314

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  255  INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDD  434
            INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF+ADVKPVG D
Sbjct  2    INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTD  61

Query  435  GISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GISVDGKVI+VVS+RNP NLPWG+LGIDLVIEGTGVFV
Sbjct  62   GISVDGKVIQVVSNRNPSNLPWGDLGIDLVIEGTGVFV  99



>ref|XP_008664191.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Zea mays]
Length=420

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 107/132 (81%), Gaps = 4/132 (3%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVI  332
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRI RNFLRCWHGR D SPLDVI
Sbjct  56   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIRRNFLRCWHGRDDDSPLDVI  115

Query  333  AINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELG  512
            AINDTG VKQASHLLKYDS LGIFDAD + VGD+ ISVD KVIKVVS RNP NLPWGEL 
Sbjct  116  AINDTGDVKQASHLLKYDSLLGIFDADAELVGDNAISVDDKVIKVVSDRNPSNLPWGELS  175

Query  513  IDLVIEGTGVFV  548
            +DL IEGTGVFV
Sbjct  176  VDLFIEGTGVFV  187



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGGVKQASHLLKYDSTLGIFDADV
Sbjct  1    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADV  60

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            KP G+  ISVDGK+I+VVS+RNP  LPW ELGID+VIEGTGVFV
Sbjct  61   KPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFV  104



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  240  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  419
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  420  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFV
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFV  103



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  240  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  419
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  420  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFV
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFV  103



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  240  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  419
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  420  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFV
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFV  103



>emb|CAC80373.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=312

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  255  INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDD  434
            INGFGRIGRNFLRCWHGRKDSPL+VIAIND+GGVKQASHLLKYDSTLGIFDADVKPVG D
Sbjct  2    INGFGRIGRNFLRCWHGRKDSPLEVIAINDSGGVKQASHLLKYDSTLGIFDADVKPVGTD  61

Query  435  GISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GISVDGKVIKVVS RNP+NLPW +LG+DLVIEGTGVFV
Sbjct  62   GISVDGKVIKVVSDRNPINLPWKDLGVDLVIEGTGVFV  99



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 102/120 (85%), Gaps = 2/120 (2%)
 Frame = +3

Query  165  DDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  344
            D+  S V+FQTS V     + V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAIND
Sbjct  39   DEFVSAVTFQTSAVS--SLKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAIND  96

Query  345  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  524
            TGGVKQASHLLKYDSTLGIFDADVKP GD  +SVDGK+IK+VS+RNP  LPW ELGID++
Sbjct  97   TGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKIIKIVSNRNPSLLPWKELGIDIL  156



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RAV EAK+KVAINGFGRIGRNF+RCW GRKDSPLDV+ INDTGGVKQASHLLKYDS LG 
Sbjct  64   RAVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGT  123

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F+ADVK  G++ ISVDGKVIKVVS RNPLNLPWG++ IDLVIEGTGVFV
Sbjct  124  FNADVKVEGNNAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFV  172



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RAV EAK+KVAINGFGRIGRNF+RCW GRKDSPLDV+ INDTGGVKQASHLLKYDS LG 
Sbjct  36   RAVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGT  95

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F+ADVK  G++ ISVDGKVIKVVS RNPLNLPWG++ IDLVIEGTGVFV
Sbjct  96   FNADVKVEGNNAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFV  144



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +3

Query  240  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  419
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  420  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFV
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFV  103



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   191 bits (484),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  240  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  419
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ IND GGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDAGGVKQASHLLKYDSILGTFDADVK  60

Query  420  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
              GD  ISVDGKVIKVVS RNP+NLPWG++GIDLVIEGTGVFV
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFV  103



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RAV EAK++VAINGFGRIGRNF+RCWHGRKDSPL+V+ INDTGGVKQASHLLKYDS LG 
Sbjct  36   RAVTEAKIRVAINGFGRIGRNFVRCWHGRKDSPLEVVVINDTGGVKQASHLLKYDSMLGT  95

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F+ADVK V  DGISVDGK IKVVS RNPLNLPWG++ IDLVIEGTGVFV
Sbjct  96   FNADVK-VDGDGISVDGKTIKVVSDRNPLNLPWGDMDIDLVIEGTGVFV  143



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   185 bits (470),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  264  FGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDDGIS  443
            FGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDSTLGIFDADVKP GD  +S
Sbjct  1    FGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALS  60

Query  444  VDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            VDGK+IK+VS RNP NLPWGELGIDLVIEGTGVFV
Sbjct  61   VDGKIIKIVSDRNPSNLPWGELGIDLVIEGTGVFV  95



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = +3

Query  192  QTSVVGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVK  359
            Q + V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVK
Sbjct  17   QKAGVRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVK  76

Query  360  QASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTG  539
            QASHLLKYDSTLG FDADVK V D  ISVDGKVIK+VSSR+PL LPWGE+ +DLVIEGTG
Sbjct  77   QASHLLKYDSTLGTFDADVKIVDDSHISVDGKVIKIVSSRDPLQLPWGEMDVDLVIEGTG  136

Query  540  VFV  548
            VF+
Sbjct  137  VFI  139



>emb|CAC80392.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Spirogyra 
sp.]
Length=318

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPV  425
            KV INGFGRIGRNF+RCWHGR DSPL+VIAINDTGGVKQA+HLLKYDS LGIF+ADVK  
Sbjct  1    KVGINGFGRIGRNFIRCWHGRDDSPLEVIAINDTGGVKQAAHLLKYDSMLGIFNADVKIA  60

Query  426  GDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
             D+ ISVDGK+IKVVS RNPLNLPWGE+GIDLVIEGTGVF+
Sbjct  61   DDNSISVDGKIIKVVSDRNPLNLPWGEMGIDLVIEGTGVFI  101



>gb|KDO85183.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85184.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=275

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>gb|KDO85177.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85178.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=304

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>ref|XP_006383782.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61579.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=308

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  139  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>gb|KDO85181.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85182.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=269

 Score =   181 bits (458),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>gb|KDO85176.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=329

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>ref|XP_006435407.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48647.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=329

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>gb|KDO85179.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85180.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=248

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  177  SVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGV  356
            SV    +S V G   R   EAKL+VAINGFGRIGRNFLRCWHGR DSPL+VIAIND+GGV
Sbjct  90   SVTRDVSSKVIGSGHRGETEAKLRVAINGFGRIGRNFLRCWHGRPDSPLEVIAINDSGGV  149

Query  357  KQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGT  536
            KQA+HLLKYDS LG F+ADVK V +  ISVDGKVI++VS+R+PL LPW ELGID+VIEGT
Sbjct  150  KQATHLLKYDSMLGTFNADVKTVDETHISVDGKVIQIVSNRDPLKLPWAELGIDIVIEGT  209

Query  537  GVFV  548
            GVFV
Sbjct  210  GVFV  213



>ref|XP_003603852.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=283

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  195  TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHL  374
            T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  375  LKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LKYDS LG F ADVK + ++ I+VDGK I VVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFV  187



>gb|KDO85175.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=309

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>emb|CAC80393.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=318

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPV  425
            KV INGFGRIGRNF+RCWHGRKDSPL+++ INDTGG+KQASHLLKYDS LG F ADVK  
Sbjct  1    KVGINGFGRIGRNFIRCWHGRKDSPLEIVVINDTGGLKQASHLLKYDSMLGTFAADVKVD  60

Query  426  GDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            G+D ISVDGK IKVVS RNPLNLPWGELGIDLVIEGTGVFV
Sbjct  61   GNDSISVDGKTIKVVSDRNPLNLPWGELGIDLVIEGTGVFV  101



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  201  VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  380
            VVG    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLK
Sbjct  71   VVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  130

Query  381  YDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            YDS LG F A+VK V ++ ISVDGK IKVVSSR+PL LPWGELGID+VIEGTGVFV
Sbjct  131  YDSMLGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWGELGIDIVIEGTGVFV  186



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  201  VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  380
            VVG    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLK
Sbjct  72   VVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  131

Query  381  YDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            YDS LG F A+VK V ++ ISVDGK IKVVSSR+PL LPWGELGID+VIEGTGVFV
Sbjct  132  YDSMLGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWGELGIDIVIEGTGVFV  187



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA  EAKLKVAINGFGRIGRNFLRCWHGR+DSPLDV+ +ND+GGV+ ASHLLKYDS LG 
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPLDVVVVNDSGGVRNASHLLKYDSMLGT  130

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V D  ISVDGK IKVVSSR+PL LPW E+GID+VIEGTGVFV
Sbjct  131  FKADVKIVDDTTISVDGKPIKVVSSRDPLKLPWAEMGIDIVIEGTGVFV  179



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR+DSP+DV+ +ND+GGV+ ASHLLKYD
Sbjct  71   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPIDVVVVNDSGGVRNASHLLKYD  130

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK V D  ISVDGK I VVSSR+PL LPWGELGID+VIEGTGVFV
Sbjct  131  SMLGTFKADVKIVDDTTISVDGKPITVVSSRDPLKLPWGELGIDIVIEGTGVFV  184



>gb|KJB57937.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=278

 Score =   178 bits (452),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK V ++ ISVDGK IKVVS+R+P+ LPW ELGID+VIEGTGVFV
Sbjct  137  SMLGTFKADVKIVDNETISVDGKPIKVVSNRDPVQLPWAELGIDIVIEGTGVFV  190



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI +ND+GGV+ ASHLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVVNDSGGVRNASHLLKYD  125

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK V D+ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  126  SMLGTFKADVKIVDDETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  179



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  139  FKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = +3

Query  171  LHSVVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  344
            L  VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND
Sbjct  58   LFDVVSAQLTPKTTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVND  117

Query  345  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  524
            +GGVK ASHLLKYDS LG F ADVK V ++ ISVDGK IKVVSSR+PL LPW ELGID+V
Sbjct  118  SGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIV  177

Query  525  IEGTGVFV  548
            IEGTGVFV
Sbjct  178  IEGTGVFV  185



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 93/103 (90%), Gaps = 2/103 (2%)
 Frame = +3

Query  240  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  419
            KLKVAINGFGRIGRNFLRCWHG KDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHG-KDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  59

Query  420  PVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
              GD  ISV GKVIKVVS RNP+NLPWG++GIDLVIEGTGVFV
Sbjct  60   TAGDSAISV-GKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFV  101



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V +  ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  139  FKADVKIVDNTTISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LGIF ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGIFKADV  143

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK ++VVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  144  KIVDNETISVDGKPVQVVSSRDPLKLPWAELGIDIVIEGTGVFV  187



>gb|KJB57939.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=320

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK V ++ ISVDGK IKVVS+R+P+ LPW ELGID+VIEGTGVFV
Sbjct  137  SMLGTFKADVKIVDNETISVDGKPIKVVSNRDPVQLPWAELGIDIVIEGTGVFV  190



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGTFKADV  141

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  142  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  185



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGT  139

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK+IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  140  FKADVKIVNNETISVDGKLIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  188



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYD
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYD  133

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK V ++ ISVDGK+IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  134  SMLGTFKADVKIVDNETISVDGKLIKVVSSRDPLKLPWTELGIDIVIEGTGVFV  187



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +3

Query  180  VVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  353
            VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GG
Sbjct  62   VVSAQLTPKTTGSAPAKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121

Query  354  VKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEG  533
            VK ASHLLKYDS LG F ADVK V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEG
Sbjct  122  VKNASHLLKYDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEG  181

Query  534  TGVFV  548
            TGVFV
Sbjct  182  TGVFV  186



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  143  KIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  186



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = +3

Query  171  LHSVVSFQTSV--VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  344
             + VV+ Q S    G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND
Sbjct  38   FYDVVAAQLSTKRTGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND  97

Query  345  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  524
            +GGVK ASHLLKYDS LG F A+VK + ++ I+VDGK IKVVSSR+PL LPW ELGID+V
Sbjct  98   SGGVKNASHLLKYDSMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIV  157

Query  525  IEGTGVFV  548
            IEGTGVFV
Sbjct  158  IEGTGVFV  165



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  143  KIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  186



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  48   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  107

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  108  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  156



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  139  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  143  KIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  186



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  53   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  112

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  113  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  156



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  145  KIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  188



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 99/119 (83%), Gaps = 4/119 (3%)
 Frame = +3

Query  204  VGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  371
            V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVKQASH
Sbjct  21   VRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASH  80

Query  372  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LLKYDSTLG F ADVK V D  ISVDGK IK+VSSR+PL LPW E+ IDLVIEGTGVF+
Sbjct  81   LLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMNIDLVIEGTGVFI  139



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  141

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  142  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  185



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  141

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  142  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  185



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  143  KIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  186



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LGIF ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGIFKADV  143

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK ++VVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  144  KIVDNETISVDGKPVQVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = +3

Query  171  LHSVVSFQTSVV-GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDT  347
            L   V  Q S+V  G   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA+ND+
Sbjct  40   LFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAVNDS  99

Query  348  GGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVI  527
            GGVK ASHLLKYDS LG F A+VK V D  ISVDGK I VVSSR+PL LPW ++GID+VI
Sbjct  100  GGVKNASHLLKYDSMLGTFKANVKVVDDKTISVDGKNITVVSSRDPLKLPWADMGIDIVI  159

Query  528  EGTGVFV  548
            EGTGVFV
Sbjct  160  EGTGVFV  166



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  189  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  368
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  369  HLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            HLLKYDS LG F ADVK + ++ I+VDGK I VVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  128  HLLKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFV  187



>gb|ABA01156.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
incerta]
Length=342

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 99/119 (83%), Gaps = 4/119 (3%)
 Frame = +3

Query  204  VGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  371
            V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVKQASH
Sbjct  8    VRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASH  67

Query  372  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LLKYDSTLG F ADVK V D  ISVDGK IK+VSSR+PL LPW E+ IDLVIEGTGVF+
Sbjct  68   LLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMDIDLVIEGTGVFI  126



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = +3

Query  171  LHSVVSFQTSVV-GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDT  347
            L   V  Q S+V  G   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA+ND+
Sbjct  40   LFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAVNDS  99

Query  348  GGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVI  527
            GGVK ASHLLKYDS LG F A+VK V D  ISVDGK I VVSSR+PL LPW ++GID+VI
Sbjct  100  GGVKNASHLLKYDSMLGTFKANVKVVDDKTISVDGKNIAVVSSRDPLKLPWADMGIDIVI  159

Query  528  EGTGVFV  548
            EGTGVFV
Sbjct  160  EGTGVFV  166



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 99/119 (83%), Gaps = 4/119 (3%)
 Frame = +3

Query  204  VGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  371
            V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVKQASH
Sbjct  16   VRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASH  75

Query  372  LLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            LLKYDSTLG F ADVK V D  ISVDGK IK+VSSR+PL LPW E+ IDLVIEGTGVF+
Sbjct  76   LLKYDSTLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMDIDLVIEGTGVFI  134



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  139

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  140  FKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  188



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  134

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  135  FKADVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  183



>gb|ABD37960.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Coleochaete 
scutata]
Length=314

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +3

Query  255  INGFGRIGRNFLRCWHGR-KDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGD  431
            INGFGRIGRNF+RCWHGR KDSPL+VIAINDTGGVKQASHLLKYDS LG F A+VK VGD
Sbjct  1    INGFGRIGRNFIRCWHGRGKDSPLEVIAINDTGGVKQASHLLKYDSMLGTFGAEVKIVGD  60

Query  432  DGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            D ISVDG VIKVVS RNPLN+PWG++G+DLVIEGTGVFV
Sbjct  61   DAISVDGHVIKVVSDRNPLNMPWGKMGVDLVIEGTGVFV  99



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = +3

Query  171  LHSVVSFQ--TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  344
             H V++ Q  T   G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FHDVIAAQLTTKTTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  345  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  524
            +GGVK A+HLLKYDS LG F ADVK V ++  S+DGK IKVVS+R+PL LPW +LGID+V
Sbjct  119  SGGVKSATHLLKYDSILGTFKADVKIVDNETFSIDGKSIKVVSNRDPLKLPWADLGIDIV  178

Query  525  IEGTGVFV  548
            IEGTGVFV
Sbjct  179  IEGTGVFV  186



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  139  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  139

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  140  FKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  188



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  139  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = +3

Query  171  LHSVVSFQ--TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  344
             H V++ Q  T   G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FHDVIAAQLTTKPTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  345  TGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLV  524
            +GGVK A+HLLKYDS LG F ADVK + ++  S+DGK IKVVS+R+PL LPW ELGID+V
Sbjct  119  SGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIV  178

Query  525  IEGTGVFV  548
            IEGTGVFV
Sbjct  179  IEGTGVFV  186



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG 
Sbjct  78   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGT  137

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  138  FKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  186



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGT  134

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  135  FKADVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  183



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  134

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  135  FKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  183



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  162  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            +D L + ++ ++  V     R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +N
Sbjct  61   FDVLAAQLTPKSEGVPSASVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVN  120

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            D+GGVK ASHLLKYDS LG F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+
Sbjct  121  DSGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDI  180

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  181  VIEGTGVFV  189



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +3

Query  162  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            +D + + ++ +T+  G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +N
Sbjct  61   FDAVAAQLTLKTA--GSTTVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVN  118

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            D+GGVK ASHLLKYDS LG F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+
Sbjct  119  DSGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDI  178

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  179  VIEGTGVFV  187



>gb|ABD37958.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Chara vulgaris]
Length=318

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPV  425
            KV INGFGRIGRNFLRCWH RKDSPL+++AINDTGGVKQASHLLKYDS LG+F  +VK  
Sbjct  1    KVGINGFGRIGRNFLRCWHTRKDSPLEIVAINDTGGVKQASHLLKYDSMLGVFSGNVKIE  60

Query  426  GDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
             +D ISVDGK I++VS+RNPLNLPWGE+GIDLVIEGTGVFV
Sbjct  61   AEDVISVDGKSIQIVSNRNPLNLPWGEMGIDLVIEGTGVFV  101



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  189  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  368
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  369  HLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            HLLKYDS LG F ADVK + ++ I+VDGK I VVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  128  HLLKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFV  187



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  189  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  368
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  369  HLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            HLLKYDS LG F ADVK + ++ I+VDGK I VVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  128  HLLKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFV  187



>gb|EYU41183.1| hypothetical protein MIMGU_mgv1a025772mg, partial [Erythranthe 
guttata]
Length=182

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGTFKADV  144

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIE  530
            K V ++ ISVDGK+IKVVSSR+PL LPW ELGID+VIE
Sbjct  145  KIVNNETISVDGKLIKVVSSRDPLKLPWAELGIDIVIE  182



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  137  SMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLQLPWAELGIDIVIEGTGVFV  190



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  101  RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  160

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  161  FKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  209



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V D  ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  139  FKADVKIVDDSTISVDGKHIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +3

Query  162  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  341
            +D + + ++ QTS  G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +N
Sbjct  61   FDAVAAQLTPQTS--GSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVN  118

Query  342  DTGGVKQASHLLKYDSTLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDL  521
            D+GGVK ASHLLKYDS LG F AD+K V ++ ISVDGK IKVVS+R+PL LPW E+GID+
Sbjct  119  DSGGVKNASHLLKYDSMLGTFKADIKIVDNETISVDGKPIKVVSNRDPLKLPWAEMGIDI  178

Query  522  VIEGTGVFV  548
            VIEGTGVFV
Sbjct  179  VIEGTGVFV  187



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK +KVVSSR+PL LPW E+GID+VIEGTGVFV
Sbjct  139  FKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFV  187



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK +KVVSSR+PL LPW E+GID+VIEGTGVFV
Sbjct  139  FKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFV  187



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK +KVVSSR+PL LPW E+GID+VIEGTGVFV
Sbjct  139  FKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFV  187



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKADV  143

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  144  KIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    RA  EAKLKVAINGFGRIGRNFLRCWH R++SPL+V+ +ND+GGV+ ASHLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHERENSPLEVVVVNDSGGVRNASHLLKYD  125

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK V D  ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  126  SMLGTFKADVKIVDDQTISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  179



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGT  134

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  135  FKAEVKIVDNETISVDGKIIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  183



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  74   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVLVVNDSGGVKNASHLLKYDSMLGT  133

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  134  FKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  182



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  76   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVLVVNDSGGVKNASHLLKYDSMLGT  135

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  136  FKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  184



>emb|CAC80391.2| glyceraldehyde-3-phosphate dehydrogenase [Klebsormidium flaccidum]
Length=315

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  246  KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPV  425
            +  INGFGRIGRNFLRCW+GR++SPL+V+ INDTGGVKQASHLLKYDS LG FDADVK V
Sbjct  1    EFGINGFGRIGRNFLRCWNGRENSPLEVVVINDTGGVKQASHLLKYDSILGTFDADVKVV  60

Query  426  GDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            GDD ISVDGKVIKVVS+R+P  LPWGE+ IDLVIEGTGVFV
Sbjct  61   GDDAISVDGKVIKVVSNRDPTKLPWGEMNIDLVIEGTGVFV  101



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  30   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGT  89

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  90   FKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  138



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK A+HLLKYDS LG F A V
Sbjct  46   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNAAHLLKYDSMLGTFKAAV  105

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  106  KIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  149



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    + V  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYD
Sbjct  70   GSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYD  129

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F A+VK + ++ I+VDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  130  SMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  183



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    + V  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYD
Sbjct  74   GSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYD  133

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F A+VK + ++ I+VDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  134  SMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  187



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK V ++ ISVDGK I+VVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  126  SMLGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFV  179



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYD
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYD  133

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK + ++ I+VDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  134  SMLGTFKADVKILDNETITVDGKSIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  187



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYD
Sbjct  75   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYD  134

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK + ++ I+VDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  135  SMLGTFKADVKILDNETITVDGKSIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  188



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYD
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYD  133

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK + ++ I+VDGK IKVVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  134  SMLGTFKADVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  187



>gb|ABR16095.1| unknown [Picea sitchensis]
Length=229

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  237  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  416
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG F A+V
Sbjct  92   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKANV  151

Query  417  KPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            K V +  ISVDGK I VVSSR+PL LPW ELGID+VIEGTGVFV
Sbjct  152  KVVDNKTISVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFV  195



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLLKYDS LG 
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYDSMLGT  130

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK I+VVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  131  FKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFV  179



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLLKYDS LG 
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYDSMLGT  130

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK I+VVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  131  FKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFV  179



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLLKYDS LG 
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYDSMLGT  130

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F ADVK V ++ ISVDGK I+VVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  131  FKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFV  179



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  207  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  386
            G    R    AKLKVAINGFGRIGRNFLRCWHGR++SPLDVI +ND+GGVK ASHLLKYD
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRENSPLDVIVVNDSGGVKNASHLLKYD  133

Query  387  STLGIFDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            S LG F ADVK V ++ ISVDGK IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  134  SMLGTFKADVKIVNNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  187



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGT  134

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  135  FKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  183



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  222  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  401
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG 
Sbjct  73   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGT  132

Query  402  FDADVKPVGDDGISVDGKVIKVVSSRNPLNLPWGELGIDLVIEGTGVFV  548
            F A+VK V ++ ISVDGK+IKVVS+R+PL LPW ELGID+VIEGTGVFV
Sbjct  133  FKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720