BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006M24

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02673.1|  unnamed protein product                                134   9e-34   Coffea canephora [robusta coffee]
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             129   5e-32   Prunus persica
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           128   1e-31   Prunus mume [ume]
gb|KDP32156.1|  hypothetical protein JCGZ_12617                         125   1e-30   Jatropha curcas
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           124   5e-30   Pyrus x bretschneideri [bai li]
gb|ADL36578.1|  ARF domain class transcription factor                   123   7e-30   Malus domestica [apple tree]
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg             120   7e-29   Citrus clementina [clementine]
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein             120   8e-29   
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like      120   8e-29   Citrus sinensis [apfelsine]
ref|XP_010105114.1|  Auxin-responsive protein IAA9                      119   2e-28   
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             118   4e-28   Phaseolus vulgaris [French bean]
ref|XP_002509993.1|  Auxin-responsive protein IAA19, putative           117   1e-27   
gb|ACU19961.1|  unknown                                                 114   1e-27   Glycine max [soybeans]
gb|ACJ84551.1|  unknown                                                 116   2e-27   Medicago truncatula
gb|AFK49626.1|  unknown                                                 116   2e-27   Medicago truncatula
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    114   8e-27   Cicer arietinum [garbanzo]
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           114   9e-27   Glycine max [soybeans]
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    114   1e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    113   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_007047690.1|  Transcription factor, putative isoform 4           112   6e-26   
ref|XP_007047688.1|  Transcription factor, putative isoform 2           112   6e-26   Theobroma cacao [chocolate]
ref|XP_007047687.1|  Transcription factor, putative isoform 1           112   7e-26   Theobroma cacao [chocolate]
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      112   7e-26   Sesamum indicum [beniseed]
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             111   8e-26   Phaseolus vulgaris [French bean]
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    111   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008357957.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    107   4e-25   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                108   6e-25   Erythranthe guttata [common monkey flower]
gb|KHN46011.1|  Auxin-responsive protein IAA9                           109   6e-25   Glycine soja [wild soybean]
gb|EYU44548.1|  hypothetical protein MIMGU_mgv1a010252mg                108   6e-25   Erythranthe guttata [common monkey flower]
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...    108   7e-25   
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...    108   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           108   2e-24   Fragaria vesca subsp. vesca
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    107   3e-24   
emb|CAN77436.1|  hypothetical protein VITISV_007399                     107   4e-24   Vitis vinifera
ref|NP_001275473.1|  Aux/IAA protein                                    107   4e-24   Solanum tuberosum [potatoes]
ref|NP_001268170.1|  Aux/IAA protein                                    107   4e-24   Vitis vinifera
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              107   4e-24   Vitis vinifera
gb|AAM12952.1|  auxin-regulated protein                                 106   6e-24   Zinnia elegans [garden zinnia]
gb|KHN22187.1|  Auxin-responsive protein IAA9                           106   6e-24   Glycine soja [wild soybean]
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...    106   6e-24   Glycine max [soybeans]
ref|XP_006585902.1|  PREDICTED: auxin-responsive protein IAA9-lik...    106   7e-24   
gb|ABB55368.1|  Aux/IAA protein-like                                    105   1e-23   Solanum tuberosum [potatoes]
gb|KJB58782.1|  hypothetical protein B456_009G226000                    104   3e-23   Gossypium raimondii
gb|KJB71171.1|  hypothetical protein B456_011G109000                    103   3e-23   Gossypium raimondii
gb|AAL92850.1|  Aux/IAA protein                                         104   3e-23   Vitis vinifera
gb|KJB58781.1|  hypothetical protein B456_009G226000                    104   4e-23   Gossypium raimondii
gb|KCW59655.1|  hypothetical protein EUGRSUZ_H02407                     104   4e-23   Eucalyptus grandis [rose gum]
gb|KJB58777.1|  hypothetical protein B456_009G226000                    104   4e-23   Gossypium raimondii
gb|KJB71172.1|  hypothetical protein B456_011G109000                    103   4e-23   Gossypium raimondii
gb|KJB71166.1|  hypothetical protein B456_011G109000                    103   4e-23   Gossypium raimondii
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    104   4e-23   Eucalyptus grandis [rose gum]
gb|KJB71165.1|  hypothetical protein B456_011G109000                    103   4e-23   Gossypium raimondii
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...    103   5e-23   
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                     103   5e-23   Gossypium arboreum [tree cotton]
gb|KJB18143.1|  hypothetical protein B456_003G035700                    102   5e-23   Gossypium raimondii
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      103   7e-23   Glycine max [soybeans]
gb|AAB70005.1|  GH1 protein                                             103   8e-23   Glycine max [soybeans]
gb|KJB18142.1|  hypothetical protein B456_003G035700                    102   9e-23   Gossypium raimondii
gb|KJB18140.1|  hypothetical protein B456_003G035700                    103   9e-23   Gossypium raimondii
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    103   9e-23   
gb|KJB18136.1|  hypothetical protein B456_003G035700                    103   1e-22   Gossypium raimondii
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          102   1e-22   
ref|XP_002862301.1|  hypothetical protein ARALYDRAFT_920936             100   2e-22   Arabidopsis lyrata subsp. lyrata
gb|ACU23129.1|  unknown                                               99.8    3e-22   Glycine max [soybeans]
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      101   5e-22   Sesamum indicum [beniseed]
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 100   5e-22   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 100   6e-22   Malus domestica [apple tree]
gb|KCW68554.1|  hypothetical protein EUGRSUZ_F02172                     100   6e-22   Eucalyptus grandis [rose gum]
gb|KCW68553.1|  hypothetical protein EUGRSUZ_F02172                     100   7e-22   Eucalyptus grandis [rose gum]
gb|ADL70577.1|  indole-3-acetic acid inducible 9                        100   7e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KDP41528.1|  hypothetical protein JCGZ_15935                         100   7e-22   Jatropha curcas
gb|ADL70578.1|  indole-3-acetic acid inducible 9                        100   8e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29394.1|  indole-3-acetic acid inducible 9                        100   8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061570.1|  PREDICTED: auxin-responsive protein IAA9-like      100   8e-22   Eucalyptus grandis [rose gum]
gb|ADC29395.2|  indole-3-acetic acid inducible 9                        100   8e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70586.1|  indole-3-acetic acid inducible 9                        100   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70583.1|  indole-3-acetic acid inducible 9                        100   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29398.1|  indole-3-acetic acid inducible 9                        100   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851275.1|  auxin-responsive protein IAA9                         100   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864969.1|  auxin-induced protein IAA9                         100   1e-21   
dbj|BAB10673.1|  auxin-induced protein IAA9                             100   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528895.1|  transcription factor, putative                     100   1e-21   Ricinus communis
ref|NP_569017.2|  auxin-responsive protein IAA9                         100   1e-21   
gb|ADL70579.1|  indole-3-acetic acid inducible 9                      99.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like    99.8    1e-21   
gb|AAM64650.1|  auxin-induced protein IAA9                            99.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like    99.8    2e-21   Prunus mume [ume]
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9         99.8    2e-21   Glycine max [soybeans]
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                   99.0    3e-21   Gossypium arboreum [tree cotton]
ref|XP_007225723.1|  hypothetical protein PRUPE_ppa006744mg           98.6    3e-21   
gb|AEI70507.1|  auxin-responsive protein                              99.0    3e-21   Gossypium hirsutum [American cotton]
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg              98.2    5e-21   Erythranthe guttata [common monkey flower]
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg           98.2    5e-21   
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg           98.6    5e-21   Prunus persica
ref|XP_008440498.1|  PREDICTED: auxin-responsive protein IAA9-like    98.2    5e-21   Cucumis melo [Oriental melon]
gb|KJB64034.1|  hypothetical protein B456_010G031600                  97.8    6e-21   Gossypium raimondii
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like    97.8    7e-21   Nelumbo nucifera [Indian lotus]
gb|KJB64033.1|  hypothetical protein B456_010G031600                  97.8    7e-21   Gossypium raimondii
ref|XP_006279648.1|  hypothetical protein CARUB_v10026736mg           97.4    9e-21   Capsella rubella
gb|KJB64027.1|  hypothetical protein B456_010G031600                  97.4    1e-20   Gossypium raimondii
gb|ABD98054.1|  auxin-regulated protein                               96.7    1e-20   Striga asiatica [witchweed]
emb|CAC84706.1|  aux/IAA protein                                      96.7    2e-20   Populus tremula x Populus tremuloides
gb|AGV54485.1|  auxin-responsive protein                              96.3    2e-20   Phaseolus vulgaris [French bean]
ref|NP_001241389.1|  uncharacterized protein LOC100783314             95.9    4e-20   Glycine max [soybeans]
gb|KHN09036.1|  Auxin-responsive protein IAA8                         95.5    4e-20   Glycine soja [wild soybean]
gb|KHG08155.1|  Auxin-responsive IAA9 -like protein                   95.5    4e-20   Gossypium arboreum [tree cotton]
gb|KHN08222.1|  Auxin-responsive protein IAA8                         95.5    5e-20   Glycine soja [wild soybean]
gb|AFZ78618.1|  hypothetical protein                                  95.1    6e-20   Populus tomentosa [Chinese white poplar]
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...  95.1    7e-20   
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...  94.7    8e-20   
ref|XP_007047689.1|  Transcription factor, putative isoform 3         94.4    1e-19   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like    94.4    1e-19   Pyrus x bretschneideri [bai li]
ref|NP_001267710.1|  auxin-responsive protein IAA9-like               94.4    1e-19   Cucumis sativus [cucumbers]
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g           94.0    2e-19   Phaseolus vulgaris [French bean]
gb|KDO81312.1|  hypothetical protein CISIN_1g017824mg                 92.4    2e-19   Citrus sinensis [apfelsine]
gb|AFK38170.1|  unknown                                               93.6    2e-19   Lotus japonicus
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like    93.6    2e-19   Cicer arietinum [garbanzo]
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like    92.8    4e-19   Cucumis melo [Oriental melon]
gb|KDO81311.1|  hypothetical protein CISIN_1g017824mg                 92.4    4e-19   Citrus sinensis [apfelsine]
gb|KDO81310.1|  hypothetical protein CISIN_1g017824mg                 92.0    6e-19   Citrus sinensis [apfelsine]
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg           92.0    6e-19   Eutrema salsugineum [saltwater cress]
ref|XP_002302351.1|  auxin-responsive family protein                  92.4    6e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006394001.1|  hypothetical protein EUTSA_v10004532mg           92.0    7e-19   Eutrema salsugineum [saltwater cress]
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                 92.0    7e-19   Citrus sinensis [apfelsine]
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like    92.0    9e-19   Populus euphratica
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA9-like    91.7    1e-18   Cucumis sativus [cucumbers]
gb|ADL70574.1|  indole-3-acetic acid inducible 9                      90.9    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like    90.9    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg           90.9    2e-18   
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...  90.5    2e-18   Fragaria vesca subsp. vesca
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg           90.9    2e-18   Citrus clementina [clementine]
emb|CAJ13716.1|  auxin induced protein                                89.0    3e-18   Capsicum chinense [bonnet pepper]
ref|XP_010484401.1|  PREDICTED: auxin-responsive protein IAA9         90.1    4e-18   Camelina sativa [gold-of-pleasure]
gb|KHN04889.1|  Auxin-responsive protein IAA8                         89.0    6e-18   Glycine soja [wild soybean]
emb|CDY68170.1|  BnaCnng57860D                                        89.0    6e-18   Brassica napus [oilseed rape]
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...  89.4    8e-18   Citrus sinensis [apfelsine]
ref|XP_010104556.1|  Auxin-responsive protein IAA9                    89.4    8e-18   
emb|CDP00957.1|  unnamed protein product                              88.6    1e-17   Coffea canephora [robusta coffee]
ref|XP_010463449.1|  PREDICTED: auxin-responsive protein IAA9-lik...  88.2    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9         87.8    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like    87.4    3e-17   Nicotiana tomentosiformis
ref|XP_009150656.1|  PREDICTED: auxin-responsive protein IAA9-lik...  87.4    3e-17   Brassica rapa
ref|XP_009150655.1|  PREDICTED: auxin-responsive protein IAA9-lik...  87.0    3e-17   Brassica rapa
emb|CDY08767.1|  BnaA06g24570D                                        87.0    3e-17   Brassica napus [oilseed rape]
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like    86.7    5e-17   Nicotiana sylvestris
gb|AID60626.1|  auxin-responsive protein IAA8                         84.0    3e-16   Dimocarpus longan [longan]
dbj|BAP94244.1|  auxin-responsive protein IAA homolog                 80.1    4e-16   Rubus grayanus
emb|CAD10639.1|  IAA9 protein                                         84.3    4e-16   Nicotiana tabacum [American tobacco]
emb|CDY45607.1|  BnaCnng13150D                                        83.6    5e-16   Brassica napus [oilseed rape]
dbj|BAP94262.1|  auxin-responsive protein IAA homolog                 79.7    6e-16   Rubus sp. MM-2014
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...  83.6    6e-16   Fragaria vesca subsp. vesca
dbj|BAP94276.1|  auxin-responsive protein IAA homolog                 79.3    7e-16   Rubus sp. MM-2014
gb|AFK49555.1|  unknown                                               79.3    1e-15   Medicago truncatula
emb|CDY18679.1|  BnaA09g07160D                                        82.0    2e-15   Brassica napus [oilseed rape]
gb|AFK43616.1|  unknown                                               80.5    2e-15   Lotus japonicus
ref|NP_001237053.1|  uncharacterized protein LOC100500373             80.5    2e-15   
gb|AFK38538.1|  unknown                                               81.6    3e-15   Lotus japonicus
emb|CBI19314.3|  unnamed protein product                              80.9    5e-15   Vitis vinifera
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)               80.9    5e-15   Medicago truncatula
gb|ABY48132.1|  GH1 protein                                           80.9    6e-15   Medicago truncatula
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...  78.6    2e-14   Brassica rapa
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like    79.3    2e-14   Cicer arietinum [garbanzo]
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...  78.2    3e-14   Brassica rapa
ref|XP_010666360.1|  PREDICTED: auxin-responsive protein IAA8-like    79.0    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010444576.1|  PREDICTED: auxin-responsive protein IAA9-like    77.8    8e-14   
emb|CAI77628.1|  Aux/IAA protein                                      77.0    1e-13   Solanum lycopersicum
gb|KEH28135.1|  auxin response factor                                 73.9    9e-13   Medicago truncatula
ref|XP_003615390.1|  Auxin-responsive protein IAA5                    74.7    1e-12   Medicago truncatula
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8         74.3    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...  73.9    2e-12   
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like    73.6    2e-12   Camelina sativa [gold-of-pleasure]
gb|ADL70561.1|  indole-3-acetic acid inducible 8                      71.2    7e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70564.1|  indole-3-acetic acid inducible 8                      71.2    7e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70565.1|  indole-3-acetic acid inducible 8                      70.9    7e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29393.2|  indole-3-acetic acid inducible 8                      71.2    8e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70563.1|  indole-3-acetic acid inducible 8                      70.9    8e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70572.1|  indole-3-acetic acid inducible 8                      70.9    8e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70566.1|  indole-3-acetic acid inducible 8                      70.9    8e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70573.1|  indole-3-acetic acid inducible 8                      70.9    8e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70567.1|  indole-3-acetic acid inducible 8                      70.9    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...  72.4    8e-12   Tarenaya hassleriana [spider flower]
gb|ADL70569.1|  indole-3-acetic acid inducible 8                      71.2    8e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29390.2|  indole-3-acetic acid inducible 8                      70.9    9e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70571.1|  indole-3-acetic acid inducible 8                      70.9    9e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70570.1|  indole-3-acetic acid inducible 8                      70.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850028.1|  auxin-responsive protein IAA8                       71.2    1e-11   
ref|NP_179852.1|  auxin-responsive protein IAA8                       71.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29389.2|  indole-3-acetic acid inducible 8                      70.1    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70562.1|  indole-3-acetic acid inducible 8                      70.1    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189579.1|  auxin-responsive protein IAA8                    71.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg           70.5    3e-11   
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg           70.5    3e-11   
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...  70.5    3e-11   Tarenaya hassleriana [spider flower]
gb|EPS59988.1|  auxin-regulated protein                               70.1    4e-11   Genlisea aurea
ref|XP_002878628.1|  indoleacetic acid-induced protein 8              69.7    4e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_006404728.1|  hypothetical protein EUTSA_v10000236mg           70.1    4e-11   Eutrema salsugineum [saltwater cress]
gb|ADL70568.1|  indole-3-acetic acid inducible 8                      68.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29392.2|  indole-3-acetic acid inducible 8                      67.4    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29391.2|  indole-3-acetic acid inducible 8                      67.4    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540        68.2    2e-10   Amborella trichopoda
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like    67.0    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010527157.1|  PREDICTED: auxin-responsive protein IAA8         66.2    1e-09   Tarenaya hassleriana [spider flower]
emb|CDY66936.1|  BnaC02g47310D                                        64.3    2e-09   Brassica napus [oilseed rape]
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8         62.8    7e-09   Brassica rapa
emb|CDY25617.1|  BnaA04g13090D                                        62.8    8e-09   Brassica napus [oilseed rape]
ref|XP_010555426.1|  PREDICTED: auxin-responsive protein IAA8-like    61.6    4e-08   Tarenaya hassleriana [spider flower]
emb|CDX89499.1|  BnaC04g35180D                                        60.5    5e-08   
gb|AAM76220.1|  putative IAA-responsive protein 9                     49.3    1e-04   Gossypium herbaceum [Arabian cotton]
gb|AAM76222.1|  putative IAA-responsive protein 9                     49.3    1e-04   Gossypium hirsutum [American cotton]
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g           51.2    1e-04   Phaseolus vulgaris [French bean]
gb|AAM76223.1|  putative IAA-responsive protein 9                     48.5    2e-04   Gossypium hirsutum [American cotton]
ref|XP_003637871.1|  Auxin-responsive aux/iaa gene family member      48.9    5e-04   
gb|AAM76221.1|  putative IAA-responsive protein 9                     47.4    5e-04   Gossypium raimondii
ref|XP_003637872.1|  Auxin-responsive aux/iaa gene family member      48.5    5e-04   
gb|ACU24212.1|  unknown                                               47.8    6e-04   Glycine max [soybeans]
gb|KEH27147.1|  auxin response factor                                 48.9    6e-04   Medicago truncatula
gb|AFK45766.1|  unknown                                               48.9    7e-04   Medicago truncatula



>emb|CDP02673.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG   EGQGN SVMASS ++DC+S  G  LKERNYLGLSDSS   +S ++    +
Sbjct  1    MSPPLLGIEGEGQGNVSVMASSKSVDCVSNNGLGLKERNYLGLSDSSEESTSMSTVSKEK  60

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFT  515
            K  LNLKAT+LRLGLPGSQSP+R+ ELN  S+ KFDEKPLFPLLPSKDGI SS+ K+  +
Sbjct  61   KSSLNLKATDLRLGLPGSQSPERESELNLLSSDKFDEKPLFPLLPSKDGICSSIHKSVVS  120

Query  516  GNKRGFLDTM  545
            GNKR F DT+
Sbjct  121  GNKRVFSDTI  130



>ref|XP_007205358.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 ref|XP_007205359.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06557.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06558.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
Length=378

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 102/131 (78%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG   EGQ NGS++ASS ++DCIS  GS LKERNYLGLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  339  K-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
            K ++LN +ATELRLGLPGSQ+P+R+ +L   S+GK DEKPLFPLLPSKDGI SS  K   
Sbjct  61   KKNKLNFQATELRLGLPGSQTPEREPDLCLLSSGKLDEKPLFPLLPSKDGICSSSQKNVV  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF DTM
Sbjct  121  SGNKRGFADTM  131



>ref|XP_008236708.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236714.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236721.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236728.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
Length=378

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 101/131 (77%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG   EGQ NGS++ASS ++DCIS  GS LKERNYLGLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  339  K-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
            K ++LN +ATELRLGLPGSQSP+R  +L   S+GK DEKPLFPLLPSKDGI SS  K   
Sbjct  61   KKNKLNFQATELRLGLPGSQSPERVPDLCLLSSGKLDEKPLFPLLPSKDGICSSSQKNVV  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF DTM
Sbjct  121  SGNKRGFADTM  131



>gb|KDP32156.1| hypothetical protein JCGZ_12617 [Jatropha curcas]
Length=380

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 100/131 (76%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG   EG+ N S++ASS ++DCISQ G  L ERNYLGLSD SSVDSSA   +  E
Sbjct  1    MSPPLLGVEEEGENNVSLVASSPSIDCISQNGCGLTERNYLGLSDCSSVDSSAVPSLSKE  60

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
             K+ LNLKATELRLGLPGSQSP+R+ +++  STGK DEKPLFPLLP KDGI SS  K   
Sbjct  61   TKNNLNLKATELRLGLPGSQSPERETDVSLLSTGKLDEKPLFPLLPLKDGICSSSQKHVV  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF DTM
Sbjct  121  SGNKRGFSDTM  131



>ref|XP_009344514.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344515.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344516.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
Length=373

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 97/130 (75%), Gaps = 6/130 (5%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgvVN  335
            MSP +LG   EGQ NGS++A S ++DCIS  GS LKERNYLGLSD SS   S+ ++    
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  515
             K+ LN KATELRLGLPGSQSP+R+ +L   ++GK DEKPLFPLLPSKDGI SS + +  
Sbjct  61   TKNNLNFKATELRLGLPGSQSPEREPDLCLLNSGKLDEKPLFPLLPSKDGICSSSQKN--  118

Query  516  GNKRGFLDTM  545
            GNKRGF DTM
Sbjct  119  GNKRGFADTM  128



>gb|ADL36578.1| ARF domain class transcription factor [Malus domestica]
Length=373

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 98/130 (75%), Gaps = 6/130 (5%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasg-vVN  335
            MSP +LG   EGQ NGS++A S ++DCISQ  S LKERNYLGLSD SSVDSS  S     
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISQNSSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  515
             K+ LN KATELRLGLPGSQSP+R+ +L   ++GK DEKPLFPLLPSKDGI SS + +  
Sbjct  61   TKNNLNFKATELRLGLPGSQSPEREPDLCLLNSGKLDEKPLFPLLPSKDGICSSSQKN--  118

Query  516  GNKRGFLDTM  545
            GNKRGF DTM
Sbjct  119  GNKRGFADTM  128



>ref|XP_006426197.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 ref|XP_006426198.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39437.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39438.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
Length=376

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  MMSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYl-glsdsssvdssaasgvV  332
            M  P +LG   EGQ N S+MASS + DCISQ  S L+ERNYL     SS   S+A+S  V
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  509
            + K++LNLKATELRLGLPGS+SP+R+ +L+  S+GK DEKPLFPLLPSKDGI   S K  
Sbjct  60   DNKNKLNLKATELRLGLPGSESPEREPDLSLLSSGKLDEKPLFPLLPSKDGICPGSQKNV  119

Query  510  FTGNKRGFLDTMGRLCD  560
             +GNKRGF DTM R  +
Sbjct  120  VSGNKRGFSDTMDRFSE  136



>ref|XP_003628839.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AET03315.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=356

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = +3

Query  156  LYDMMSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaa  320
            ++++MSP +L    EGQ N S +AS+S  +LD  SQT + LKERNYLGLSD SSVDSS  
Sbjct  5    IWNLMSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTV  64

Query  321  sgvVNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-  494
              + +EK + LNLKATELRLGLPGSQSP+RDL+L   ++ K DEKPLFPLLP+KDGI S 
Sbjct  65   PSLSDEKKENLNLKATELRLGLPGSQSPERDLDLFPLNSTKLDEKPLFPLLPTKDGICSL  124

Query  495  SVKASFTGNKRGFLDTM  545
            S K   +GNKRGF DT+
Sbjct  125  SQKTVVSGNKRGFADTL  141



>ref|XP_006466369.1| PREDICTED: auxin-responsive protein IAA9-like [Citrus sinensis]
 gb|KDO78726.1| hypothetical protein CISIN_1g017170mg [Citrus sinensis]
Length=376

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 6/137 (4%)
 Frame = +3

Query  165  MMSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYl-glsdsssvdssaasgvV  332
            M  P +LG   EGQ N S+MASS + DCISQ  S L+ERNYL     SS   S+A+S  V
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  509
            + K++LNLKATELRLGLPGS+SP+R+ +L+  S+GK DEKPLFPLLPSKDGI   S K  
Sbjct  60   DNKNKLNLKATELRLGLPGSESPEREPDLSLLSSGKLDEKPLFPLLPSKDGICPGSQKNV  119

Query  510  FTGNKRGFLDTMGRLCD  560
             +GNKRGF DTM R  +
Sbjct  120  VSGNKRGFSDTMDRFSE  136



>ref|XP_010105114.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC03899.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = +3

Query  168  MSPTILG-EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-K  341
            MSP +LG E +G+ S++ASS T+DCISQ GS LKE NYLGLSD SSVDSSA S +  E K
Sbjct  1    MSPPLLGGEEEGHSSLVASSPTIDCISQNGSGLKEWNYLGLSDCSSVDSSAVSSLSEENK  60

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT-G  518
            + LN KATELRLGLPGSQSP+R+ EL+   + K DEK LFPLLPSKDGI SS + +   G
Sbjct  61   NNLNFKATELRLGLPGSQSPEREPELSLLGSSKLDEKQLFPLLPSKDGICSSSQKNVVLG  120

Query  519  NKRGFLDTM  545
            NKRGF DTM
Sbjct  121  NKRGFSDTM  129



>ref|XP_007156440.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
 gb|ESW28434.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
Length=348

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 96/132 (73%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTIL---GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L    EGQ N S++AS+S+  ++C S   +  KERNYLG SD SSV+SS    + 
Sbjct  1    MSPPLLVTEDEGQSNASMVASASSPSMECFSPHEARFKERNYLGFSDCSSVESSTVPSLS  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKAS  509
            NEK  LNLKATELRLGLPGSQSP+R+ +L   ++ K DEKPLFPLLP+KDGIF+ S K  
Sbjct  61   NEKKNLNLKATELRLGLPGSQSPERNPDLFPLTSSKLDEKPLFPLLPTKDGIFALSQKTV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF DTM
Sbjct  121  VSGNKRGFADTM  132



>ref|XP_002509993.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
 gb|EEF52180.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
Length=374

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 97/131 (74%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP ++G   EGQ N +V+ASS++ + I Q GS LKERNY+GLSD SSVDSS A    +E
Sbjct  1    MSPPLIGVVEEGQSNVTVLASSTSAESICQNGSKLKERNYMGLSDCSSVDSSIAPSSSDE  60

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
             K RLNLKATELRLGLPGSQSP+R+ EL+  ++ +FDEKP FPL PS DG +SS  K   
Sbjct  61   SKTRLNLKATELRLGLPGSQSPQRNSELSLLNSTQFDEKPFFPLNPSNDGHYSSTQKNVV  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF D M
Sbjct  121  SGNKRGFSDAM  131



>gb|ACU19961.1| unknown [Glycine max]
Length=235

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 97/132 (73%), Gaps = 5/132 (4%)
 Frame = +3

Query  165  MMSPTILGEGQGNGSVMA-SSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV---  332
            M  PT++ E +G  +V + SS +LDC SQ G+ LKERNYLGLSD SSVDS A++      
Sbjct  1    MSPPTLVTEEEGRSTVASDSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLCD  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSS-VKAS  509
             +K+ +NLKATELRLGLPG QSP+R+ +L   S+ K DEKPLFPLLP+KDGI SS  KA 
Sbjct  61   EKKENMNLKATELRLGLPGFQSPEREPDLFSLSSPKLDEKPLFPLLPTKDGICSSGQKAV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF DTM
Sbjct  121  VSGNKRGFADTM  132



>gb|ACJ84551.1| unknown [Medicago truncatula]
Length=348

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L    EGQ N S +AS+S  +LD  SQT + LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  333  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            +EK + LNLKATELRLGLPGSQSP+RDL+L   ++ K DEKPLFPLLP+KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDLDLFPLNSTKLDEKPLFPLLPTKDGICSLSQKT  120

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF DT+
Sbjct  121  VVSGNKRGFADTL  133



>gb|AFK49626.1| unknown [Medicago truncatula]
Length=348

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L    EGQ N S +AS+S  +LD  SQT + LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  333  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            +EK + LNLKATELRLGLPGSQSP+RDL+L   ++ K DEKPLFPLLP+KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDLDLFPLNSTKLDEKPLFPLLPTKDGICSLSQKT  120

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF DT+
Sbjct  121  VVSGNKRGFADTL  133



>ref|XP_004509715.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Cicer 
arietinum]
Length=353

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 97/133 (73%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L    E Q N S +AS+S  +LDC SQ G+ LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  333  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            +EK + LNLKATELRLGLPGSQSP+RD +L   S+ K DEKPLFPLLP+KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDPDLFLLSSTKLDEKPLFPLLPTKDGICSLSQKN  120

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF D M
Sbjct  121  VVSGNKRGFSDAM  133



>ref|XP_003534264.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN38914.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=354

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 97/132 (73%), Gaps = 5/132 (4%)
 Frame = +3

Query  165  MMSPTILGEGQGNGSVMA-SSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV---  332
            M  PT++ E +G  +V + SS +LDC SQ G+ LKERNYLGLSD SSVDS A++      
Sbjct  1    MSPPTLVTEEEGRSTVASDSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLCD  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSS-VKAS  509
             +K+ +NLKATELRLGLPG QSP+R+ +L   S+ K DEKPLFPLLP+KDGI SS  KA 
Sbjct  61   EKKENMNLKATELRLGLPGFQSPEREPDLFSLSSPKLDEKPLFPLLPTKDGICSSGQKAV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF DTM
Sbjct  121  VSGNKRGFADTM  132



>ref|XP_010275504.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Nelumbo 
nucifera]
Length=410

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 103/144 (72%), Gaps = 3/144 (2%)
 Frame = +3

Query  123  VISRLRDELEFLYDMMSPTILGEGQGNGSVMASSSTLDCIS-QTGSALKERNYlglsdss  299
            + SRL  +L    ++MSP +LG G+G  +V   SS     S Q GS LKERNY+GLSD S
Sbjct  8    LYSRLGGKLLSSGNLMSPPLLGVGEGQSNVSVVSSPSVDGSCQNGSGLKERNYMGLSDCS  67

Query  300  svdssaasgvVNE-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPS  476
            SVDSSA SG+  E K  LNLKATELRLGLPGSQSP+RD EL   + GK DEKPLFPLLPS
Sbjct  68   SVDSSAISGLAEENKSSLNLKATELRLGLPGSQSPERDPELCLLNPGKLDEKPLFPLLPS  127

Query  477  KDGIFSSV-KASFTGNKRGFLDTM  545
            KDGI+SS  KA  TGNKRGF D M
Sbjct  128  KDGIYSSSQKAVVTGNKRGFSDAM  151



>ref|XP_010275505.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Nelumbo 
nucifera]
Length=409

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 97/131 (74%), Gaps = 3/131 (2%)
 Frame = +3

Query  162  DMMSPTILGEGQGNGSVMASSSTLDCIS-QTGSALKERNYlglsdsssvdssaasgvVNE  338
            ++MSP +LG G+G  +V   SS     S Q GS LKERNY+GLSD SSVDSSA SG+  E
Sbjct  20   NLMSPPLLGVGEGQSNVSVVSSPSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAEE  79

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
             K  LNLKATELRLGLPGSQSP+RD EL   + GK DEKPLFPLLPSKDGI+SS  KA  
Sbjct  80   NKSSLNLKATELRLGLPGSQSPERDPELCLLNPGKLDEKPLFPLLPSKDGIYSSSQKAVV  139

Query  513  TGNKRGFLDTM  545
            TGNKRGF D M
Sbjct  140  TGNKRGFSDAM  150



>ref|XP_007047690.1| Transcription factor, putative isoform 4 [Theobroma cacao]
 gb|EOX91847.1| Transcription factor, putative isoform 4 [Theobroma cacao]
Length=372

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 95/131 (73%), Gaps = 9/131 (7%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MS  +LG   EGQ N     SS + DCISQ G  LKERNYLGLSD SSVDSS  S +  +
Sbjct  1    MSQPLLGVEEEGQSN----VSSPSDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
             K+ LNLKATELRLGLPGSQSP+R+ EL   ++GK DEKPLFPLLPSKDGI SS  K   
Sbjct  57   NKNNLNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTVV  116

Query  513  TGNKRGFLDTM  545
            +GNKRGF DTM
Sbjct  117  SGNKRGFSDTM  127



>ref|XP_007047688.1| Transcription factor, putative isoform 2 [Theobroma cacao]
 gb|EOX91845.1| Transcription factor, putative isoform 2 [Theobroma cacao]
Length=374

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 95/131 (73%), Gaps = 9/131 (7%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MS  +LG   EGQ N     SS + DCISQ G  LKERNYLGLSD SSVDSS  S +  +
Sbjct  1    MSQPLLGVEEEGQSN----VSSPSDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
             K+ LNLKATELRLGLPGSQSP+R+ EL   ++GK DEKPLFPLLPSKDGI SS  K   
Sbjct  57   NKNNLNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTVV  116

Query  513  TGNKRGFLDTM  545
            +GNKRGF DTM
Sbjct  117  SGNKRGFSDTM  127



>ref|XP_007047687.1| Transcription factor, putative isoform 1 [Theobroma cacao]
 gb|EOX91844.1| Transcription factor, putative isoform 1 [Theobroma cacao]
Length=376

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 95/131 (73%), Gaps = 9/131 (7%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MS  +LG   EGQ N     SS + DCISQ G  LKERNYLGLSD SSVDSS  S +  +
Sbjct  1    MSQPLLGVEEEGQSN----VSSPSDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
             K+ LNLKATELRLGLPGSQSP+R+ EL   ++GK DEKPLFPLLPSKDGI SS  K   
Sbjct  57   NKNNLNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTVV  116

Query  513  TGNKRGFLDTM  545
            +GNKRGF DTM
Sbjct  117  SGNKRGFSDTM  127



>ref|XP_011099452.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=359

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 97/131 (74%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG   + Q N S+MASS+++D +SQ G  LKERNYLGLSD SSVDSS  S V  E
Sbjct  1    MSPPLLGVEGQDQCNVSLMASSASVDTVSQNGLGLKERNYLGLSDCSSVDSSGVSSVPEE  60

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASF  512
             K+ LNLKATELRLGLPGSQSP+RD + +  S+ K DEK LFPL+PSKDGI   S K   
Sbjct  61   NKNNLNLKATELRLGLPGSQSPERDPDFSPLSSVKLDEKQLFPLVPSKDGICLLSPKTVV  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF DT+
Sbjct  121  SGNKRGFADTV  131



>ref|XP_007158315.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 ref|XP_007158316.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|AGV54410.1| auxin-responsive protein IAA8 [Phaseolus vulgaris]
 gb|ESW30309.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|ESW30310.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
Length=350

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 94/136 (69%), Gaps = 9/136 (7%)
 Frame = +3

Query  165  MMSPTILGEGQGNGSVMA-----SSSTLDCISQTGSALKERNYlglsdsssvdssaasgv  329
            M  P ++ E  G   V +     SS +LDC SQ G+ LKERNYLGLSD SSVDS A++  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  330  ---VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SS  497
                 +K+ +NLKATELRLGLPGSQSP+RD +L   S+ K DEKPLFPL P+KDGIF SS
Sbjct  61   GLGDEKKENMNLKATELRLGLPGSQSPERDPDLFSLSSAKIDEKPLFPLGPTKDGIFLSS  120

Query  498  VKASFTGNKRGFLDTM  545
             K   +GNKRGF DTM
Sbjct  121  QKTVVSGNKRGFADTM  136



>ref|XP_010275506.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010275507.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
Length=388

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 95/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCIS-QTGSALKERNYlglsdsssvdssaasgvVNE-K  341
            MSP +LG G+G  +V   SS     S Q GS LKERNY+GLSD SSVDSSA SG+  E K
Sbjct  1    MSPPLLGVGEGQSNVSVVSSPSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAEENK  60

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  518
              LNLKATELRLGLPGSQSP+RD EL   + GK DEKPLFPLLPSKDGI+SS  KA  TG
Sbjct  61   SSLNLKATELRLGLPGSQSPERDPELCLLNPGKLDEKPLFPLLPSKDGIYSSSQKAVVTG  120

Query  519  NKRGFLDTM  545
            NKRGF D M
Sbjct  121  NKRGFSDAM  129



>ref|XP_008357957.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA9-like 
[Malus domestica]
Length=216

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 91/136 (67%), Gaps = 12/136 (9%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN-  335
            MSP + G   EG+ NGS       +DCIS  GS LKE NY GLSD SSV+SS  S +   
Sbjct  1    MSPPLXGGEEEGKSNGS-------MDCISHNGSGLKELNYHGLSDCSSVNSSXVSNLSEG  53

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
             K+ LN KA ELRLGLP SQSP+R+ +L   S+GK DEKPLFPLLPSKDGI SS  K   
Sbjct  54   NKNNLNFKAPELRLGLPASQSPERESDLCLLSSGKLDEKPLFPLLPSKDGIXSSSQKDGV  113

Query  513  TGNKRGFLDTMGRLCD  560
            +GNKRGF DTM R  +
Sbjct  114  SGNKRGFADTMDRFSE  129



>gb|EYU44549.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=306

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 88/131 (67%), Gaps = 15/131 (11%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV--  332
            MSP +LG     Q N S MASSS+ DC+SQ  S LKERNYLGLSD SSVDSS     V  
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
            + K  LNLKATELRLGLPGS SP R+ E     +   DEK LFPL+PSKDGIFSS     
Sbjct  61   DPKSNLNLKATELRLGLPGSHSPGRESEF----SPLIDEKQLFPLIPSKDGIFSS-----  111

Query  513  TGNKRGFLDTM  545
             GNKRGF DT+
Sbjct  112  -GNKRGFADTV  121



>gb|KHN46011.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTIL---GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L    EGQ + S++AS+S+  L+C S   +  KE NYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEDEGQCHASMVASASSPSLNCFSLNEAGFKECNYLGLSDCSSVDSSTVPNLS  60

Query  333  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            +EK + LNLKATELRLGLPGSQSP+R+ EL   S+ K DEKPLFPLLP+KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERETELFSLSSTKLDEKPLFPLLPTKDGICSLSQKT  120

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF DTM
Sbjct  121  VVSGNKRGFADTM  133



>gb|EYU44548.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=318

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 88/131 (67%), Gaps = 15/131 (11%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV--  332
            MSP +LG     Q N S MASSS+ DC+SQ  S LKERNYLGLSD SSVDSS     V  
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
            + K  LNLKATELRLGLPGS SP R+ E     +   DEK LFPL+PSKDGIFSS     
Sbjct  61   DPKSNLNLKATELRLGLPGSHSPGRESEF----SPLIDEKQLFPLIPSKDGIFSS-----  111

Query  513  TGNKRGFLDTM  545
             GNKRGF DT+
Sbjct  112  -GNKRGFADTV  121



>ref|XP_010547581.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Tarenaya 
hassleriana]
Length=342

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-N  335
            MSP +     E Q N SV +SS T +C+S+  S  KE NYLGLS+ SSV SS   G+  +
Sbjct  1    MSPPVADVEEELQSNVSVASSSPTSECLSRNTSGPKEHNYLGLSECSSVGSSNLPGLAED  60

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKASF  512
            +K+ ++LKATELRLGLPGSQSP+R+ + N  ++GK DEKPLFPL PSKDGI S S K S 
Sbjct  61   DKNSISLKATELRLGLPGSQSPERETDFNTLTSGKLDEKPLFPLAPSKDGICSQSQKNSG  120

Query  513  TGNKRGFLDTMGRLCD  560
            TGNKRGF DTM +  +
Sbjct  121  TGNKRGFSDTMDQFAE  136



>ref|XP_010547580.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Tarenaya 
hassleriana]
Length=350

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-N  335
            MSP +     E Q N SV +SS T +C+S+  S  KE NYLGLS+ SSV SS   G+  +
Sbjct  1    MSPPVADVEEELQSNVSVASSSPTSECLSRNTSGPKEHNYLGLSECSSVGSSNLPGLAED  60

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKASF  512
            +K+ ++LKATELRLGLPGSQSP+R+ + N  ++GK DEKPLFPL PSKDGI S S K S 
Sbjct  61   DKNSISLKATELRLGLPGSQSPERETDFNTLTSGKLDEKPLFPLAPSKDGICSQSQKNSG  120

Query  513  TGNKRGFLDTMGRLCD  560
            TGNKRGF DTM +  +
Sbjct  121  TGNKRGFSDTMDQFAE  136



>ref|XP_004288310.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
 ref|XP_011466548.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 92/131 (70%), Gaps = 10/131 (8%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG   EG+ NGS++A S +++ I Q  S LKERNYLGLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGGEGEGKSNGSMVACSPSMEMIPQNSSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
             K + N KATELRLGLPGSQSP+R  EL        DEKPLFPLLPSKDGI SS  K   
Sbjct  61   NKSKFNFKATELRLGLPGSQSPERQSEL-----CLLDEKPLFPLLPSKDGICSSSQKNVV  115

Query  513  TGNKRGFLDTM  545
            +GNKRGF DTM
Sbjct  116  SGNKRGFSDTM  126



>ref|XP_003517136.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Glycine 
max]
 ref|XP_006572983.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Glycine 
max]
Length=359

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 97/137 (71%), Gaps = 10/137 (7%)
 Frame = +3

Query  165  MMSP-TILGEGQGNGSVMA-----SSSTLDCISQTGSALKERNYlglsdsssvdssaasg  326
            MMSP  ++ E +G  +V +     SS +LD  SQ G+ LKERNYLGLSD SSVDSSA++ 
Sbjct  1    MMSPPAVVTEEEGRSNVSSTVASGSSQSLDRFSQNGAGLKERNYLGLSDCSSVDSSASTV  60

Query  327  vV---NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FS  494
                  +K+ +NLKATELRLGLPGSQSP+R+ +L   S  K DEKPLFPLLP+KDGI  S
Sbjct  61   PSLCDEKKENMNLKATELRLGLPGSQSPEREPDLFSLSPAKLDEKPLFPLLPTKDGICLS  120

Query  495  SVKASFTGNKRGFLDTM  545
            + K   +GNKRGF DTM
Sbjct  121  AQKTVVSGNKRGFADTM  137



>emb|CAN77436.1| hypothetical protein VITISV_007399 [Vitis vinifera]
Length=359

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 93/132 (70%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  336  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  509
              K  LNLKATELRLGLPGS SP R+ EL   S+ K DEKPLFPL PSKD  + SS K  
Sbjct  61   GNKSSLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFADAM  132



>ref|NP_001275473.1| Aux/IAA protein [Solanum tuberosum]
 gb|AAM29182.1| Aux/IAA protein [Solanum tuberosum]
Length=349

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 92/133 (69%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++ASS++L  I + GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  336  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            + +   LNLKATELRLGLPGSQSP+R  E    S+ K DEK LFPL P+KD  FS S K 
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPAKDTAFSVSQKT  120

Query  507  SFTGNKRGFLDTM  545
              TGNKRGF DTM
Sbjct  121  VVTGNKRGFSDTM  133



>ref|NP_001268170.1| Aux/IAA protein [Vitis vinifera]
 gb|AEV89794.1| indole-3-acetic acid-induced protein 4 [Vitis vinifera]
Length=359

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 93/132 (70%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  336  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  509
              K  LNLKATELRLGLPGS SP R+ EL   S+ K DEKPLFPL PSKD  + SS K  
Sbjct  61   GNKSSLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFADAM  132



>ref|XP_010664066.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664068.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664069.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 gb|ADR80320.1| indole-3-acetic acid-induced protein 9 [Vitis vinifera]
Length=359

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 93/132 (70%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  336  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  509
              K  LNLKATELRLGLPGS SP R+ EL   S+ K DEKPLFPL PSKD  + SS K  
Sbjct  61   GNKSSLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFADAM  132



>gb|AAM12952.1| auxin-regulated protein [Zinnia violacea]
Length=351

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 98/131 (75%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN-  335
            M P +LG   +G GN S+M S+ST++ I Q  + L ERNYLGLSD SS DS+A SG+   
Sbjct  1    MPPPLLGVEGDGLGNVSLMTSASTMESIFQKNAELTERNYLGLSDCSSFDSTAVSGISEV  60

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF-  512
            +++ LNLKATELRLGLPGSQSP+RD++++  ++   DEKPLFPLLPSKDGI S+ +  F 
Sbjct  61   KRNNLNLKATELRLGLPGSQSPERDVDVDLVNSESLDEKPLFPLLPSKDGICSNSQKVFV  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF D +
Sbjct  121  SGNKRGFSDAI  131



>gb|KHN22187.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 8/134 (6%)
 Frame = +3

Query  168  MSPTIL----GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgv  329
            MSP +L     EGQ N S++AS+S+   +C +   + LKERNYLGLSD SSVDSS    +
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  330  VNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVK  503
             +EK + LNLKATELRLGLPGSQSP+RD +L   S+ K DEKPLF LLP+KDGI S S K
Sbjct  61   SDEKKENLNLKATELRLGLPGSQSPERDPDLFSLSSTKLDEKPLFSLLPTKDGICSLSQK  120

Query  504  ASFTGNKRGFLDTM  545
               +GNKRGF DT+
Sbjct  121  TVVSGNKRGFADTI  134



>ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Glycine 
max]
 ref|XP_006585901.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Glycine 
max]
Length=350

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 8/134 (6%)
 Frame = +3

Query  168  MSPTIL----GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgv  329
            MSP +L     EGQ N S++AS+S+   +C +   + LKERNYLGLSD SSVDSS    +
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  330  VNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVK  503
             +EK + LNLKATELRLGLPGSQSP+RD +L   S+ K DEKPLF LLP+KDGI S S K
Sbjct  61   SDEKKENLNLKATELRLGLPGSQSPERDPDLFSLSSTKLDEKPLFSLLPTKDGICSLSQK  120

Query  504  ASFTGNKRGFLDTM  545
               +GNKRGF DT+
Sbjct  121  TVVSGNKRGFADTI  134



>ref|XP_006585902.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Glycine 
max]
Length=348

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 8/134 (6%)
 Frame = +3

Query  168  MSPTIL----GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgv  329
            MSP +L     EGQ N S++AS+S+   +C +   + LKERNYLGLSD SSVDSS    +
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  330  VNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVK  503
             +EK + LNLKATELRLGLPGSQSP+RD +L   S+ K DEKPLF LLP+KDGI S S K
Sbjct  61   SDEKKENLNLKATELRLGLPGSQSPERDPDLFSLSSTKLDEKPLFSLLPTKDGICSLSQK  120

Query  504  ASFTGNKRGFLDTM  545
               +GNKRGF DT+
Sbjct  121  TVVSGNKRGFADTI  134



>gb|ABB55368.1| Aux/IAA protein-like [Solanum tuberosum]
Length=349

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 91/133 (68%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++ASS++L  I + GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  336  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            + +   LNLKATELRLGLPGSQSP+R  E    S+ K DEK LFPL P+KD  FS S K 
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPAKDTAFSVSQKT  120

Query  507  SFTGNKRGFLDTM  545
              TGNKRGF D M
Sbjct  121  VVTGNKRGFSDAM  133



>gb|KJB58782.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58783.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=334

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG    GQ N +++ SS ++D + Q  + LKERNY+GLSD SS+D S  +   ++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  339  KD-RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASF  512
             +  LNLKATELRLGLPGSQSP+R+ EL   S+ + DEKPLFPL PS DG  F S K   
Sbjct  61   SNVSLNLKATELRLGLPGSQSPERNSELCLLSSAQLDEKPLFPLHPSSDGHCFPSQKTVV  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF D M
Sbjct  121  SGNKRGFSDAM  131



>gb|KJB71171.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=289

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  347
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS-FTGNK  524
            LNLKATELRLGLPGSQSP+R+ EL   ++GK DEK LFPLLPSKDGI SS + S  TGNK
Sbjct  58   LNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNK  117

Query  525  RGFLDTMGRL  554
            RGF +  G +
Sbjct  118  RGFSEVKGTI  127



>gb|AAL92850.1| Aux/IAA protein [Vitis vinifera]
Length=359

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 92/132 (70%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  336  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  509
              K  LNLKATELRLGLPG  SP R+ EL   S+ K DEKPLFPL PSKD  + SS K  
Sbjct  61   GNKSSLNLKATELRLGLPGFLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFADAM  132



>gb|KJB58781.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=368

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG    GQ N +++ SS ++D + Q  + LKERNY+GLSD SS+D S  +   ++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  339  KD-RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASF  512
             +  LNLKATELRLGLPGSQSP+R+ EL   S+ + DEKPLFPL PS DG  F S K   
Sbjct  61   SNVSLNLKATELRLGLPGSQSPERNSELCLLSSAQLDEKPLFPLHPSSDGHCFPSQKTVV  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF D M
Sbjct  121  SGNKRGFSDAM  131



>gb|KCW59655.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=345

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 95/131 (73%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  338
            MSP +LG  EG GN S +A+S ++D  S     LKERNYLGLSD SSVDSSA S + +E 
Sbjct  1    MSPPLLGVEEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDEN  60

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  512
            K  LNLKATEL LGLPGSQSP+R+ +L   S+GK DEKPLFPLLP KDGI SS   K   
Sbjct  61   KSNLNLKATELTLGLPGSQSPEREPKLCLLSSGKLDEKPLFPLLPLKDGICSSSLQKNIA  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF DT+
Sbjct  121  SGNKRGFSDTI  131



>gb|KJB58777.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58778.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58779.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58780.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=367

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG    GQ N +++ SS ++D + Q  + LKERNY+GLSD SS+D S  +   ++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  339  KD-RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASF  512
             +  LNLKATELRLGLPGSQSP+R+ EL   S+ + DEKPLFPL PS DG  F S K   
Sbjct  61   SNVSLNLKATELRLGLPGSQSPERNSELCLLSSAQLDEKPLFPLHPSSDGHCFPSQKTVV  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF D M
Sbjct  121  SGNKRGFSDAM  131



>gb|KJB71172.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=344

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  347
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS-FTGNK  524
            LNLKATELRLGLPGSQSP+R+ EL   ++GK DEK LFPLLPSKDGI SS + S  TGNK
Sbjct  58   LNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNK  117

Query  525  RGFLDTMGRL  554
            RGF +  G +
Sbjct  118  RGFSEVKGTI  127



>gb|KJB71166.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71167.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71168.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71169.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=351

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  347
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS-FTGNK  524
            LNLKATELRLGLPGSQSP+R+ EL   ++GK DEK LFPLLPSKDGI SS + S  TGNK
Sbjct  58   LNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNK  117

Query  525  RGFLDTMGRL  554
            RGF +  G +
Sbjct  118  RGFSEVKGTI  127



>ref|XP_010023411.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023412.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
Length=377

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 95/131 (73%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  338
            MSP +LG  EG GN S +A+S ++D  S     LKERNYLGLSD SSVDSSA S + +E 
Sbjct  1    MSPPLLGVEEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDEN  60

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  512
            K  LNLKATEL LGLPGSQSP+R+ +L   S+GK DEKPLFPLLP KDGI SS   K   
Sbjct  61   KSNLNLKATELTLGLPGSQSPEREPKLCLLSSGKLDEKPLFPLLPLKDGICSSSLQKNIA  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF DT+
Sbjct  121  SGNKRGFSDTI  131



>gb|KJB71165.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71170.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=352

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  347
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS-FTGNK  524
            LNLKATELRLGLPGSQSP+R+ EL   ++GK DEK LFPLLPSKDGI SS + S  TGNK
Sbjct  58   LNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNK  117

Query  525  RGFLDTMGRL  554
            RGF +  G +
Sbjct  118  RGFSEVKGTI  127



>ref|XP_010023413.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Eucalyptus 
grandis]
 gb|KCW59654.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=368

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 95/131 (73%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  338
            MSP +LG  EG GN S +A+S ++D  S     LKERNYLGLSD SSVDSSA S + +E 
Sbjct  1    MSPPLLGVEEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDEN  60

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  512
            K  LNLKATEL LGLPGSQSP+R+ +L   S+GK DEKPLFPLLP KDGI SS   K   
Sbjct  61   KSNLNLKATELTLGLPGSQSPEREPKLCLLSSGKLDEKPLFPLLPLKDGICSSSLQKNIA  120

Query  513  TGNKRGFLDTM  545
            +GNKRGF DT+
Sbjct  121  SGNKRGFSDTI  131



>gb|KHG08881.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=351

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 92/131 (70%), Gaps = 6/131 (5%)
 Frame = +3

Query  168  MSPTILG-EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKD  344
            MSP +LG E +G   V  SS +++CISQ G  ++ERNYLGLSD  SVDSS      +  +
Sbjct  1    MSPPLLGVEEEGQSRV--SSPSVECISQNGLGIRERNYLGLSDFCSVDSSGVPD--DNGN  56

Query  345  RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS-FTGN  521
             LNLKATELRLGLPGSQSP+R+ E    ++GK DEK LFPLLPSKDGI SS + S  TGN
Sbjct  57   NLNLKATELRLGLPGSQSPERETEHCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGN  116

Query  522  KRGFLDTMGRL  554
            KRGF +  G +
Sbjct  117  KRGFSEVKGTI  127



>gb|KJB18143.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=255

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 88/127 (69%), Gaps = 8/127 (6%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  347
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS           
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDSSGV------SSN  53

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  524
            LNLKATELRLGLPGSQSP+R+ EL   + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  113

Query  525  RGFLDTM  545
            RGF DTM
Sbjct  114  RGFSDTM  120



>ref|XP_003519213.1| PREDICTED: auxin-responsive protein IAA9-like [Glycine max]
 gb|KHN26175.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=366

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSS-TLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MS  +LG    EGQ N +++ SSS T++ +    S LKERNY+GLSD SSVDSSA S   
Sbjct  1    MSKPLLGIAEEEGQSNVTLLVSSSATMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
              K  LNLKATELRLGLPGSQSP+RD +L   S+ +FDEKPLFPL P+ D   SS K + 
Sbjct  61   ETKSNLNLKATELRLGLPGSQSPERDSDLCLRSSIQFDEKPLFPLHPATDEHHSSSKPAV  120

Query  513  TGNKRGFLDTM  545
             GNKRGF D M
Sbjct  121  LGNKRGFSDVM  131



>gb|AAB70005.1| GH1 protein [Glycine max]
Length=339

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 85/113 (75%), Gaps = 4/113 (4%)
 Frame = +3

Query  219  SSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV---NEKDRLNLKATELRLGLPG  389
            SS +LD  SQ G+ LKERNYLGLSD SSVDSSA++       +K+ +NLKATELRLGLPG
Sbjct  5    SSQSLDRFSQNGAGLKERNYLGLSDCSSVDSSASTVPSLCDEKKENMNLKATELRLGLPG  64

Query  390  SQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLDTM  545
            SQSP+R+ +L   S  K DEKPLFPLLP+KDGI  S+ K   +GNKRGF DTM
Sbjct  65   SQSPEREPDLFSLSPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNKRGFADTM  117



>gb|KJB18142.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=296

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 87/127 (69%), Gaps = 8/127 (6%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  347
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDS            
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDS------SGVSSN  53

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  524
            LNLKATELRLGLPGSQSP+R+ EL   + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  113

Query  525  RGFLDTM  545
            RGF DTM
Sbjct  114  RGFSDTM  120



>gb|KJB18140.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=403

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 88/127 (69%), Gaps = 8/127 (6%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  347
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS           
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDSS------GVSSN  53

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  524
            LNLKATELRLGLPGSQSP+R+ EL   + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  113

Query  525  RGFLDTM  545
            RGF DTM
Sbjct  114  RGFSDTM  120



>ref|XP_010320058.1| PREDICTED: auxin-responsive protein (Aux/IAA) isoform X1 [Solanum 
lycopersicum]
Length=349

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 90/133 (68%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++ASS++L  I   GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  336  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            + +   LNLKATELRLGLPGSQSP+R  E    S+ K DEK LFPL PSKD  FS S K 
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPSKDTAFSVSQKT  120

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF D M
Sbjct  121  VVSGNKRGFSDAM  133



>gb|KJB18136.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18137.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18138.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18139.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18141.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18144.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=377

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 87/127 (69%), Gaps = 8/127 (6%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  347
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDS            
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDS------SGVSSN  53

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  524
            LNLKATELRLGLPGSQSP+R+ EL   + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  113

Query  525  RGFLDTM  545
            RGF DTM
Sbjct  114  RGFSDTM  120



>ref|XP_007018336.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 ref|XP_007018337.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15561.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15562.1| Aux/IAA protein isoform 1 [Theobroma cacao]
Length=368

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 90/132 (68%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILGE----GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG     GQ N + + SS ++D + Q  + LKERNY+GLSD SSVDSS  S V  
Sbjct  1    MSPPLLGVEEEGGQSNVTCLGSSGSMDSVCQNSAELKERNYMGLSDCSSVDSSVGSPVSE  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKAS  509
            E K  LNLKATELRLGLPGSQSPKR+ EL   S+ + DEKPLFPL PS DG  S S K  
Sbjct  61   ESKGNLNLKATELRLGLPGSQSPKRNPELCLLSSPQLDEKPLFPLHPSSDGHCSASQKTV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>ref|XP_002862301.1| hypothetical protein ARALYDRAFT_920936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38559.1| hypothetical protein ARALYDRAFT_920936 [Arabidopsis lyrata subsp. 
lyrata]
Length=238

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  362
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSLLAEDDKATISLKA  65

Query  363  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  539
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  66   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  125

Query  540  TMGRLCD  560
            TM +  +
Sbjct  126  TMDQFAE  132



>gb|ACU23129.1| unknown [Glycine max]
Length=210

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTL-DCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MS  +LG    EGQ N +++ SSS + + +    S LKERNY+GLSD SSVDSSA S   
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
              K  LNLKATELRLGLPG QSP+RD +L   S+ +FDEKPLFPL P+ D   SS K + 
Sbjct  61   ETKSNLNLKATELRLGLPGLQSPERDSDLCLRSSIQFDEKPLFPLHPATDDHHSSSKPAV  120

Query  513  TGNKRGFLDTM  545
             GNKRGF D M
Sbjct  121  LGNKRGFSDVM  131



>ref|XP_011073641.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=346

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = +3

Query  213  MASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEK-DRLNLKATELRLGLPG  389
            MASS++ D ++Q G  LKERNYLGLSD SSVDSSA S V  EK   LNLKATELRLGLPG
Sbjct  1    MASSASADRVAQNGLGLKERNYLGLSDCSSVDSSAVSSVPEEKKSNLNLKATELRLGLPG  60

Query  390  SQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTM  545
            SQSP+R+ +    S  K DEK LFPL+PSKDGI  S K   +GNKRGF DT+
Sbjct  61   SQSPERESDFTLLSPSKLDEKQLFPLIPSKDGILLSQKTVVSGNKRGFSDTV  112



>ref|NP_001265888.1| auxin-responsive protein (Aux/IAA) [Solanum lycopersicum]
 gb|AAZ20313.1| AUX/IAA protein [Solanum lycopersicum]
 gb|ADN51993.1| entire [Solanum lycopersicum]
 gb|AEX00353.1| IAA9 [Solanum lycopersicum]
Length=349

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 89/133 (67%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++ASS++L  I   GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  336  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            + +   LNLKATELRLGLPGSQSP+R  E     + K DEK LFPL PSKD  FS S K 
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVISTKVDEKLLFPLHPSKDTAFSVSQKT  120

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF D M
Sbjct  121  VVSGNKRGFSDAM  133



>ref|NP_001280795.1| auxin-responsive protein IAA8-like [Malus domestica]
 gb|ADL36582.1| ARF domain class transcription factor [Malus domestica]
Length=363

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 94/137 (69%), Gaps = 7/137 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ + +++ASS +++ + Q    LKERNY+GLSD SSVDSS  S V +
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  336  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  509
              +  L+LKATELRLGLPGSQSP+RD E    ST + DEKPLFPL P KDG +SS+ K  
Sbjct  61   GSRSSLHLKATELRLGLPGSQSPERDSEARVIST-QLDEKPLFPLHPLKDGHYSSLQKTV  119

Query  510  FTGNKRGFLDTMGRLCD  560
             +GNKRGF D M    +
Sbjct  120  VSGNKRGFSDAMDEFSE  136



>gb|KCW68554.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
 gb|KCW68555.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=321

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILGEGQ----GNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +L  G+     N +++AS S+L  + Q    LKERNY+G+ D  S D S      +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQNAE-LKERNYMGMGDHPSADGSVIPNAFD  59

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
              K  LNL+ATELRLGLPGSQSP+RD +    S+ K DEKP FPL PS DG +SS K   
Sbjct  60   GCKITLNLRATELRLGLPGSQSPERDADFCTISSAKLDEKPFFPLHPSNDGHYSSQKIVV  119

Query  513  TGNKRGFLDTMG  548
            +GNKRGF D MG
Sbjct  120  SGNKRGFADAMG  131



>gb|KCW68553.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=330

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 84/132 (64%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILGEGQ----GNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +L  G+     N +++AS S+L  + Q  + LKERNY+G+ D  S D S      +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQN-AELKERNYMGMGDHPSADGSVIPNAFD  59

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
              K  LNL+ATELRLGLPGSQSP+RD +    S+ K DEKP FPL PS DG +SS K   
Sbjct  60   GCKITLNLRATELRLGLPGSQSPERDADFCTISSAKLDEKPFFPLHPSNDGHYSSQKIVV  119

Query  513  TGNKRGFLDTMG  548
            +GNKRGF D MG
Sbjct  120  SGNKRGFADAMG  131



>gb|ADL70577.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=292

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 91/134 (68%), Gaps = 5/134 (4%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  341
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  518
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM +  +
Sbjct  119  NKRGFSDTMDQFAE  132



>gb|KDP41528.1| hypothetical protein JCGZ_15935 [Jatropha curcas]
Length=368

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 91/132 (69%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MS  +LG    EGQ N +++ASS++ +   QTGS L+ERNY+GLSD SSVDSS      +
Sbjct  1    MSSPLLGAVEEEGQSNVTLLASSTSAESTCQTGSELRERNYMGLSDCSSVDSSVIPAACD  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  509
            + K RL LKATELRLGLPGSQSP+R+ EL   S+ + DEKP FPL PS +   SSV K  
Sbjct  61   QNKTRLILKATELRLGLPGSQSPERNSELCLLSSAQLDEKPFFPLHPSNERHCSSVQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>gb|ADL70578.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70582.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=303

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 91/134 (68%), Gaps = 5/134 (4%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  341
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  518
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM +  +
Sbjct  119  NKRGFSDTMDQFAE  132



>gb|ADC29394.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADC29397.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=300

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  362
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  3    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  62

Query  363  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  539
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  63   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  122

Query  540  TMGRLCD  560
            TM +  +
Sbjct  123  TMDQFAE  129



>ref|XP_010061570.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 ref|XP_010061571.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 gb|KCW68552.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=359

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 84/132 (64%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILGEGQ----GNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +L  G+     N +++AS S+L  + Q  + LKERNY+G+ D  S D S      +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQN-AELKERNYMGMGDHPSADGSVIPNAFD  59

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
              K  LNL+ATELRLGLPGSQSP+RD +    S+ K DEKP FPL PS DG +SS K   
Sbjct  60   GCKITLNLRATELRLGLPGSQSPERDADFCTISSAKLDEKPFFPLHPSNDGHYSSQKIVV  119

Query  513  TGNKRGFLDTMG  548
            +GNKRGF D MG
Sbjct  120  SGNKRGFADAMG  131



>gb|ADC29395.2| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADC29396.2| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70575.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70576.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70580.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70581.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=303

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 91/134 (68%), Gaps = 5/134 (4%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  341
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  518
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM +  +
Sbjct  119  NKRGFSDTMDQFAE  132



>gb|ADL70586.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  362
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  5    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  64

Query  363  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  539
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  65   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  124

Query  540  TMGRLCD  560
            TM +  +
Sbjct  125  TMDQFAE  131



>gb|ADL70583.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70584.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  362
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  5    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  64

Query  363  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  539
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  65   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  124

Query  540  TMGRLCD  560
            TM +  +
Sbjct  125  TMDQFAE  131



>gb|ADC29398.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=300

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  362
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  3    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  62

Query  363  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  539
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  63   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  122

Query  540  TMGRLCD  560
            TM +  +
Sbjct  123  TMDQFAE  129



>ref|NP_851275.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 sp|Q38827.1|IAA9_ARATH RecName: Full=Auxin-responsive protein IAA9; AltName: Full=Indoleacetic 
acid-induced protein 9 [Arabidopsis thaliana]
 gb|AAG50093.1|AF334715_1 auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AAC49050.1| IAA9 [Arabidopsis thaliana]
 emb|CAA16692.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AED98084.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=338

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 91/134 (68%), Gaps = 5/134 (4%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  341
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  518
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM +  +
Sbjct  119  NKRGFSDTMDQFAE  132



>ref|XP_002864969.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41228.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  362
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSLLAEDDKATISLKA  65

Query  363  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  539
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  66   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  125

Query  540  TMGRLCD  560
            TM +  +
Sbjct  126  TMDQFAE  132



>dbj|BAB10673.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=333

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 91/134 (68%), Gaps = 5/134 (4%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  341
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  518
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM +  +
Sbjct  119  NKRGFSDTMDQFAE  132



>ref|XP_002528895.1| transcription factor, putative [Ricinus communis]
 gb|EEF33475.1| transcription factor, putative [Ricinus communis]
Length=382

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 94/133 (71%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaa-sgvVN  335
            MSP +LG    GQ   S++ASS ++DCISQ G  LKERNYLGLSD SSVDSSA  S    
Sbjct  1    MSPPLLGVEDGGQSKVSLVASSPSVDCISQNGCRLKERNYLGLSDCSSVDSSAVPSLSEE  60

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKD--GIFS-SVKA  506
              + LNLKATELRLGLPGS SP+RD E++   +GK DEKPLFPLLP KD  GI S   K 
Sbjct  61   NNNNLNLKATELRLGLPGSLSPERDTEVSLLISGKLDEKPLFPLLPLKDGHGICSLPQKH  120

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF DTM
Sbjct  121  VVSGNKRGFSDTM  133



>ref|NP_569017.2| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 gb|AED98085.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=336

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 91/134 (68%), Gaps = 5/134 (4%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  341
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  518
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM +  +
Sbjct  119  NKRGFSDTMDQFAE  132



>gb|ADL70579.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  362
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  5    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  64

Query  363  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  539
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  65   TELTLGLPGSQSPVRDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  124

Query  540  TMGRLCD  560
            TM +  +
Sbjct  125  TMDQFAE  131



>ref|XP_008378626.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
 ref|XP_008378627.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
Length=363

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 93/137 (68%), Gaps = 7/137 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ + +++ASS +++ + Q    LKERNY+GLSD SSVDSS  S V +
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  336  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  509
                 L+LKATELRLGLPGSQSP+RD E    ST + DEKPLFPL P KDG +SS+ K  
Sbjct  61   GSXSSLHLKATELRLGLPGSQSPERDSEARVIST-QLDEKPLFPLHPLKDGHYSSLQKTV  119

Query  510  FTGNKRGFLDTMGRLCD  560
             +GNKRGF D M    +
Sbjct  120  VSGNKRGFSDAMDEFSE  136



>gb|AAM64650.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=338

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 91/134 (68%), Gaps = 5/134 (4%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  341
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQTNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  518
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM +  +
Sbjct  119  NKRGFSDTMDQFAE  132



>ref|XP_008219180.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
 ref|XP_008219181.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
Length=366

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = +3

Query  168  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SSVDSS  S V 
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  333  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  506
               K  LNLKAT+LRLGLPGSQSP+RD EL   ST + DEKPLFPL P KDG +SS+ K 
Sbjct  61   GGSKSSLNLKATDLRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPIKDGNYSSLQKT  119

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF D M
Sbjct  120  VVSGNKRGFSDAM  132



>ref|XP_003544843.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN39979.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=367

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTL-DCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MS  +LG    EGQ N +++ SSS + + +    S LKERNY+GLSD SSVDSSA S   
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
              K  LNLKATELRLGLPG QSP+RD +L   S+ +FDEKPLFPL P+ D   SS K + 
Sbjct  61   ETKSNLNLKATELRLGLPGLQSPERDSDLCLRSSIQFDEKPLFPLHPATDDHHSSSKPAV  120

Query  513  TGNKRGFLDTM  545
             GNKRGF D M
Sbjct  121  LGNKRGFSDVM  131



>gb|KHG13564.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=357

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 91/132 (69%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  509
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKPLFPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>ref|XP_007225723.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26922.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=293

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = +3

Query  168  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SSVDSS  S V 
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  333  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  506
               K+ LNLKAT+LRLGLPGSQSP+RD EL   ST + DEKPLFPL P  DG +SS+ K 
Sbjct  61   GGSKNSLNLKATDLRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPIMDGNYSSLQKT  119

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF D M
Sbjct  120  VVSGNKRGFSDAM  132



>gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum]
Length=357

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 91/132 (69%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  509
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKPLFPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>gb|EYU41350.1| hypothetical protein MIMGU_mgv1a009380mg [Erythranthe guttata]
Length=344

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 89/129 (69%), Gaps = 9/129 (7%)
 Frame = +3

Query  180  ILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE--KDRLN  353
            + G+ Q N S+MASS++ DCI+Q GS+LKERNYLGLSD SSVDSSA S   +   K  LN
Sbjct  8    VEGQSQCNVSLMASSASADCITQNGSSLKERNYLGLSDCSSVDSSAVSCGADTEIKSNLN  67

Query  354  LKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGF  533
            LKATEL LGLPGSQSP    EL+   T   DEK LFPL+PSKD    + K+  +GNKRGF
Sbjct  68   LKATELTLGLPGSQSPHHQ-ELS--FTALLDEKQLFPLIPSKD----AQKSVVSGNKRGF  120

Query  534  LDTMGRLCD  560
             DT+    D
Sbjct  121  ADTVDGFSD  129



>ref|XP_007225724.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225725.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225726.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26923.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26924.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26925.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=366

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = +3

Query  168  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SSVDSS  S V 
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  333  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  506
               K+ LNLKAT+LRLGLPGSQSP+RD EL   ST + DEKPLFPL P  DG +SS+ K 
Sbjct  61   GGSKNSLNLKATDLRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPIMDGNYSSLQKT  119

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF D M
Sbjct  120  VVSGNKRGFSDAM  132



>ref|XP_007225727.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26926.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=397

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = +3

Query  168  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SSVDSS  S V 
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  333  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  506
               K+ LNLKAT+LRLGLPGSQSP+RD EL   ST + DEKPLFPL P  DG +SS+ K 
Sbjct  61   GGSKNSLNLKATDLRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPIMDGNYSSLQKT  119

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF D M
Sbjct  120  VVSGNKRGFSDAM  132



>ref|XP_008440498.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
 ref|XP_008440499.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=377

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 87/131 (66%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +L    E  GN  V+A+S ++DC SQ G+  +ERNYL LS  SSVDSSA S +  E
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASF  512
             K  LNLKATELRLGLPGS SP+RD E    S+G+ DEK L  LLPS DG   +S K   
Sbjct  61   NKSNLNLKATELRLGLPGSLSPERDQEFTLISSGEPDEKTLLQLLPSTDGYSVASQKNII  120

Query  513  TGNKRGFLDTM  545
             G+KRGF DTM
Sbjct  121  AGSKRGFSDTM  131



>gb|KJB64034.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64035.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=303

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 90/132 (68%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  509
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKP FPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>ref|XP_010254653.1| PREDICTED: auxin-responsive protein IAA9-like [Nelumbo nucifera]
Length=386

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +3

Query  168  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  338
            MSP +L   E   N +++ SS ++D   Q  S L+ERNY+GLSD SSVDSSA SG+  E 
Sbjct  1    MSPPLLNVVERPSNVTLVPSSPSVDSSCQNVSGLRERNYMGLSDCSSVDSSAISGLSEEN  60

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFT  515
            K  LNLKATELRLGLPGSQSP+R  EL   S GK DEKPLFPLLPSKDGI SS  KA  +
Sbjct  61   KSSLNLKATELRLGLPGSQSPERGSELCLLSPGKLDEKPLFPLLPSKDGICSSSQKAVVS  120

Query  516  GNKRGFLDTM  545
            GNKRGF D M
Sbjct  121  GNKRGFSDAM  130



>gb|KJB64033.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=330

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 90/132 (68%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  509
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKP FPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>ref|XP_006279648.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
 gb|EOA12546.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
Length=339

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 86/128 (67%), Gaps = 4/128 (3%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvVNEKDR--LNLK  359
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SS   S+    + + D+  ++LK
Sbjct  6    ELQSNVSVASSSPTSNCISRSTVGGLKEHNYLGLSDCSSSVGSSTLSGLADDDKATISLK  65

Query  360  ATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFL  536
            ATEL LGLPGSQSP RD +LN  +  K DEKP FPLLPSKD I SS  K + +GNKRGF 
Sbjct  66   ATELTLGLPGSQSPARDTDLNLMTPVKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFS  125

Query  537  DTMGRLCD  560
            DTM +  +
Sbjct  126  DTMDQFAE  133



>gb|KJB64027.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64028.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64029.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64030.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64031.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64032.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=357

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 90/132 (68%), Gaps = 6/132 (5%)
 Frame = +3

Query  168  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  509
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKP FPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>gb|ABD98054.1| auxin-regulated protein [Striga asiatica]
Length=305

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 84/124 (68%), Gaps = 10/124 (8%)
 Frame = +3

Query  180  ILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNL  356
            I G+ Q N  +MASSS+ DCI+Q    LKERNYLGLSD SSVDSS  S   +E K  LNL
Sbjct  8    IEGQNQFNAHLMASSSSADCITQNTLGLKERNYLGLSDCSSVDSSTVSSSPDEGKTNLNL  67

Query  357  KATELRLGLPGSQSPKRDLELN-GPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGF  533
            KATELRLGLPGSQSPKRDL+ +   S  K DEK LFPL+P+            +GNKRGF
Sbjct  68   KATELRLGLPGSQSPKRDLDFSLLSSVNKLDEKQLFPLVPN--------TVIVSGNKRGF  119

Query  534  LDTM  545
             DT+
Sbjct  120  SDTV  123



>emb|CAC84706.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=365

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 91/136 (67%), Gaps = 5/136 (4%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++AS ++ +     G  LKERNY+GLSD SSVDSSA S   +
Sbjct  1    MSPPLLGVVEEEGQSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
            E K  LNLKATELRLGLPGSQSP+R+ EL+  S+   DEKP FPL PS DG +S+ K   
Sbjct  61   ERKASLNLKATELRLGLPGSQSPERNHELSLLSSALLDEKPFFPLHPSNDGHYSTQKNVV  120

Query  513  TGNKRGFLDTMGRLCD  560
            +GNKR F D M    +
Sbjct  121  SGNKRVFSDAMDEFSE  136



>gb|AGV54485.1| auxin-responsive protein [Phaseolus vulgaris]
Length=352

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 89/137 (65%), Gaps = 10/137 (7%)
 Frame = +3

Query  165  MMSPTILGEGQGNGSVMA-----SSSTLDCISQTGSALKERNYlglsdsssvdssaasgv  329
            M  P ++ E  G   V +     SS +LDC SQ G+ LKERNYLGLSD SSVDS A++  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  330  ---VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV  500
                 +K+ +NLKATELRLGLPGSQSP+RD +L   S+ K DEKPLFPL P+KDGIF S 
Sbjct  61   GLGDEKKENMNLKATELRLGLPGSQSPERDPDLFSLSSAKIDEKPLFPLGPTKDGIFLSS  120

Query  501  K--ASFTGNKRGFLDTM  545
            +    F   ++   DTM
Sbjct  121  RKNCCFRQTRKVLPDTM  137



>ref|NP_001241389.1| uncharacterized protein LOC100783314 [Glycine max]
 ref|XP_006577803.1| PREDICTED: uncharacterized protein LOC100783314 isoform X1 [Glycine 
max]
 gb|ACU23462.1| unknown [Glycine max]
Length=360

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 85/134 (63%), Gaps = 5/134 (4%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSST-LDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L     EG+ N +++ SSST ++ +       KERNY+G SD SSVDSS  S   
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
              K  LNLKATELRLGLPGSQSP+RD +L   S+ + DEKPLFPL P  D   SS K + 
Sbjct  61   ECKSNLNLKATELRLGLPGSQSPERDSDLCLRSSTQLDEKPLFPLHPLTDDHHSSAKTAV  120

Query  513  TGNKRGFLDTMGRL  554
             GNKRGF D M  L
Sbjct  121  LGNKRGFSDAMNGL  134



>gb|KHN09036.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=361

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTIL--GEGQGNGSV---MASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L  GE +G  +V   ++SS+T++ +       KERNY+GLSD SSVDSS  S   
Sbjct  1    MSPPVLSIGEEEGKSNVTLLVSSSTTMESVCLKSLEFKERNYMGLSDCSSVDSSVPSFSE  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
              K  LNLKATELRLGLPGSQSP RD +L   S+ +FDEK LFPL P  D   SS K + 
Sbjct  61   ETKSNLNLKATELRLGLPGSQSPDRDSDLCLRSSTQFDEKTLFPLRPLTDDHHSSAKTAV  120

Query  513  TGNKRGFLDTM  545
             GNKRGF D M
Sbjct  121  LGNKRGFSDAM  131



>gb|KHG08155.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
 gb|KHG17373.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=376

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 85/127 (67%), Gaps = 9/127 (7%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  347
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDS            
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGMGLKERNYLGLSDCSSVDS------SGVSSN  53

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  524
            LNL ATELRLGLPGSQSP+R+ E    + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNL-ATELRLGLPGSQSPERETEFCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  112

Query  525  RGFLDTM  545
            RGF DTM
Sbjct  113  RGFSDTM  119



>gb|KHN08222.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=360

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 85/134 (63%), Gaps = 5/134 (4%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSST-LDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L     EG+ N +++ SSST ++ +       KERNY+G SD SSVDSS  S   
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
              K  LNLKATELRLGLPGSQSP+RD +L   S+ + DEKPLFPL P  D   SS K + 
Sbjct  61   ECKSNLNLKATELRLGLPGSQSPERDSDLCLRSSTQLDEKPLFPLHPLTDDHHSSAKIAV  120

Query  513  TGNKRGFLDTMGRL  554
             GNKRGF D M  L
Sbjct  121  LGNKRGFSDAMNGL  134



>gb|AFZ78618.1| hypothetical protein [Populus tomentosa]
Length=365

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EG  N +++AS ++ +     G  LKERNY+GLSD SSVDSSA S   +
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  512
            E K  LNLKATELRLGLPGSQSP+R+ EL+  S+   DEKP FPL PS DG +S+ K   
Sbjct  61   ERKTSLNLKATELRLGLPGSQSPERNHELSLLSSALLDEKPFFPLHPSNDGHYSTQKNVV  120

Query  513  TGNKRGFLDTMGRLCD  560
            +GNKR F D M    +
Sbjct  121  SGNKRVFSDAMDEFSE  136



>ref|XP_008339000.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Malus 
domestica]
Length=363

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 87/137 (64%), Gaps = 7/137 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ + + ++SS +++ + Q  S LKE+NY+GLSD SSV SS  S   +
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  336  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  509
                 LNLKATELRLGLPGSQSP RD       T + DEKPLFPL P KDG +SS  K  
Sbjct  61   GSNSSLNLKATELRLGLPGSQSPXRDSXXRVIXT-QLDEKPLFPLHPLKDGHYSSXQKXV  119

Query  510  FTGNKRGFLDTMGRLCD  560
             +GNKRGF D M    +
Sbjct  120  VSGNKRGFSDAMDEFSE  136



>ref|XP_008338995.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338996.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338997.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338999.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
Length=366

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 87/137 (64%), Gaps = 7/137 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ + + ++SS +++ + Q  S LKE+NY+GLSD SSV SS  S   +
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  336  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  509
                 LNLKATELRLGLPGSQSP RD       T + DEKPLFPL P KDG +SS  K  
Sbjct  61   GSNSSLNLKATELRLGLPGSQSPXRDSXXRVIXT-QLDEKPLFPLHPLKDGHYSSXQKXV  119

Query  510  FTGNKRGFLDTMGRLCD  560
             +GNKRGF D M    +
Sbjct  120  VSGNKRGFSDAMDEFSE  136



>ref|XP_007047689.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOX91846.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
Length=345

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +3

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  509
            + K+ LNLKATELRLGLPGSQSP+R+ EL   ++GK DEKPLFPLLPSKDGI SS  K  
Sbjct  25   DNKNNLNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTV  84

Query  510  FTGNKRGFLDTM  545
             +GNKRGF DTM
Sbjct  85   VSGNKRGFSDTM  96



>ref|XP_009366395.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
 ref|XP_009366396.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
Length=363

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 90/137 (66%), Gaps = 7/137 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ + + ++SS +++ + Q    LKE+NY+GLSD SSV SS  S   +
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSLELKEQNYMGLSDCSSVGSSKVSTASD  60

Query  336  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  509
              K  LNLKATELRLGLPGSQSP+RD +L   +T + DEK LFPL P KDG +SS  K  
Sbjct  61   GSKSSLNLKATELRLGLPGSQSPERDSDLRVITT-QLDEKSLFPLHPLKDGHYSSSQKIV  119

Query  510  FTGNKRGFLDTMGRLCD  560
             +GNKRGF D M    +
Sbjct  120  VSGNKRGFSDAMDEFSE  136



>ref|NP_001267710.1| auxin-responsive protein IAA9-like [Cucumis sativus]
 dbj|BAA85821.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN62776.1| hypothetical protein Csa_2G372720 [Cucumis sativus]
Length=355

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 90/139 (65%), Gaps = 7/139 (5%)
 Frame = +3

Query  168  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L      E + N +++ASS++++ +S      +ERNY+GLSDSSS DS   +   
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLEFEERNYMGLSDSSSEDSCMTATKS  60

Query  333  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSS-VKA  506
            +  K  LNLKATELRLGLPGS+SP+RD +    S+ + DEKPLFPL PS DG++SS  K 
Sbjct  61   DGNKPSLNLKATELRLGLPGSESPERDPDNCLRSSSQLDEKPLFPLHPSSDGLYSSPQKT  120

Query  507  SFTGNKRGFLDTMGRLCDH  563
              +GNKRGF D M    + 
Sbjct  121  VVSGNKRGFSDAMNEFSEE  139



>ref|XP_007137671.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 ref|XP_007137672.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09665.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09666.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
Length=366

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 85/130 (65%), Gaps = 4/130 (3%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSST-LDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG   EG+ N +++ SSST ++ +      LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGIGEEGKSNVTLLVSSSTTMESVCLKTLELKERNYMGLSDCSSVDSSVPSVSEE  60

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  515
             K  LNLKATEL LGLPGSQS +RD +L   S+ +FDEK LFPL P  D   SS K +  
Sbjct  61   TKSNLNLKATELTLGLPGSQSSERDSDLCLRSSTQFDEKALFPLCPLADDHHSSTKTAVL  120

Query  516  GNKRGFLDTM  545
            GNKRGF D M
Sbjct  121  GNKRGFSDAM  130



>gb|KDO81312.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=210

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = +3

Query  165  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  329
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  330  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>gb|AFK38170.1| unknown [Lotus japonicus]
Length=347

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 90/134 (67%), Gaps = 7/134 (5%)
 Frame = +3

Query  165  MMSPTILGEGQGNGSVMASSSTLDCISQTGS-ALKERNYlglsdsssvdssaasgvV---  332
            M  P ++ E +G   + ++++     SQ     LKERNYLGLSD SSVDS A++      
Sbjct  1    MTPPAVVTEEEGRCKLTSTTTVATASSQVDCFELKERNYLGLSDCSSVDSCASTVPSLCD  60

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTG--KFDEKPLFPLLPSKDGIFS-SVK  503
             +K  LNLKATELRLGLPGSQSP+RD EL   S+   K DEKPLFPLLP+KDGI S S K
Sbjct  61   EKKGNLNLKATELRLGLPGSQSPERDPELFSLSSAATKLDEKPLFPLLPTKDGISSTSQK  120

Query  504  ASFTGNKRGFLDTM  545
            A  +GNKRGF DTM
Sbjct  121  AVVSGNKRGFADTM  134



>ref|XP_004512542.1| PREDICTED: auxin-responsive protein IAA8-like [Cicer arietinum]
Length=348

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 12/132 (9%)
 Frame = +3

Query  168  MSPTIL---GEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV--  332
            MSP ++    EG+   S    S++    SQ G+ LKERNYLGLSD SSVDS  ++     
Sbjct  1    MSPAVVVTEEEGRNKLSSTVVSASSQSFSQIGADLKERNYLGLSDCSSVDSCDSTVPSLC  60

Query  333  -NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
              +K+ LNLKATELRLGLPGSQSP+RD +     + K DEKPLFPL+P+KDGI  +V   
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDSDF---YSTKLDEKPLFPLVPTKDGIQKNV---  114

Query  510  FTGNKRGFLDTM  545
             +GNKRGF DT+
Sbjct  115  VSGNKRGFADTV  126



>ref|XP_008444965.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=355

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 89/139 (64%), Gaps = 7/139 (5%)
 Frame = +3

Query  168  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L      E + N +++ASS++++ +S      +ERNY+GLSDSSS DS   +   
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLGFEERNYMGLSDSSSEDSCMTATKS  60

Query  333  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSS-VKA  506
            +  K  LNLKATELRLGLPGS+SP+RD +    S+ + DEKPLFPL PS DG +SS  K 
Sbjct  61   DGNKPSLNLKATELRLGLPGSESPERDPDNCLRSSSQLDEKPLFPLHPSSDGHYSSPQKT  120

Query  507  SFTGNKRGFLDTMGRLCDH  563
              +GNKRGF D M    + 
Sbjct  121  VVSGNKRGFSDAMNEFSEE  139



>gb|KDO81311.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=288

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = +3

Query  165  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  329
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  330  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>gb|KDO81310.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=333

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = +3

Query  165  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  329
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  330  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>ref|XP_006394000.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31286.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=337

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ--TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLK  359
            E Q N SV +SS T +CIS+   G  LKE NYLGLSD SSV SS  SG+  ++K  ++LK
Sbjct  6    ELQSNVSVASSSPTSNCISRNTAGGGLKEHNYLGLSDCSSVGSSTLSGLAEDDKATISLK  65

Query  360  ATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT-GNKRGFL  536
            ATEL LGLPG QSP RD +LN  S  K DEK  FPLLPSKD I SS + +   GNKRGF 
Sbjct  66   ATELTLGLPGPQSPARDTDLNLLSPAKLDEKTFFPLLPSKDEICSSSQKNIALGNKRGFS  125

Query  537  DTMGRLCD  560
            D M +  +
Sbjct  126  DAMDQFSE  133



>ref|XP_002302351.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ABK95187.1| unknown [Populus trichocarpa]
 gb|EEE81624.1| auxin-responsive family protein [Populus trichocarpa]
Length=366

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 90/137 (66%), Gaps = 6/137 (4%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EG  N +++AS ++ +     G  LKERNY+GLSD SSVDSSA S   +
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  509
            E K  LNLKATELRLGLPGSQSP+R+ EL+  S+   DEKP FPL PS DG +SS  K  
Sbjct  61   ERKTSLNLKATELRLGLPGSQSPERNHELSLLSSALLDEKPFFPLHPSNDGHYSSTQKNV  120

Query  510  FTGNKRGFLDTMGRLCD  560
             +GNKR F D M    +
Sbjct  121  VSGNKRVFSDAMDEFSE  137



>ref|XP_006394001.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 ref|XP_006394002.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 dbj|BAJ33783.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31287.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31288.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=339

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ--TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLK  359
            E Q N SV +SS T +CIS+   G  LKE NYLGLSD SSV SS  SG+  ++K  ++LK
Sbjct  6    ELQSNVSVASSSPTSNCISRNTAGGGLKEHNYLGLSDCSSVGSSTLSGLAEDDKATISLK  65

Query  360  ATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT-GNKRGFL  536
            ATEL LGLPG QSP RD +LN  S  K DEK  FPLLPSKD I SS + +   GNKRGF 
Sbjct  66   ATELTLGLPGPQSPARDTDLNLLSPAKLDEKTFFPLLPSKDEICSSSQKNIALGNKRGFS  125

Query  537  DTMGRLCD  560
            D M +  +
Sbjct  126  DAMDQFSE  133



>gb|KDO81302.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81303.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81304.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81305.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81306.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81307.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81308.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81309.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=365

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = +3

Query  165  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  329
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  330  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>ref|XP_011016963.1| PREDICTED: auxin-responsive protein IAA9-like [Populus euphratica]
Length=366

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 89/137 (65%), Gaps = 6/137 (4%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N ++++S  + +     G  LKERNY+GLSD SSVDSSA S   N
Sbjct  1    MSPPLLGVVEEEGQSNVTLLSSPVSAESACLNGLELKERNYMGLSDCSSVDSSAVSAASN  60

Query  336  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  509
            E K  LNLKATELRLGLPGSQSP+R  EL+  S+   DEKP FPL PS DG ++S  K  
Sbjct  61   ERKTSLNLKATELRLGLPGSQSPERHHELSLLSSALLDEKPFFPLHPSIDGHYTSTQKNV  120

Query  510  FTGNKRGFLDTMGRLCD  560
             +GNKR F D M    +
Sbjct  121  VSGNKRVFSDAMDEFSE  137



>ref|XP_004143431.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 ref|XP_004160925.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 gb|KGN48671.1| ARF domain class transcription factor [Cucumis sativus]
Length=380

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 87/131 (66%), Gaps = 5/131 (4%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +L    E  GN  V+A+S ++DC SQ G+  +ERNYL LS  SSVDSSA S +  E
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  339  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF-  512
             K  LNLKATELRLGLPGS SP+RD E    S+ + DEK L  LLPS DG   S++ +  
Sbjct  61   NKSNLNLKATELRLGLPGSLSPERDQEFTLISSVEPDEKTLLQLLPSTDGYSVSLQKNIV  120

Query  513  TGNKRGFLDTM  545
            +G+KR F DTM
Sbjct  121  SGSKRVFSDTM  131



>gb|ADL70574.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70585.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=286

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = +3

Query  228  TLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKATELRLGLPGSQSP  401
            T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKATEL LGLPGSQSP
Sbjct  2    TSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKATELTLGLPGSQSP  61

Query  402  KRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTMGRLCD  560
             RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF DTM +  +
Sbjct  62   ARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAE  115



>ref|XP_010518881.1| PREDICTED: auxin-responsive protein IAA9-like [Tarenaya hassleriana]
Length=312

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 81/129 (63%), Gaps = 21/129 (16%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP I     E Q N SV +SS   +C+S+  S LKE NYLGLSD SS     +    ++
Sbjct  1    MSPPIAEVEEELQSNVSVASSSPISECLSRNTSGLKEHNYLGLSDCSSTLPDLSE---DD  57

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  518
            K  ++LKATELRLGLPGSQSP+RD +LN        EKP FPL+PSKDGI S       G
Sbjct  58   KSGISLKATELRLGLPGSQSPERDTDLN--------EKPFFPLVPSKDGICS-------G  102

Query  519  NKRGFLDTM  545
            NKRGF DT+
Sbjct  103  NKRGFSDTV  111



>ref|XP_006433732.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433733.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433734.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433735.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433737.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433738.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433739.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433740.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46972.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46973.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46974.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46975.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46977.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46978.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46979.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46980.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=365

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = +3

Query  165  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  329
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPGVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  330  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>ref|XP_004299829.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=356

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 86/130 (66%), Gaps = 7/130 (5%)
 Frame = +3

Query  165  MMSPTI-LGEGQGNGSVMASSSTL--DCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            M  P +  GE +G+  V A SS+L  D +    S LKERNY+GLSD SSVDSS  S V  
Sbjct  1    MSQPQVGAGEEEGSSDVTALSSSLSMDSVCPNSSDLKERNYMGLSDCSSVDSSKGSDVDG  60

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  515
             K RLNL ATELRLGLPGSQSP+R+ EL   ST + DEKPLFPL P KD +  ++    +
Sbjct  61   SKSRLNLMATELRLGLPGSQSPERNSELRLIST-QPDEKPLFPLHPVKDSLQKTI---VS  116

Query  516  GNKRGFLDTM  545
            GNKRGF D M
Sbjct  117  GNKRGFSDAM  126



>ref|XP_006433736.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46976.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=383

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = +3

Query  165  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  329
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPGVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  330  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>emb|CAJ13716.1| auxin induced protein [Capsicum chinense]
Length=210

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 87/133 (65%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +LG    EGQ N +++ SSS+L  I Q G ALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLGSSSSLGSICQKGLALKERNYMGLSDCSSVDSCNISTSSE  60

Query  336  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            + +   LNLKATELRLGLPGSQSP+R        + K DEK LFPL P+KD  FS S K 
Sbjct  61   DNNGVGLNLKATELRLGLPGSQSPERGTAPCPLGSTKVDEKLLFPLHPAKDTAFSVSQKT  120

Query  507  SFTGNKRGFLDTM  545
              TGNKRGF D M
Sbjct  121  VVTGNKRGFSDAM  133



>ref|XP_010484401.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
 ref|XP_010484402.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
Length=343

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 80/133 (60%), Gaps = 10/133 (8%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQ---TGSALKERNY---lglsdsssvdssaasgvVNEKDRL  350
            E Q N SV +SS T +CIS+    G  LKE NY      S S    + +     ++K  +
Sbjct  6    ELQSNVSVASSSPTSNCISRGTTLGGGLKEHNYLGLSDCSSSVGSSTLSTGLTEDDKASI  65

Query  351  NLKATELRLGLPGSQSPKRDLELN--GPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGN  521
            +LKATEL LGLPGS+SP RD +LN   P   K DEKP FPLLPSKD I SS  K + +GN
Sbjct  66   SLKATELTLGLPGSRSPARDTDLNLMTPPV-KLDEKPFFPLLPSKDEICSSSQKINASGN  124

Query  522  KRGFLDTMGRLCD  560
            KRGF DTM +  +
Sbjct  125  KRGFSDTMDQFAE  137



>gb|KHN04889.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=289

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +3

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASFTGNK  524
            +NLKATELRLGLPGSQSP+R+ +L   S  K DEKPLFPLLP+KDGI  S+ K   +GNK
Sbjct  1    MNLKATELRLGLPGSQSPEREPDLFSLSPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNK  60

Query  525  RGFLDTM  545
            RGF DTM
Sbjct  61   RGFADTM  67



>emb|CDY68170.1| BnaCnng57860D [Brassica napus]
Length=311

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 82/121 (68%), Gaps = 11/121 (9%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKAT  365
            E Q N SV +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S  V ++K  ++LKAT
Sbjct  6    ELQSNVSVASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSRNVEDDKATISLKAT  64

Query  366  ELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF-TGNKRGFLDT  542
            EL LGLPGSQSP R+ EL        DEKP FPLLP+KD IFSS   +   GNKRGF DT
Sbjct  65   ELTLGLPGSQSPARETEL--------DEKPFFPLLPTKDEIFSSSHKNIGPGNKRGFSDT  116

Query  543  M  545
            M
Sbjct  117  M  117



>ref|XP_006472387.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472388.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472389.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472390.1| PREDICTED: auxin-responsive protein IAA9-like isoform X4 [Citrus 
sinensis]
Length=365

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = +3

Query  165  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  329
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  330  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
             + K  LNLKATELRLGLPGSQSP+R  EL      +  EKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLGEKPLFPLHPTNDSHYPSQKNV  120

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  121  VSGNKRGFSDAM  132



>ref|XP_010104556.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC01157.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 87/134 (65%), Gaps = 17/134 (13%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP + G    EGQ N +V+ SS +++      S LKERNY+GLSD SS D S  S   +
Sbjct  1    MSPPLHGVGEDEGQSNVTVLTSSPSME------SELKERNYMGLSDCSSGDCSVVSPASD  54

Query  336  EKDR-LNLKATELRLGLPGSQSPKRDLELNGP--STGKFDEKPLFPLLPSKDGIFS-SVK  503
            E  R LNLKATELRLGLPGSQSP+RD    GP  S+ + DEK LFPL PS D  ++ S+K
Sbjct  55   ESKRTLNLKATELRLGLPGSQSPERD---PGPRQSSAQLDEKKLFPLHPSNDVHYNHSLK  111

Query  504  ASFTGNKRGFLDTM  545
               +GNKRGF D M
Sbjct  112  TVVSGNKRGFSDAM  125



>emb|CDP00957.1| unnamed protein product [Coffea canephora]
Length=366

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 92/133 (69%), Gaps = 7/133 (5%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MS  +LG    EGQ N S++ SSS+LD   Q GS  KERNY+GLS+ SSVDSS  S +  
Sbjct  1    MSTPLLGVGEEEGQSNVSLLTSSSSLDSSRQNGSVFKERNYMGLSECSSVDSSTISNISG  60

Query  336  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
              +   LNLKATELRLGLPGSQSP+RD EL   S+ K DEKPLFPL P KDG  S+++ +
Sbjct  61   GSNGSCLNLKATELRLGLPGSQSPERDSELCLVSSTKLDEKPLFPLHPLKDGNCSNLQRT  120

Query  510  FT-GNKRGFLDTM  545
             T GNKRGF D M
Sbjct  121  ITSGNKRGFSDAM  133



>ref|XP_010463449.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Camelina 
sativa]
Length=339

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 82/136 (60%), Gaps = 8/136 (6%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNY---lglsdsssvdssaasgvVN  335
            MSP    E Q N SV +SS T +CIS+ T  ALKE NY      S S    + +A    +
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRGTTVALKEHNYLGLSDCSSSVGSSTLSAGLTED  58

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  512
            +K  ++LKATEL LGLPGSQ+   DL L   S  K DEKP FPLLPSKD I SS  K + 
Sbjct  59   DKASISLKATELTLGLPGSQARDTDLNLMKNSV-KLDEKPFFPLLPSKDEICSSSQKNNA  117

Query  513  TGNKRGFLDTMGRLCD  560
            +GNKRGF DTM +  +
Sbjct  118  SGNKRGFSDTMDQFAE  133



>ref|XP_010683059.1| PREDICTED: auxin-responsive protein IAA9 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 87/136 (64%), Gaps = 12/136 (9%)
 Frame = +3

Query  168  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  338
            MSP +LG    GQ N   +  S T  C     S LKE NY GLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGLEGGGQSNDHSLVPSPT--CAE---SGLKELNYFGLSDCSSVDSSNVSSLSEE  55

Query  339  -KDRLNL--KATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  506
             KD LNL  KATELRLGLPGSQSP+RD +L   S  K DEKPLFPL P KDGI SS  KA
Sbjct  56   NKDSLNLNFKATELRLGLPGSQSPERDSDLCLLSASKLDEKPLFPLTPLKDGISSSSQKA  115

Query  507  SFTGNKRGFLDTMGRL  554
            + +G+KRGF DT  + 
Sbjct  116  AVSGSKRGFSDTEAKW  131



>ref|XP_009608764.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana tomentosiformis]
Length=346

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 87/133 (65%), Gaps = 10/133 (8%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +L     EGQ N +++ASS++L  I + GS LKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  336  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            + +   LNLKATELRLGLPGS SP+R +E    ++   +EK LFPL P+KD   + S K 
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIETCPLAS---NEKLLFPLHPAKDSALAVSQKT  117

Query  507  SFTGNKRGFLDTM  545
              TGNKRGF D M
Sbjct  118  VVTGNKRGFSDAM  130



>ref|XP_009150656.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=330

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 86/132 (65%), Gaps = 11/132 (8%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KD  344
            MSP    E Q NGSV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K 
Sbjct  1    MSPE--EELQSNGSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKA  52

Query  345  RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASFTG  518
             ++LKATEL LGLPGSQSP RD ELN     K DEKP FPLLPSKD + SS   K   +G
Sbjct  53   TISLKATELTLGLPGSQSPARDTELNLLGPAKLDEKPFFPLLPSKDEMCSSSSHKNIASG  112

Query  519  NKRGFLDTMGRL  554
            NKRGF DTM ++
Sbjct  113  NKRGFSDTMDKV  124



>ref|XP_009150655.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=332

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 86/132 (65%), Gaps = 11/132 (8%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KD  344
            MSP    E Q NGSV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K 
Sbjct  1    MSPE--EELQSNGSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKA  52

Query  345  RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASFTG  518
             ++LKATEL LGLPGSQSP RD ELN     K DEKP FPLLPSKD + SS   K   +G
Sbjct  53   TISLKATELTLGLPGSQSPARDTELNLLGPAKLDEKPFFPLLPSKDEMCSSSSHKNIASG  112

Query  519  NKRGFLDTMGRL  554
            NKRGF DTM ++
Sbjct  113  NKRGFSDTMDKV  124



>emb|CDY08767.1| BnaA06g24570D [Brassica napus]
Length=332

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 86/132 (65%), Gaps = 11/132 (8%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KD  344
            MSP    E Q NGSV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K 
Sbjct  1    MSPE--EELQSNGSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKA  52

Query  345  RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASFTG  518
             ++LKATEL LGLPGSQSP RD ELN     K DEKP FPLLPSKD + SS   K   +G
Sbjct  53   TISLKATELTLGLPGSQSPARDTELNLLGPAKLDEKPFFPLLPSKDEMCSSSSHKNIASG  112

Query  519  NKRGFLDTMGRL  554
            NKRGF DTM ++
Sbjct  113  NKRGFSDTMDKV  124



>ref|XP_009789143.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana sylvestris]
Length=346

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 87/133 (65%), Gaps = 10/133 (8%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +L     EGQ N +++ASS++L  I + GS LKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSG  60

Query  336  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKA  506
            + +   LNLKATELRLGLPGS SP+R +E    ++   +EK LFPL P+KD  +  S K 
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIETCPLAS---NEKLLFPLHPAKDSDLVVSQKT  117

Query  507  SFTGNKRGFLDTM  545
              TGNKRGF D M
Sbjct  118  VVTGNKRGFSDAM  130



>gb|AID60626.1| auxin-responsive protein IAA8 [Dimocarpus longan]
Length=257

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 89/134 (66%), Gaps = 12/134 (9%)
 Frame = +3

Query  168  MSPTILG----EGQ-GNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +LG    EG   N +++ASSS+LD I Q    LKERNY+GLSD SSVDSS  S + 
Sbjct  1    MSPPLLGVEEEEGHPSNVTLLASSSSLDSICQNNPELKERNYMGLSDCSSVDSSVISNLS  60

Query  333  NE---KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVK  503
            NE   K  LNLKATELRLGLPGSQSP+RD  L   S+ + DEKPLFPL P+ DG +   K
Sbjct  61   NETKSKSSLNLKATELRLGLPGSQSPERDPNLCLLSSAQLDEKPLFPLHPTNDGHYPLQK  120

Query  504  ASFTGNKRGFLDTM  545
                 NKRGF D M
Sbjct  121  ----NNKRGFSDAM  130



>dbj|BAP94244.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94245.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94246.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94247.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94248.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94249.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94250.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94251.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94252.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94253.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94254.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94255.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94256.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94257.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94258.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94259.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94260.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94261.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94263.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94264.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94265.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94266.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94268.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94269.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94270.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94271.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94272.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94273.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94275.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94292.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94293.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94294.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94295.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94296.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94297.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94298.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94299.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94300.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94301.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94303.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94304.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94305.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94306.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94311.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94313.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 52/74 (70%), Gaps = 4/74 (5%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  518
            K  LNLKATELRLGLPGSQSP+RD EL   ST + DEKPLFPL P KD +  +V    +G
Sbjct  9    KSSLNLKATELRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPLKDSLQKTV---VSG  64

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM    +
Sbjct  65   NKRGFSDTMDEFSE  78



>emb|CAD10639.1| IAA9 protein [Nicotiana tabacum]
Length=346

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 86/133 (65%), Gaps = 10/133 (8%)
 Frame = +3

Query  168  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  335
            MSP +L     EGQ N +++ASS++L  I + GS LKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  336  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            + +   LNLKATELRLGLPGS SP+R +E    ++   +EK LFPL P+KD   + S K 
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIETCPLAS---NEKLLFPLHPAKDSALAVSQKT  117

Query  507  SFTGNKRGFLDTM  545
              TGNKR F D M
Sbjct  118  VVTGNKRRFSDAM  130



>emb|CDY45607.1| BnaCnng13150D [Brassica napus]
Length=329

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KD  344
            MSP    E Q N SV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K 
Sbjct  1    MSPE--EELQSNVSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKA  52

Query  345  RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFTGN  521
             ++LKATEL LGLPGSQSP RD ELN     K DEK  FPLLPSKD I  SS K   +GN
Sbjct  53   TISLKATELTLGLPGSQSPARDTELNSLGPAKLDEKLFFPLLPSKDEICPSSQKNIASGN  112

Query  522  KRGFLDTMGRL  554
            KRGF DTM ++
Sbjct  113  KRGFADTMDKV  123



>dbj|BAP94262.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94267.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94274.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94283.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94302.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94307.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94308.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94309.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94310.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94312.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94314.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94315.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 51/74 (69%), Gaps = 4/74 (5%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  518
            K  LNLKATELRLGLPGSQSP RD EL   ST + DEKPLFPL P KD +  +V    +G
Sbjct  9    KSSLNLKATELRLGLPGSQSPXRDSELRLIST-QLDEKPLFPLHPLKDSLQKTV---VSG  64

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM    +
Sbjct  65   NKRGFSDTMDEFSE  78



>ref|XP_011464769.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 73/105 (70%), Gaps = 4/105 (4%)
 Frame = +3

Query  231  LDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRD  410
            +D +    S LKERNY+GLSD SSVDSS  S V   K RLNL ATELRLGLPGSQSP+R+
Sbjct  1    MDSVCPNSSDLKERNYMGLSDCSSVDSSKGSDVDGSKSRLNLMATELRLGLPGSQSPERN  60

Query  411  LELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTM  545
             EL   ST + DEKPLFPL P KD +  ++    +GNKRGF D M
Sbjct  61   SELRLIST-QPDEKPLFPLHPVKDSLQKTI---VSGNKRGFSDAM  101



>dbj|BAP94276.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94277.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94278.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94279.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94280.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94281.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94282.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94284.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94285.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94286.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94287.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94288.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94289.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94290.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94291.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94316.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94317.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94318.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94319.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94320.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94321.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94322.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94323.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 51/74 (69%), Gaps = 4/74 (5%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  518
            K  LNLKATELRLGLPGSQSP RD EL   ST + DEKPLFPL P KD +  +V    +G
Sbjct  9    KSSLNLKATELRLGLPGSQSPDRDSELRLIST-QLDEKPLFPLHPLKDSLQKTV---VSG  64

Query  519  NKRGFLDTMGRLCD  560
            NKRGF DTM    +
Sbjct  65   NKRGFSDTMDEFSE  78



>gb|AFK49555.1| unknown [Medicago truncatula]
Length=99

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 4/70 (6%)
 Frame = +3

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  515
            +K  LNLKATELRLGLPGSQSP+R+++ +   T K DEKPLFPLLP+KDG+  +V    +
Sbjct  28   KKVNLNLKATELRLGLPGSQSPEREMDSDFYLT-KLDEKPLFPLLPAKDGLQKNV---VS  83

Query  516  GNKRGFLDTM  545
            GNKRGF DT+
Sbjct  84   GNKRGFADTV  93



>emb|CDY18679.1| BnaA09g07160D [Brassica napus]
Length=312

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 77/119 (65%), Gaps = 13/119 (11%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATE  368
            E Q N S+ +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S   ++K  ++LKATE
Sbjct  6    ELQSNVSLASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSCGEDDKGTISLKATE  64

Query  369  LRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTM  545
            L LGLPGSQSP RD         K DEKP FPLLPSKD I SS       NKRGF DT+
Sbjct  65   LTLGLPGSQSPARDT--------KLDEKPFFPLLPSKDEICSSSHK----NKRGFSDTI  111



>gb|AFK43616.1| unknown [Lotus japonicus]
Length=180

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  518
            K  LNLKATELRLGLPGSQSP+RD  L    + +FDEKPLFPL P  D   SS K +  G
Sbjct  66   KSNLNLKATELRLGLPGSQSPERDSNLCLRGSAQFDEKPLFPLHPVTDDHHSSSKPAVLG  125

Query  519  NKRGFLDTM  545
            +KRGF D M
Sbjct  126  SKRGFSDAM  134



>ref|NP_001237053.1| uncharacterized protein LOC100500373 [Glycine max]
 gb|ACU15430.1| unknown [Glycine max]
Length=193

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 85/133 (64%), Gaps = 20/133 (15%)
 Frame = +3

Query  168  MSPTIL---GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L    EGQ + S++AS+S+  L+C S   +  KE NYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEDEGQCHASMVASASSPSLNCFSLNEAGFKECNYLGLSDCSSVDSSTVPNLS  60

Query  333  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  506
            +EK + LNLKATELRLGLPGSQSP+R+ E             LF L  +KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERETE-------------LFSLSSTKDGICSLSQKT  107

Query  507  SFTGNKRGFLDTM  545
              +GNKRGF DTM
Sbjct  108  VVSGNKRGFADTM  120



>gb|AFK38538.1| unknown [Lotus japonicus]
Length=318

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  518
            K  LNLKATELRLGLPGSQSP+RD  L    + +FDEKPLFPL P  D   SS K +  G
Sbjct  33   KSNLNLKATELRLGLPGSQSPERDSNLCLRGSAQFDEKPLFPLHPVTDDHHSSSKPAVLG  92

Query  519  NKRGFLDTM  545
            +KRGF D M
Sbjct  93   SKRGFSDAM  101



>emb|CBI19314.3| unnamed protein product [Vitis vinifera]
Length=318

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFT  515
            K  LNLKATELRLGLPGS SP R+ EL   S+ K DEKPLFPL PSKD  + SS K   +
Sbjct  22   KSSLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTVVS  81

Query  516  GNKRGFLDTM  545
            GNKRGF D M
Sbjct  82   GNKRGFADAM  91



>ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AES95891.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=335

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 4/70 (6%)
 Frame = +3

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  515
            +K  LNLKATELRLGLPGSQSP+R+++ +   T K DEKPLFPLLP+KDG+  +V    +
Sbjct  47   KKVNLNLKATELRLGLPGSQSPEREMDSDFYLT-KLDEKPLFPLLPAKDGLQKNV---VS  102

Query  516  GNKRGFLDTM  545
            GNKRGF DT+
Sbjct  103  GNKRGFADTV  112



>gb|ABY48132.1| GH1 protein [Medicago truncatula]
Length=335

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 4/70 (6%)
 Frame = +3

Query  336  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  515
            +K  LNLKATELRLGLPGSQSP+R+++ +   T K DEKPLFPLLP+KDG+  +V    +
Sbjct  47   KKVNLNLKATELRLGLPGSQSPEREMDSDFYLT-KLDEKPLFPLLPAKDGLQKNV---VS  102

Query  516  GNKRGFLDTM  545
            GNKRGF DT+
Sbjct  103  GNKRGFADTV  112



>ref|XP_009112194.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=278

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 76/119 (64%), Gaps = 13/119 (11%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATE  368
            E Q N SV +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S   ++K  ++LKATE
Sbjct  6    ELQSNVSVASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSCGEDDKGTISLKATE  64

Query  369  LRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTM  545
            L LGLPGSQS  R+         K DEKP FPLLPSKD I SS       NKRGF DT+
Sbjct  65   LTLGLPGSQSHARET--------KLDEKPFFPLLPSKDEICSSSHK----NKRGFSDTV  111



>ref|XP_004490496.1| PREDICTED: auxin-responsive protein IAA9-like [Cicer arietinum]
Length=362

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 80/130 (62%), Gaps = 11/130 (8%)
 Frame = +3

Query  189  EGQGNGSVMASSSTL---DCISQTGSALKERNYlglsdsssvdssaasgvVNE-----KD  344
            EG+ N +++ SSST     C++ + S  KE NY+GLS  SS  S  +S  +       K 
Sbjct  12   EGESNVTLLVSSSTTMESVCLNVSKSKPKEFNYMGLSCDSSSSSVESSVPIQSFSDETKS  71

Query  345  RLNLKATELRLGLPGSQSPKRD--LELNGPSTGKFDEKPLFPLLPSK-DGIFSSVKASFT  515
             LNLKATELRLG+PGSQSP+RD   +L   S+ KFDEK LFPL P K D   SS K +  
Sbjct  72   NLNLKATELRLGIPGSQSPERDSSSDLCLRSSTKFDEKTLFPLHPQKDDHHLSSPKVAVL  131

Query  516  GNKRGFLDTM  545
            G+KRGF D M
Sbjct  132  GSKRGFSDAM  141



>ref|XP_009112193.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=312

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 76/119 (64%), Gaps = 13/119 (11%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATE  368
            E Q N SV +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S   ++K  ++LKATE
Sbjct  6    ELQSNVSVASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSCGEDDKGTISLKATE  64

Query  369  LRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTM  545
            L LGLPGSQS  R+         K DEKP FPLLPSKD I SS       NKRGF DT+
Sbjct  65   LTLGLPGSQSHARET--------KLDEKPFFPLLPSKDEICSSSHK----NKRGFSDTV  111



>ref|XP_010666360.1| PREDICTED: auxin-responsive protein IAA8-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 78/122 (64%), Gaps = 3/122 (2%)
 Frame = +3

Query  189  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR--LNLKA  362
            +GQ +G++   +S+ + I    S L+E NY+G SD SS   S+A  V + + R   NLKA
Sbjct  9    DGQSSGTLPFPASSAESILHNNSELREVNYMGYSDCSSSVDSSAISVASGESRSNYNLKA  68

Query  363  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLD  539
            TELRLGLPGSQSP RD EL   ++ K D+KPLFPL P  DG   SS  +  +G+KRGF D
Sbjct  69   TELRLGLPGSQSPGRDTELGPLTSSKLDKKPLFPLYPVSDGTSSSSRISIVSGHKRGFAD  128

Query  540  TM  545
             +
Sbjct  129  AV  130



>ref|XP_010444576.1| PREDICTED: auxin-responsive protein IAA9-like [Camelina sativa]
Length=341

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 80/140 (57%), Gaps = 14/140 (10%)
 Frame = +3

Query  168  MSPTILGEGQGNGSVMASSSTLDCISQTGSA-----LKERNY---lglsdsssvdssaas  323
            MSP    E Q N SV +SS T +CIS+  +      LKE NY      S S    + +A 
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRGTTVSVCGGLKEHNYLGLSDCSSSVGSSTLSAG  58

Query  324  gvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-  500
             V ++K   +LKATEL LGLPGS+    DL L  P   K DEKP FPLLPSKD I SS  
Sbjct  59   LVEDDKATFSLKATELTLGLPGSRD--TDLNLMTPPV-KLDEKPFFPLLPSKDDICSSSQ  115

Query  501  KASFTGNKRGFLDTMGRLCD  560
            K + +GNKRGF DTM +  +
Sbjct  116  KNNASGNKRGFSDTMDQFAE  135



>emb|CAI77628.1| Aux/IAA protein [Solanum lycopersicum]
Length=308

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +3

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKASFTGNK  524
            LNLKATELRLGLPGSQSP+R  E     + K DEK LFPL PSKD  FS S K   +GNK
Sbjct  26   LNLKATELRLGLPGSQSPERGEETCPVISTKVDEKLLFPLHPSKDTAFSVSQKTVVSGNK  85

Query  525  RGFLDTM  545
            RGF D M
Sbjct  86   RGFSDAM  92



>gb|KEH28135.1| auxin response factor [Medicago truncatula]
Length=272

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDL-ELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  515
            K  LNLKATELRLGLPGS SP+RD  +    S+ +FDEKPLFPL P KD      K +  
Sbjct  62   KSNLNLKATELRLGLPGSLSPERDSSDFCLRSSKQFDEKPLFPLHPQKDDHLFESKPAVL  121

Query  516  GNKRGFLDTM  545
            GNKRGF D M
Sbjct  122  GNKRGFSDAM  131



>ref|XP_003615390.1| Auxin-responsive protein IAA5 [Medicago truncatula]
 gb|AES98348.1| auxin response factor [Medicago truncatula]
Length=347

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDL-ELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  515
            K  LNLKATELRLGLPGS SP+RD  +    S+ +FDEKPLFPL P KD      K +  
Sbjct  62   KSNLNLKATELRLGLPGSLSPERDSSDFCLRSSKQFDEKPLFPLHPQKDDHLFESKPAVL  121

Query  516  GNKRGFLDTM  545
            GNKRGF D M
Sbjct  122  GNKRGFSDAM  131



>ref|XP_010429195.1| PREDICTED: auxin-responsive protein IAA8 [Camelina sativa]
Length=326

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 65/100 (65%), Gaps = 5/100 (5%)
 Frame = +3

Query  261  LKERNYlglsdsssvdssaasgvVN--EKDRLNLKATELRLGLPGSQSPKRDLELNGPST  434
            LKERNYLGLSD SSVDSS     V   EK  LN KATELRLGLP SQSP+R+ +    S 
Sbjct  20   LKERNYLGLSDCSSVDSSTIHNRVQDGEKSNLNFKATELRLGLPESQSPERETDFGLLSP  79

Query  435  GKFDEKPLFPLLPSKDGIFSSV---KASFTGNKRGFLDTM  545
               DEK LFPLLPSKD   S+    K   +GNKRGF DT 
Sbjct  80   RTPDEKLLFPLLPSKDTAASATIGHKNVVSGNKRGFADTW  119



>ref|XP_004509716.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Cicer 
arietinum]
Length=326

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 78/132 (59%), Gaps = 32/132 (24%)
 Frame = +3

Query  168  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  332
            MSP +L    E Q N S +AS+S  +LDC SQ G+ LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  333  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  509
            +EK + LNLKATELRLGLPGSQSP+RD              P+            S K  
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERD--------------PV------------SQKNV  94

Query  510  FTGNKRGFLDTM  545
             +GNKRGF D M
Sbjct  95   VSGNKRGFSDAM  106



>ref|XP_010472259.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=326

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 65/100 (65%), Gaps = 5/100 (5%)
 Frame = +3

Query  261  LKERNYlglsdsssvdssaasgvVN--EKDRLNLKATELRLGLPGSQSPKRDLELNGPST  434
            LKERNYLGLSD SSVDSS     V   EK  LN KATELRLGLP SQSP+R+ +    S 
Sbjct  20   LKERNYLGLSDCSSVDSSTIHNRVQDGEKSNLNFKATELRLGLPESQSPERETDFGLLSP  79

Query  435  GKFDEKPLFPLLPSKDGIFSSV---KASFTGNKRGFLDTM  545
               DEK LFPLLPSKD   S+    K   +GNKRGF DT 
Sbjct  80   RTPDEKLLFPLLPSKDIAASATIGHKNVVSGNKRGFADTW  119



>gb|ADL70561.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=249

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  8    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  66

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  67   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  107



>gb|ADL70564.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=252

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  8    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  66

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  67   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  107



>gb|ADL70565.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=247

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  5    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  63

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  64   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  104



>gb|ADC29393.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=253

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  9    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  67

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  68   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  108



>gb|ADL70563.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=250

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  6    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  64

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  65   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  105



>gb|ADL70572.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=252

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  10   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  68

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  69   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  109



>gb|ADL70566.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=251

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  9    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  67

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  68   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  108



>gb|ADL70573.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=253

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  11   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  69

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  70   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  110



>gb|ADL70567.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=259

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  114



>ref|XP_010521481.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Tarenaya 
hassleriana]
Length=352

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 82/137 (60%), Gaps = 18/137 (13%)
 Frame = +3

Query  165  MMSPTILG-----EGQGNG---SVMASSSTLDCISQTGSALKERNYlglsdss--svdss  314
            +MSP + G     + Q N    S++ SS+++D      S LKERNY+ LS+SS     ++
Sbjct  2    LMSPPLRGVAEEEKAQSNNNATSLLVSSASMD---NKISELKERNYMSLSESSPGDESNN  58

Query  315  aasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS  494
            +   ++ ++ +++LK TELRLGLPGSQ  +R+     PS    DEKPLFPL P+ D   +
Sbjct  59   SGVSIITDEIKISLKETELRLGLPGSQPLQRE-----PSPSLLDEKPLFPLHPTGDDHCT  113

Query  495  SVKASFTGNKRGFLDTM  545
            S+K    GNKRGF D M
Sbjct  114  SLKNVVFGNKRGFSDAM  130



>gb|ADL70569.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=263

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  114



>gb|ADC29390.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=257

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  13   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  71

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  72   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  112



>gb|ADL70571.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=262

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  114



>gb|ADL70570.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=278

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  114



>ref|NP_850028.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07337.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=319

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  114



>ref|NP_179852.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 ref|NP_001077943.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 sp|Q38826.1|IAA8_ARATH RecName: Full=Auxin-responsive protein IAA8; AltName: Full=Indoleacetic 
acid-induced protein 8 [Arabidopsis thaliana]
 gb|AAG50092.1|AF334714_1 auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAC49049.1| IAA8 [Arabidopsis thaliana]
 gb|AAD15575.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL24387.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL49895.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM20092.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM47990.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM65174.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AEC07336.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07338.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=321

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  114



>gb|ADC29389.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=221

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +3

Query  261  LKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGK  440
            LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    S   
Sbjct  1    LKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLLSPRT  59

Query  441  FDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
             DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  60   PDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  96



>gb|ADL70562.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=226

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +3

Query  261  LKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGK  440
            LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    S   
Sbjct  1    LKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLLSPRT  59

Query  441  FDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
             DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  60   PDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  96



>ref|NP_001189579.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07339.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=338

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 3/101 (3%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  428
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  32   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  90

Query  429  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  91   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  131



>ref|XP_006294567.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27465.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=323

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = +3

Query  261  LKERNYlglsdsssvdssaasgvVNEKDRLNL--KATELRLGLPGSQSPKRDLELNGPST  434
            LKERNYLGLSD SSVDSS     V + ++ NL  KATELRLGLP SQSP+R+ +    S 
Sbjct  19   LKERNYLGLSDCSSVDSSTIHNRVPDVEKSNLIFKATELRLGLPESQSPERETDFGLLSP  78

Query  435  GKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
               DEK LFPLLPSKD   +++  K   +GNKRGF DT 
Sbjct  79   RTPDEKLLFPLLPSKDTASATIGHKNVVSGNKRGFADTW  117



>ref|XP_006294565.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 ref|XP_006294566.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27463.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27464.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=330

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = +3

Query  261  LKERNYlglsdsssvdssaasgvVNEKDRLNL--KATELRLGLPGSQSPKRDLELNGPST  434
            LKERNYLGLSD SSVDSS     V + ++ NL  KATELRLGLP SQSP+R+ +    S 
Sbjct  19   LKERNYLGLSDCSSVDSSTIHNRVPDVEKSNLIFKATELRLGLPESQSPERETDFGLLSP  78

Query  435  GKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
               DEK LFPLLPSKD   +++  K   +GNKRGF DT 
Sbjct  79   RTPDEKLLFPLLPSKDTASATIGHKNVVSGNKRGFADTW  117



>ref|XP_010521482.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Tarenaya 
hassleriana]
Length=352

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 82/137 (60%), Gaps = 18/137 (13%)
 Frame = +3

Query  165  MMSPTILG-----EGQGNG---SVMASSSTLDCISQTGSALKERNYlglsdss--svdss  314
            +MSP + G     + Q N    S++ SS+++D      S LKERNY+ LS+SS     ++
Sbjct  2    LMSPPLRGVAEEEKAQSNNNATSLLVSSASMD---NKISELKERNYMSLSESSPGDESNN  58

Query  315  aasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS  494
            +   ++ ++ +++LK TELRLGLPGSQ  +R+     PS    DEKPLFPL P+ D   +
Sbjct  59   SGVSIITDEIKISLKETELRLGLPGSQPLQRE-----PSPSLLDEKPLFPLHPTGDDHCT  113

Query  495  SVKASFTGNKRGFLDTM  545
            S+K    GNKRGF D +
Sbjct  114  SLKNVVFGNKRGFSDAV  130



>gb|EPS59988.1| auxin-regulated protein [Genlisea aurea]
Length=317

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 74/128 (58%), Gaps = 24/128 (19%)
 Frame = +3

Query  168  MSPTILGEGQG--NGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEK  341
            MSP  L  G G  NGSVMA+SS     S     LKE NYLG SD SSVDSSA     + K
Sbjct  1    MSPPCLTAGIGGSNGSVMAASSG----SVNSLVLKEINYLGFSDCSSVDSSALPE--DNK  54

Query  342  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGN  521
              +NLKATELRLGLPGSQSP R            DEK LFPL+PS       V    +GN
Sbjct  55   TTMNLKATELRLGLPGSQSPDR------------DEKQLFPLVPSSQKPVIIV----SGN  98

Query  522  KRGFLDTM  545
            KRGF DT+
Sbjct  99   KRGFSDTV  106



>ref|XP_002878628.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54887.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = +3

Query  261  LKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGK  440
            LKERNYLGLSD SSVDSS    V  EK  LN KATELRLGLP S+SP+R+ +    S   
Sbjct  15   LKERNYLGLSDCSSVDSSTIPNV--EKSNLNFKATELRLGLPESESPERETDFGLLSPRT  72

Query  441  FDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
             DEK LFPLLP KD   ++   K   +GNKRGF DT 
Sbjct  73   LDEKLLFPLLPCKDNTSATTGHKNVVSGNKRGFADTW  109



>ref|XP_006404728.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 ref|XP_006404729.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 dbj|BAJ33826.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46181.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 gb|ESQ46182.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
Length=334

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVN---EKDRLNLKATELRLGLPGSQSPKRDLEL  419
            T   LKERNYLGLSD SSVDSS    VV    EK  LN KATELRLGLP SQSP+R+ + 
Sbjct  15   TPPGLKERNYLGLSDCSSVDSSTIPNVVVPEIEKSNLNFKATELRLGLPESQSPERETDF  74

Query  420  NGPSTGKFDEKPLFPLLPSKD---GIFSSVKASFTGNKRGFLDTM  545
               S    DEK LFPLLP KD   G  +  K   +GNKRGF DT 
Sbjct  75   GLLSPRTPDEKLLFPLLPCKDHASGATTVHKNVVSGNKRGFSDTW  119



>gb|ADL70568.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=225

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 64/96 (67%), Gaps = 3/96 (3%)
 Frame = +3

Query  264  KERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKF  443
            KERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    S    
Sbjct  1    KERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLLSPRTP  59

Query  444  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTM  545
            DEK LFPLLPSKD   ++   K   +GNKRGF DT 
Sbjct  60   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTW  95



>gb|ADC29392.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=224

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  512
            K  LN KATELRLGLP SQSP+R+ +    S    DEK LFPLLPSKD   ++   K   
Sbjct  20   KSNLNFKATELRLGLPESQSPERETDFGLLSPRTPDEKLLFPLLPSKDNGSATTGHKNVV  79

Query  513  TGNKRGFLDTM  545
            +GNKRGF DT 
Sbjct  80   SGNKRGFADTW  90



>gb|ADC29391.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=229

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +3

Query  339  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  512
            K  LN KATELRLGLP SQSP+R+ +    S    DEK LFPLLPSKD   ++   K   
Sbjct  20   KSNLNFKATELRLGLPESQSPERETDFGLLSPRTPDEKLLFPLLPSKDNGSATTGHKNVV  79

Query  513  TGNKRGFLDTM  545
            +GNKRGF DT 
Sbjct  80   SGNKRGFADTW  90



>ref|XP_006850381.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
 gb|ERN11962.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
Length=393

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 4/99 (4%)
 Frame = +3

Query  261  LKERNYlglsdsssvdssaasgvVNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTG  437
            L+E NY+GLSD+SS++SS  +  + EK D LNLK TELRLGLPGS+SP RD EL    + 
Sbjct  35   LREHNYMGLSDASSLESSVITCPLEEKEDSLNLKETELRLGLPGSRSPVRDPELCLLPSL  94

Query  438  KFDEKPLFPLLPSKDGIFSSVKAS---FTGNKRGFLDTM  545
            K DEK LFPL P K+            F+GNKRGF D +
Sbjct  95   KLDEKALFPLAPLKENTSEEKNGRNGIFSGNKRGFSDAI  133



>ref|XP_010417025.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=327

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 63/101 (62%), Gaps = 6/101 (6%)
 Frame = +3

Query  261  LKERNYlglsdsssvdssaasgvVNEKDR---LNLKATELRLGLPGSQSPKRDLELNGPS  431
            LK RNY GLSD SSVDSS     V + ++   LN KATELRLGLP SQSP+R+ +    S
Sbjct  20   LKVRNYFGLSDCSSVDSSTIHNRVQDGEKTSNLNFKATELRLGLPESQSPERETDFGLLS  79

Query  432  TGKFDEKPLFPLLPSKDGIFSSV---KASFTGNKRGFLDTM  545
                DEK LFPLLP KD   S+    K   +GNKRGF DT 
Sbjct  80   PRTPDEKLLFPLLPCKDTAASATTEHKNVVSGNKRGFADTW  120



>ref|XP_010527157.1| PREDICTED: auxin-responsive protein IAA8, partial [Tarenaya hassleriana]
Length=354

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 70/108 (65%), Gaps = 2/108 (2%)
 Frame = +3

Query  240  ISQTGSALKERNYlglsdsssvdssaasgvVN-EKDRLNLKATELRLGLPGSQSPKRDLE  416
            I Q+  +LKERNYLGLSD SSVDSS    V + EK  LN+KATELRLGLPGS+S + + +
Sbjct  9    IPQSALSLKERNYLGLSDCSSVDSSTVPNVPDDEKGNLNVKATELRLGLPGSRSSEGESD  68

Query  417  LNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMGRLCD  560
               PS    DEK LFPL PSKD   +  K   + NKRGF DT+    +
Sbjct  69   FGLPSPRTPDEKLLFPLAPSKDPA-TGHKNVVSRNKRGFSDTLDEFSE  115



>emb|CDY66936.1| BnaC02g47310D [Brassica napus]
Length=276

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +3

Query  333  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI--FSSVKA  506
            ++K  + LKAT+L LGLPGS+SP RD +L+  S  K DE+P  PL+P KD I  FSS+K 
Sbjct  49   DDKAVIRLKATDLTLGLPGSRSPVRDTDLHLLSYAKLDERPFLPLVPLKDEICPFSSLKN  108

Query  507  SFTGNK  524
              +GNK
Sbjct  109  IASGNK  114



>ref|XP_009140376.1| PREDICTED: auxin-responsive protein IAA8 [Brassica rapa]
Length=266

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 63/101 (62%), Gaps = 10/101 (10%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLP-GSQSPKRDLELNG  425
            T   LKERNY+GLSD SSVDSS     V++K  LN KATELRLGLP  SQSP+R+ +   
Sbjct  15   TSPGLKERNYMGLSDCSSVDSSTIPN-VDKKSSLNFKATELRLGLPESSQSPQRETDFGL  73

Query  426  PSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMG  548
             S    DEK LFPLLP KD          +GNKRG+L   G
Sbjct  74   LSPRTPDEKLLFPLLPCKDHA--------SGNKRGYLAKSG  106



>emb|CDY25617.1| BnaA04g13090D [Brassica napus]
Length=266

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 63/101 (62%), Gaps = 10/101 (10%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLP-GSQSPKRDLELNG  425
            T   LKERNY+GLSD SSVDSS     V++K  LN KATELRLGLP  SQSP+R+ +   
Sbjct  15   TSPGLKERNYMGLSDCSSVDSSTIPN-VDKKSSLNFKATELRLGLPESSQSPQRETDYRL  73

Query  426  PSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMG  548
             S    DEK LFPLLP KD          +GNKRG+L   G
Sbjct  74   LSPRTPDEKLLFPLLPCKDHA--------SGNKRGYLAKSG  106



>ref|XP_010555426.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
 ref|XP_010555427.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
Length=360

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 58/105 (55%), Gaps = 9/105 (9%)
 Frame = +3

Query  240  ISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKATELRLGLPGSQSPKRD--  410
            + Q    LKE NYL  S  SS   S      NE K  LN KATELRLGLPG QSP+R+  
Sbjct  20   VHQYAFGLKEHNYLVRSVDSSTLCSVPD---NEGKGNLNFKATELRLGLPGLQSPERESN  76

Query  411  LELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTM  545
              L  P T   DEK LFPL  SKD      K   +GNKRGF DT+
Sbjct  77   FALLNPRTP--DEKLLFPLSASKDPAIVH-KNVVSGNKRGFSDTL  118



>emb|CDX89499.1| BnaC04g35180D [Brassica napus]
Length=271

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 62/105 (59%), Gaps = 13/105 (12%)
 Frame = +3

Query  249  TGSALKERNYlglsdsssvdssaasgvV----NEKDRLNLKATELRLGLP-GSQSPKRDL  413
            T + LKERNYLGLSD SS   S+    +    ++K  LN KATELRLGLP  SQSP+R+ 
Sbjct  15   TATCLKERNYLGLSDCSSSVDSSTVPNLVLDTDKKSSLNFKATELRLGLPESSQSPQRET  74

Query  414  ELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMG  548
            +    S    DEK LFPLLP KD          +GNKRG+L   G
Sbjct  75   DFGLLSPRTPDEKLLFPLLPCKDHA--------SGNKRGYLAKSG  111



>gb|AAM76220.1| putative IAA-responsive protein 9 [Gossypium herbaceum]
Length=122

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  405  RDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTM  545
            R+ EL   S+ + DEKPLFPL PS DG  F+S K   +GNKRGF D M
Sbjct  1    RNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAM  48



>gb|AAM76222.1| putative IAA-responsive protein 9 [Gossypium hirsutum]
Length=122

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  405  RDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTM  545
            R+ EL   S+ + DEKPLFPL PS DG  F+S K   +GNKRGF D M
Sbjct  1    RNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAM  48



>ref|XP_007152862.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
 gb|ESW24856.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
Length=307

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 16/66 (24%)
 Frame = +3

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  527
            LNLKATELRLGLPGS+SP+RD        G  +E+ + PL          VK   +G KR
Sbjct  32   LNLKATELRLGLPGSESPERD--------GGVEERNVHPL--------GMVKNLVSGAKR  75

Query  528  GFLDTM  545
            GF DT+
Sbjct  76   GFSDTI  81



>gb|AAM76223.1| putative IAA-responsive protein 9 [Gossypium hirsutum]
Length=122

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  405  RDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTM  545
            R+ EL   S+ + DEKP FPL PS DG  F+S K+  +GNKRGF D M
Sbjct  1    RNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKSVVSGNKRGFSDAM  48



>ref|XP_003637871.1| Auxin-responsive aux/iaa gene family member [Medicago truncatula]
Length=222

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 15/66 (23%)
 Frame = +3

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  527
            LNLKATELRLGLPGS+SP+RD +L        +EK  + L          + + F+G KR
Sbjct  15   LNLKATELRLGLPGSESPERDNDL-------LEEKNAYSLC--------MLNSLFSGAKR  59

Query  528  GFLDTM  545
            GF D +
Sbjct  60   GFSDAI  65



>gb|AAM76221.1| putative IAA-responsive protein 9 [Gossypium raimondii]
Length=122

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +3

Query  405  RDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTM  545
            R+ EL   S+ + DEKP FPL PS DG  F+S K   +GNKRGF D M
Sbjct  1    RNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKNVVSGNKRGFSDAM  48



>ref|XP_003637872.1| Auxin-responsive aux/iaa gene family member [Medicago truncatula]
 gb|KEH27148.1| auxin response factor [Medicago truncatula]
Length=193

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 15/66 (23%)
 Frame = +3

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  527
            LNLKATELRLGLPGS+SP+RD +L        +EK  + L          + + F+G KR
Sbjct  15   LNLKATELRLGLPGSESPERDNDL-------LEEKNAYSLCM--------LNSLFSGAKR  59

Query  528  GFLDTM  545
            GF D +
Sbjct  60   GFSDAI  65



>gb|ACU24212.1| unknown [Glycine max]
Length=152

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 16/66 (24%)
 Frame = +3

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  527
            LNLKATELRLGLPGS+SP+R+  +        ++K + PL          VK   +G KR
Sbjct  30   LNLKATELRLGLPGSESPEREEGV--------EDKNVHPL--------GMVKCLVSGAKR  73

Query  528  GFLDTM  545
            GF DT+
Sbjct  74   GFSDTI  79



>gb|KEH27147.1| auxin response factor [Medicago truncatula]
Length=254

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 15/66 (23%)
 Frame = +3

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  527
            LNLKATELRLGLPGS+SP+RD +L        +EK  + L          + + F+G KR
Sbjct  15   LNLKATELRLGLPGSESPERDNDL-------LEEKNAYSLC--------MLNSLFSGAKR  59

Query  528  GFLDTM  545
            GF D +
Sbjct  60   GFSDAI  65



>gb|AFK45766.1| unknown [Medicago truncatula]
Length=254

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 15/66 (23%)
 Frame = +3

Query  348  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  527
            LNLKATELRLGLPGS+SP+RD +L        +EK  + L          + + F+G KR
Sbjct  15   LNLKATELRLGLPGSESPERDNDL-------LEEKNAYSLC--------MLNSLFSGAKR  59

Query  528  GFLDTM  545
            GF D +
Sbjct  60   GFSDAI  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920