BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006L23

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789015.1|  PREDICTED: uncharacterized GPI-anchored prot...    159   1e-42   Nicotiana sylvestris
ref|XP_006343290.1|  PREDICTED: uncharacterized GPI-anchored prot...    158   2e-42   
ref|XP_009624117.1|  PREDICTED: uncharacterized GPI-anchored prot...    159   2e-42   Nicotiana tomentosiformis
ref|XP_006343289.1|  PREDICTED: uncharacterized GPI-anchored prot...    158   3e-42   Solanum tuberosum [potatoes]
ref|XP_006348113.1|  PREDICTED: uncharacterized GPI-anchored prot...    157   4e-42   Solanum tuberosum [potatoes]
ref|XP_006348112.1|  PREDICTED: uncharacterized GPI-anchored prot...    157   8e-42   Solanum tuberosum [potatoes]
ref|XP_004232714.1|  PREDICTED: uncharacterized GPI-anchored prot...    156   2e-41   Solanum lycopersicum
ref|XP_010317663.1|  PREDICTED: uncharacterized GPI-anchored prot...    153   9e-41   Solanum lycopersicum
ref|XP_004234477.1|  PREDICTED: uncharacterized GPI-anchored prot...    152   6e-40   Solanum lycopersicum
emb|CDP04392.1|  unnamed protein product                                144   4e-37   Coffea canephora [robusta coffee]
ref|XP_006449719.1|  hypothetical protein CICLE_v10015200mg             139   2e-35   
gb|KDO78212.1|  hypothetical protein CISIN_1g012690mg                   139   2e-35   Citrus sinensis [apfelsine]
gb|KDO78211.1|  hypothetical protein CISIN_1g012690mg                   139   3e-35   Citrus sinensis [apfelsine]
ref|XP_006467443.1|  PREDICTED: uncharacterized GPI-anchored prot...    139   3e-35   Citrus sinensis [apfelsine]
ref|XP_006467444.1|  PREDICTED: uncharacterized GPI-anchored prot...    139   4e-35   Citrus sinensis [apfelsine]
ref|XP_011096070.1|  PREDICTED: uncharacterized GPI-anchored prot...    137   9e-35   Sesamum indicum [beniseed]
ref|XP_010655406.1|  PREDICTED: uncharacterized GPI-anchored prot...    136   4e-34   Vitis vinifera
ref|XP_007026059.1|  Uncharacterized protein isoform 2                  135   5e-34   
ref|XP_007026061.1|  Uncharacterized protein isoform 4                  135   5e-34   
ref|XP_007026060.1|  Uncharacterized protein isoform 3                  135   6e-34   
ref|XP_007216480.1|  hypothetical protein PRUPE_ppa024738mg             134   7e-34   
gb|EYU27795.1|  hypothetical protein MIMGU_mgv1a006122mg                135   1e-33   Erythranthe guttata [common monkey flower]
gb|EYU27794.1|  hypothetical protein MIMGU_mgv1a006122mg                135   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_007026058.1|  Uncharacterized protein isoform 1                  135   1e-33   
gb|KDO54654.1|  hypothetical protein CISIN_1g0440241mg                  130   3e-33   Citrus sinensis [apfelsine]
ref|XP_008812638.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   4e-33   
ref|XP_008441110.1|  PREDICTED: uncharacterized GPI-anchored prot...    133   5e-33   Cucumis melo [Oriental melon]
ref|XP_010923892.1|  PREDICTED: uncharacterized GPI-anchored prot...    133   5e-33   Elaeis guineensis
ref|XP_008812631.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   6e-33   
ref|XP_002518489.1|  conserved hypothetical protein                     132   6e-33   
ref|XP_008812636.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   6e-33   
ref|XP_008812630.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   7e-33   Phoenix dactylifera
ref|XP_006447552.1|  hypothetical protein CICLE_v10015544mg             132   7e-33   
ref|XP_008812632.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   7e-33   
ref|XP_009789016.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   8e-33   Nicotiana sylvestris
ref|XP_004145108.1|  PREDICTED: uncharacterized GPI-anchored prot...    132   1e-32   Cucumis sativus [cucumbers]
ref|XP_006469765.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   1e-32   
ref|XP_008224823.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   2e-32   Prunus mume [ume]
ref|XP_008230068.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   2e-32   Prunus mume [ume]
ref|XP_010052838.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   2e-32   Eucalyptus grandis [rose gum]
ref|XP_009361468.1|  PREDICTED: uncharacterized GPI-anchored prot...    131   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_009361541.1|  PREDICTED: uncharacterized GPI-anchored prot...    130   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_007211589.1|  hypothetical protein PRUPE_ppa005381mg             131   3e-32   Prunus persica
ref|XP_004486118.1|  PREDICTED: uncharacterized GPI-anchored prot...    130   3e-32   Cicer arietinum [garbanzo]
ref|XP_004293284.1|  PREDICTED: uncharacterized GPI-anchored prot...    130   6e-32   Fragaria vesca subsp. vesca
gb|KJB67181.1|  hypothetical protein B456_010G180100                    127   2e-31   Gossypium raimondii
ref|XP_007147733.1|  hypothetical protein PHAVU_006G150200g             128   2e-31   Phaseolus vulgaris [French bean]
ref|XP_009408659.1|  PREDICTED: uncharacterized GPI-anchored prot...    128   3e-31   
gb|KHG11868.1|  hypothetical protein F383_01404                         128   3e-31   Gossypium arboreum [tree cotton]
ref|XP_009408658.1|  PREDICTED: uncharacterized GPI-anchored prot...    128   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278700.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   4e-31   
gb|KJB67177.1|  hypothetical protein B456_010G180100                    127   4e-31   Gossypium raimondii
gb|KJB67173.1|  hypothetical protein B456_010G180100                    127   4e-31   Gossypium raimondii
ref|XP_010276075.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_009357443.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   4e-31   Pyrus x bretschneideri [bai li]
gb|KJB67176.1|  hypothetical protein B456_010G180100                    127   5e-31   Gossypium raimondii
ref|XP_011463310.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   8e-31   Fragaria vesca subsp. vesca
ref|XP_006592374.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   9e-31   
ref|XP_006592373.1|  PREDICTED: uncharacterized GPI-anchored prot...    127   9e-31   Glycine max [soybeans]
gb|KJB69285.1|  hypothetical protein B456_011G014700                    124   1e-30   Gossypium raimondii
ref|XP_010665573.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010051000.1|  PREDICTED: uncharacterized GPI-anchored prot...    125   1e-30   
gb|KHN21235.1|  Putative GPI-anchored protein                           126   1e-30   Glycine soja [wild soybean]
ref|XP_003539868.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Glycine max [soybeans]
ref|XP_006592376.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Glycine max [soybeans]
gb|KHN33033.1|  Putative GPI-anchored protein                           126   1e-30   Glycine soja [wild soybean]
ref|XP_008384071.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Malus domestica [apple tree]
ref|XP_010100635.1|  hypothetical protein L484_001991                   126   1e-30   
ref|XP_010276074.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010093283.1|  hypothetical protein L484_006297                   126   2e-30   
ref|XP_003546148.1|  PREDICTED: uncharacterized GPI-anchored prot...    126   2e-30   Glycine max [soybeans]
ref|XP_006597581.1|  PREDICTED: uncharacterized GPI-anchored prot...    125   2e-30   
gb|KEH36841.1|  hypothetical protein MTR_2g022990                       125   2e-30   Medicago truncatula
ref|XP_006389630.1|  hypothetical protein POPTR_0021s00790g             125   2e-30   Populus trichocarpa [western balsam poplar]
gb|KCW89407.1|  hypothetical protein EUGRSUZ_A01709                     125   3e-30   Eucalyptus grandis [rose gum]
gb|KCW89408.1|  hypothetical protein EUGRSUZ_A01709                     125   3e-30   Eucalyptus grandis [rose gum]
ref|XP_006389629.1|  hypothetical protein POPTR_0021s00790g             125   3e-30   
gb|EPS59099.1|  hypothetical protein M569_15711                         124   3e-30   Genlisea aurea
gb|KHG15461.1|  hypothetical protein F383_19757                         125   4e-30   Gossypium arboreum [tree cotton]
gb|KJB69288.1|  hypothetical protein B456_011G014700                    124   4e-30   Gossypium raimondii
ref|XP_006447553.1|  hypothetical protein CICLE_v10015544mg             124   5e-30   
ref|XP_006594428.1|  PREDICTED: uncharacterized GPI-anchored prot...    124   5e-30   Glycine max [soybeans]
gb|KJB69286.1|  hypothetical protein B456_011G014700                    124   6e-30   Gossypium raimondii
gb|KHN37599.1|  Putative GPI-anchored protein                           124   6e-30   Glycine soja [wild soybean]
gb|KJB69284.1|  hypothetical protein B456_011G014700                    124   6e-30   Gossypium raimondii
gb|KJB69287.1|  hypothetical protein B456_011G014700                    124   8e-30   Gossypium raimondii
ref|XP_007132551.1|  hypothetical protein PHAVU_011G104100g             124   9e-30   Phaseolus vulgaris [French bean]
ref|XP_010930056.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   1e-29   
ref|XP_010930030.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   2e-29   Elaeis guineensis
ref|XP_010930048.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   2e-29   
ref|XP_010930038.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   2e-29   Elaeis guineensis
ref|XP_011047995.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   2e-29   Populus euphratica
ref|XP_011047994.1|  PREDICTED: uncharacterized GPI-anchored prot...    123   3e-29   Populus euphratica
dbj|BAK03275.1|  predicted protein                                      120   9e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP20754.1|  hypothetical protein JCGZ_21225                         121   1e-28   Jatropha curcas
ref|XP_008348285.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    119   1e-28   
ref|XP_006858205.1|  hypothetical protein AMTR_s00062p00176270          120   1e-28   
gb|KEH29677.1|  hypothetical protein MTR_4g048040                       119   4e-28   Medicago truncatula
ref|XP_008379634.1|  PREDICTED: uncharacterized GPI-anchored prot...    119   4e-28   
ref|XP_008379633.1|  PREDICTED: uncharacterized GPI-anchored prot...    119   4e-28   
gb|KEH29676.1|  hypothetical protein MTR_4g048040                       119   5e-28   Medicago truncatula
gb|AES88114.2|  hypothetical protein MTR_4g048040                       119   5e-28   Medicago truncatula
ref|XP_006657387.1|  PREDICTED: uncharacterized GPI-anchored prot...    118   6e-28   
ref|XP_009770909.1|  PREDICTED: uncharacterized GPI-anchored prot...    118   8e-28   Nicotiana sylvestris
ref|XP_006366594.1|  PREDICTED: uncharacterized GPI-anchored prot...    118   8e-28   
ref|XP_003605917.1|  GPI-anchored protein, putative                     120   9e-28   
gb|EEE66424.1|  hypothetical protein OsJ_22777                          117   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002304912.2|  hypothetical protein POPTR_0004s01590g             117   2e-27   
dbj|BAD31837.1|  unknown protein                                        117   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058682.1|  Os07g0102300                                       117   2e-27   
ref|XP_010323825.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   2e-27   Solanum lycopersicum
ref|XP_010323826.1|  PREDICTED: uncharacterized GPI-anchored prot...    117   2e-27   
gb|ACN25434.1|  unknown                                                 115   9e-27   Zea mays [maize]
gb|EEC81371.1|  hypothetical protein OsI_24575                          115   1e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_004987275.1|  PREDICTED: uncharacterized GPI-anchored prot...    115   1e-26   Setaria italica
ref|NP_001143619.1|  uncharacterized protein LOC100276335 precursor     115   1e-26   
tpg|DAA59335.1|  TPA: hypothetical protein ZEAMMB73_763936              115   1e-26   
ref|XP_002461296.1|  hypothetical protein SORBIDRAFT_02g000365          115   2e-26   Sorghum bicolor [broomcorn]
ref|XP_011037655.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   2e-26   Populus euphratica
ref|XP_011037654.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   2e-26   Populus euphratica
ref|XP_009397174.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397173.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557710.2|  PREDICTED: uncharacterized GPI-anchored prot...    114   3e-26   Brachypodium distachyon [annual false brome]
ref|XP_009590299.1|  PREDICTED: uncharacterized GPI-anchored prot...    113   5e-26   Nicotiana tomentosiformis
ref|XP_006391949.1|  hypothetical protein EUTSA_v10023466mg             108   2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_002886500.1|  hypothetical protein ARALYDRAFT_475141             108   2e-24   
ref|XP_010546889.1|  PREDICTED: uncharacterized GPI-anchored prot...    108   3e-24   Tarenaya hassleriana [spider flower]
gb|KJB67174.1|  hypothetical protein B456_010G180100                    107   3e-24   Gossypium raimondii
ref|NP_974068.1|  uncharacterized protein                               107   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176382.2|  uncharacterized protein                               108   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAC28508.1|  ESTs gb|AA728658 and gb|N95943 come from this gene      107   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185289.1|  uncharacterized protein                            107   4e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47167.1|  BnaA01g22930D                                          106   1e-23   Brassica napus [oilseed rape]
ref|XP_009105804.1|  PREDICTED: uncharacterized GPI-anchored prot...    106   1e-23   Brassica rapa
ref|XP_009105812.1|  PREDICTED: uncharacterized GPI-anchored prot...    106   1e-23   Brassica rapa
emb|CDY25331.1|  BnaC01g30000D                                          106   2e-23   Brassica napus [oilseed rape]
emb|CDY19508.1|  BnaC09g13950D                                          105   2e-23   Brassica napus [oilseed rape]
ref|XP_009113111.1|  PREDICTED: uncharacterized GPI-anchored prot...    105   2e-23   Brassica rapa
ref|XP_006301249.1|  hypothetical protein CARUB_v10021649mg             104   7e-23   
gb|KFK37988.1|  hypothetical protein AALP_AA3G055500                    103   1e-22   Arabis alpina [alpine rockcress]
ref|XP_010418167.1|  PREDICTED: uncharacterized GPI-anchored prot...    102   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010430217.1|  PREDICTED: uncharacterized GPI-anchored prot...    102   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010473411.1|  PREDICTED: uncharacterized GPI-anchored prot...    102   2e-22   Camelina sativa [gold-of-pleasure]
gb|EMT03899.1|  hypothetical protein F775_29914                       99.0    2e-21   
ref|XP_010672282.1|  PREDICTED: uncharacterized GPI-anchored prot...  95.5    2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010268250.1|  PREDICTED: uncharacterized GPI-anchored prot...  93.6    7e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010930243.1|  PREDICTED: uncharacterized GPI-anchored prot...  92.0    2e-18   Elaeis guineensis
ref|XP_010930241.1|  PREDICTED: uncharacterized GPI-anchored prot...  92.0    3e-18   Elaeis guineensis
ref|XP_002978387.1|  hypothetical protein SELMODRAFT_108739           89.7    8e-18   
ref|XP_009383433.1|  PREDICTED: uncharacterized GPI-anchored prot...  90.1    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO50752.1|  hypothetical protein CISIN_1g012117mg                 89.0    2e-17   Citrus sinensis [apfelsine]
ref|XP_006442927.1|  hypothetical protein CICLE_v10020018mg           89.0    2e-17   
ref|XP_011047725.1|  PREDICTED: uncharacterized GPI-anchored prot...  89.7    2e-17   Populus euphratica
ref|XP_008788195.1|  PREDICTED: uncharacterized GPI-anchored prot...  89.4    2e-17   
gb|KDP43911.1|  hypothetical protein JCGZ_20921                       89.4    2e-17   Jatropha curcas
ref|XP_002309774.2|  hypothetical protein POPTR_0007s01500g           89.0    3e-17   
ref|XP_007223287.1|  hypothetical protein PRUPE_ppa005555mg           89.4    3e-17   
ref|XP_008800397.1|  PREDICTED: uncharacterized GPI-anchored prot...  89.4    3e-17   
ref|XP_008800391.1|  PREDICTED: uncharacterized GPI-anchored prot...  89.4    3e-17   Phoenix dactylifera
ref|XP_008788193.1|  PREDICTED: uncharacterized GPI-anchored prot...  89.0    3e-17   Phoenix dactylifera
ref|XP_010909048.1|  PREDICTED: uncharacterized GPI-anchored prot...  89.0    3e-17   Elaeis guineensis
gb|KDO50747.1|  hypothetical protein CISIN_1g012117mg                 89.0    3e-17   Citrus sinensis [apfelsine]
ref|XP_006442928.1|  hypothetical protein CICLE_v10020018mg           89.0    4e-17   
ref|XP_010907821.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.6    4e-17   
ref|XP_010907822.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.6    4e-17   
ref|XP_006478825.1|  PREDICTED: uncharacterized GPI-anchored prot...  89.0    4e-17   
ref|XP_010907820.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.6    4e-17   
ref|XP_010907818.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.6    4e-17   
ref|XP_010907816.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.6    4e-17   
ref|XP_010907817.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.6    4e-17   
ref|XP_010907815.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.6    4e-17   
ref|XP_002530300.1|  conserved hypothetical protein                   88.6    5e-17   
ref|XP_010907814.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.6    5e-17   
ref|XP_010907812.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.6    5e-17   Elaeis guineensis
gb|AAC02741.2|  hypothetical protein                                  88.2    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522039.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.2    6e-17   Tarenaya hassleriana [spider flower]
ref|XP_002970227.1|  hypothetical protein SELMODRAFT_33447            86.7    6e-17   
ref|XP_010522037.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.2    7e-17   Tarenaya hassleriana [spider flower]
ref|NP_850153.1|  uncharacterized protein                             88.2    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245348.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.2    7e-17   
ref|XP_008245345.1|  PREDICTED: uncharacterized GPI-anchored prot...  88.2    7e-17   Prunus mume [ume]
ref|XP_002273850.1|  PREDICTED: uncharacterized GPI-anchored prot...  87.8    8e-17   Vitis vinifera
emb|CAN82818.1|  hypothetical protein VITISV_030074                   87.8    8e-17   Vitis vinifera
ref|XP_010542709.1|  PREDICTED: uncharacterized GPI-anchored prot...  87.8    9e-17   Tarenaya hassleriana [spider flower]
ref|XP_010542708.1|  PREDICTED: uncharacterized GPI-anchored prot...  87.8    9e-17   Tarenaya hassleriana [spider flower]
ref|XP_006410172.1|  hypothetical protein EUTSA_v10016766mg           86.7    1e-16   
ref|XP_008791793.1|  PREDICTED: uncharacterized GPI-anchored prot...  87.4    1e-16   Phoenix dactylifera
ref|XP_002881126.1|  hypothetical protein ARALYDRAFT_481988           87.4    1e-16   
ref|XP_010469811.1|  PREDICTED: uncharacterized GPI-anchored prot...  87.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_007033843.1|  Uncharacterized protein isoform 5                86.7    2e-16   
ref|XP_010510299.1|  PREDICTED: uncharacterized GPI-anchored prot...  87.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009356791.1|  PREDICTED: uncharacterized GPI-anchored prot...  87.0    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_010510301.1|  PREDICTED: uncharacterized GPI-anchored prot...  87.0    2e-16   
ref|XP_010912783.1|  PREDICTED: uncharacterized GPI-anchored prot...  86.7    2e-16   
ref|XP_007033842.1|  Uncharacterized protein isoform 3                86.7    2e-16   
ref|XP_007033841.1|  Uncharacterized protein isoform 2                87.0    2e-16   
ref|XP_010912782.1|  PREDICTED: uncharacterized GPI-anchored prot...  86.7    2e-16   Elaeis guineensis
ref|XP_007033840.1|  Uncharacterized protein isoform 1                87.0    2e-16   
ref|XP_010414232.1|  PREDICTED: uncharacterized GPI-anchored prot...  86.7    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010912780.1|  PREDICTED: uncharacterized GPI-anchored prot...  86.7    2e-16   Elaeis guineensis
gb|KEH16340.1|  transmembrane protein, putative                       86.7    2e-16   Medicago truncatula
gb|KEH16341.1|  transmembrane protein, putative                       86.7    2e-16   Medicago truncatula
ref|XP_006372774.1|  hypothetical protein POPTR_0017s04930g           86.7    3e-16   
emb|CDP03434.1|  unnamed protein product                              86.3    3e-16   Coffea canephora [robusta coffee]
ref|XP_001774402.1|  predicted protein                                84.7    3e-16   
ref|XP_010094091.1|  hypothetical protein L484_018108                 85.9    4e-16   
gb|KFK31261.1|  hypothetical protein AALP_AA6G089400                  85.9    5e-16   Arabis alpina [alpine rockcress]
ref|XP_009413428.1|  PREDICTED: uncharacterized GPI-anchored prot...  85.5    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011043593.1|  PREDICTED: uncharacterized GPI-anchored prot...  85.5    6e-16   Populus euphratica
ref|XP_006294136.1|  hypothetical protein CARUB_v10023131mg           85.5    6e-16   
ref|XP_006294137.1|  hypothetical protein CARUB_v10023131mg           85.1    7e-16   
gb|KHN11705.1|  Putative GPI-anchored protein                         85.1    7e-16   Glycine soja [wild soybean]
ref|XP_006587693.1|  PREDICTED: uncharacterized GPI-anchored prot...  85.1    8e-16   Glycine max [soybeans]
ref|XP_006858875.1|  hypothetical protein AMTR_s00066p00196830        85.1    1e-15   
emb|CDY68454.1|  BnaCnng59080D                                        82.8    1e-15   Brassica napus [oilseed rape]
gb|EPS68793.1|  hypothetical protein M569_05967                       84.3    1e-15   Genlisea aurea
ref|XP_007212309.1|  hypothetical protein PRUPE_ppa006724mg           83.6    2e-15   
ref|XP_008226610.1|  PREDICTED: uncharacterized GPI-anchored prot...  84.0    2e-15   Prunus mume [ume]
gb|EEE51310.1|  hypothetical protein OsJ_32270                        83.6    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008226609.1|  PREDICTED: uncharacterized GPI-anchored prot...  84.0    2e-15   Prunus mume [ume]
gb|AAM88643.1|  hypothetical protein                                  83.6    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67358.1|  hypothetical protein OsI_34458                        83.6    2e-15   Oryza sativa Indica Group [Indian rice]
gb|ABB47927.2|  expressed protein                                     83.6    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009141092.1|  PREDICTED: uncharacterized GPI-anchored prot...  83.6    3e-15   Brassica rapa
gb|ABB47928.2|  expressed protein                                     83.6    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065159.1|  Os10g0534100                                     83.6    3e-15   
ref|XP_009141091.1|  PREDICTED: uncharacterized GPI-anchored prot...  83.2    3e-15   
ref|XP_008386190.1|  PREDICTED: uncharacterized GPI-anchored prot...  83.2    4e-15   
ref|XP_006356959.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    5e-15   Solanum tuberosum [potatoes]
ref|XP_004983825.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    5e-15   Setaria italica
ref|XP_006356958.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    5e-15   Solanum tuberosum [potatoes]
ref|XP_006661998.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    5e-15   Oryza brachyantha
ref|XP_006661999.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    5e-15   Oryza brachyantha
ref|XP_004156974.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    5e-15   
emb|CDY23986.1|  BnaC03g17050D                                        82.8    5e-15   Brassica napus [oilseed rape]
ref|XP_004983827.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    5e-15   Setaria italica
ref|XP_004152141.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    5e-15   Cucumis sativus [cucumbers]
ref|XP_009132748.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    5e-15   Brassica rapa
ref|XP_011091606.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.8    6e-15   Sesamum indicum [beniseed]
gb|EYU41043.1|  hypothetical protein MIMGU_mgv1a005775mg              82.4    6e-15   Erythranthe guttata [common monkey flower]
gb|KCW87645.1|  hypothetical protein EUGRSUZ_A00037                   81.6    7e-15   Eucalyptus grandis [rose gum]
gb|EYU41042.1|  hypothetical protein MIMGU_mgv1a005775mg              82.4    7e-15   Erythranthe guttata [common monkey flower]
ref|XP_002465025.1|  hypothetical protein SORBIDRAFT_01g030650        82.0    8e-15   Sorghum bicolor [broomcorn]
gb|KCW87643.1|  hypothetical protein EUGRSUZ_A00037                   82.0    8e-15   Eucalyptus grandis [rose gum]
ref|XP_008454095.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.0    9e-15   Cucumis melo [Oriental melon]
ref|XP_008454096.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.0    9e-15   Cucumis melo [Oriental melon]
gb|KCW87641.1|  hypothetical protein EUGRSUZ_A00037                   82.0    9e-15   Eucalyptus grandis [rose gum]
emb|CDX84821.1|  BnaA03g14090D                                        82.4    1e-14   
ref|XP_010069980.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.0    1e-14   Eucalyptus grandis [rose gum]
gb|KJB37983.1|  hypothetical protein B456_006G230000                  81.3    1e-14   Gossypium raimondii
ref|XP_010069258.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.0    1e-14   Eucalyptus grandis [rose gum]
gb|KCW87634.1|  hypothetical protein EUGRSUZ_A00037                   81.6    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010068655.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.0    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010065950.1|  PREDICTED: uncharacterized GPI-anchored prot...  82.0    1e-14   Eucalyptus grandis [rose gum]
gb|KCW87644.1|  hypothetical protein EUGRSUZ_A00037                   81.6    1e-14   Eucalyptus grandis [rose gum]
gb|KCW87635.1|  hypothetical protein EUGRSUZ_A00037                   82.0    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010067401.1|  PREDICTED: uncharacterized GPI-anchored prot...  81.6    1e-14   Eucalyptus grandis [rose gum]
ref|XP_010068086.1|  PREDICTED: uncharacterized GPI-anchored prot...  81.6    1e-14   Eucalyptus grandis [rose gum]
gb|KHG08002.1|  hypothetical protein F383_34877                       81.6    2e-14   Gossypium arboreum [tree cotton]
gb|KHN32404.1|  Putative GPI-anchored protein                         81.3    2e-14   Glycine soja [wild soybean]
gb|ACU18602.1|  unknown                                               80.9    2e-14   Glycine max [soybeans]
ref|XP_009799550.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.9    2e-14   Nicotiana sylvestris
gb|KJB37982.1|  hypothetical protein B456_006G230000                  81.3    2e-14   Gossypium raimondii
gb|KJB37981.1|  hypothetical protein B456_006G230000                  81.3    2e-14   Gossypium raimondii
ref|XP_004309828.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.9    2e-14   Fragaria vesca subsp. vesca
gb|KJB37984.1|  hypothetical protein B456_006G230000                  80.9    2e-14   Gossypium raimondii
ref|XP_009799549.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.9    2e-14   Nicotiana sylvestris
tpg|DAA46060.1|  TPA: hypothetical protein ZEAMMB73_313399            80.9    2e-14   
ref|XP_009799547.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.9    2e-14   Nicotiana sylvestris
gb|KJB37980.1|  hypothetical protein B456_006G230000                  80.9    2e-14   Gossypium raimondii
ref|XP_009786453.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.9    2e-14   Nicotiana sylvestris
ref|XP_008657905.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.9    2e-14   Zea mays [maize]
ref|XP_008657911.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.9    2e-14   Zea mays [maize]
ref|XP_009799548.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.9    2e-14   Nicotiana sylvestris
ref|XP_009786452.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.9    2e-14   Nicotiana sylvestris
ref|XP_009598829.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.1    3e-14   Nicotiana tomentosiformis
ref|XP_004250775.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.5    3e-14   Solanum lycopersicum
ref|XP_010313113.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.5    3e-14   
ref|XP_010313112.1|  PREDICTED: uncharacterized GPI-anchored prot...  80.5    3e-14   Solanum lycopersicum
dbj|BAK07547.1|  predicted protein                                    80.5    3e-14   
gb|EMT03898.1|  hypothetical protein F775_11902                       80.1    5e-14   
ref|XP_006352204.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.3    6e-14   
ref|XP_007131412.1|  hypothetical protein PHAVU_011G011600g           79.7    6e-14   
ref|XP_004513671.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.7    6e-14   
ref|XP_004513670.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.7    6e-14   
ref|XP_006352203.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.3    6e-14   
ref|XP_010234944.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.3    6e-14   
ref|XP_003574251.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.3    6e-14   
ref|XP_006352202.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.3    7e-14   
ref|XP_009627075.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.3    7e-14   
ref|XP_006352201.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.3    7e-14   
ref|XP_010324691.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.0    1e-13   
ref|XP_004244742.1|  PREDICTED: uncharacterized GPI-anchored prot...  79.0    1e-13   
gb|KHN41221.1|  Putative GPI-anchored protein                         72.4    4e-12   
gb|EMS46609.1|  hypothetical protein TRIUR3_34936                     65.1    3e-10   
emb|CDP05718.1|  unnamed protein product                              65.1    4e-10   



>ref|XP_009789015.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Nicotiana sylvestris]
Length=458

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C LNF A+ SM+++TSIDC APFA+YLANVMCCPQLETTLV+L+GQ S
Sbjct  67   FTNSTLPKLSGLCTLNFDAVKSMMAVTSIDCVAPFAQYLANVMCCPQLETTLVILIGQSS  126

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN TLA+HCLSDFQ++L S+GANDTLQ ICSL+P+
Sbjct  127  KKTNMLALNGTLAKHCLSDFQQLLVSQGANDTLQHICSLHPA  168



>ref|XP_006343290.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum tuberosum]
Length=425

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+ PKLSG C LNFAA+ SM+++TSIDC APFA+YLANVMCCPQLETTLV+L+GQ S
Sbjct  33   FTNSTSPKLSGLCTLNFAAVKSMMAVTSIDCVAPFAEYLANVMCCPQLETTLVILIGQSS  92

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K++N LALN +LA+HCLSDFQ++L S+GANDTLQQICSL+
Sbjct  93   KHSNMLALNGSLAKHCLSDFQQLLVSQGANDTLQQICSLH  132



>ref|XP_009624117.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Nicotiana tomentosiformis]
Length=463

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C LNF A+ SM+++TSIDC APFA+YLANVMCCPQLETTLV+L+G+ S
Sbjct  72   FTNSTLPKLSGLCTLNFDAVRSMMTVTSIDCVAPFAQYLANVMCCPQLETTLVILIGRSS  131

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN TLA+HCLSDFQ++L S+GANDTLQ ICSL+PS
Sbjct  132  KKTNMLALNGTLAKHCLSDFQQLLVSQGANDTLQHICSLHPS  173



>ref|XP_006343289.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum tuberosum]
Length=465

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+ PKLSG C LNFAA+ SM+++TSIDC APFA+YLANVMCCPQLETTLV+L+GQ S
Sbjct  73   FTNSTSPKLSGLCTLNFAAVKSMMAVTSIDCVAPFAEYLANVMCCPQLETTLVILIGQSS  132

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K++N LALN +LA+HCLSDFQ++L S+GANDTLQQICSL+
Sbjct  133  KHSNMLALNGSLAKHCLSDFQQLLVSQGANDTLQQICSLH  172



>ref|XP_006348113.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum tuberosum]
Length=418

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C L F A+  M+ +TSIDC APFA+YLANVMCCPQLE TLV+L+GQ S
Sbjct  33   FTNSTLPKLSGLCTLKFDAVERMMGVTSIDCVAPFAQYLANVMCCPQLEATLVILIGQSS  92

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K+TN LALN TLA+HCLSDFQ+IL S+GANDTLQ ICSL+PS
Sbjct  93   KFTNMLALNGTLAKHCLSDFQQILVSQGANDTLQHICSLHPS  134



>ref|XP_006348112.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum tuberosum]
Length=457

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C L F A+  M+ +TSIDC APFA+YLANVMCCPQLE TLV+L+GQ S
Sbjct  72   FTNSTLPKLSGLCTLKFDAVERMMGVTSIDCVAPFAQYLANVMCCPQLEATLVILIGQSS  131

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K+TN LALN TLA+HCLSDFQ+IL S+GANDTLQ ICSL+PS
Sbjct  132  KFTNMLALNGTLAKHCLSDFQQILVSQGANDTLQHICSLHPS  173



>ref|XP_004232714.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Solanum 
lycopersicum]
Length=457

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C L F A+  M+ +TSIDC APFA+YLANVMCCPQLE TLV+L+GQ S
Sbjct  72   FTNSTLPKLSGLCTLKFDAVERMMGVTSIDCVAPFAEYLANVMCCPQLEATLVILIGQSS  131

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K+TN LALN T+A+HCLSDFQ+IL S+GANDTLQ ICSL+PS
Sbjct  132  KFTNMLALNGTVAKHCLSDFQQILVSQGANDTLQHICSLHPS  173



>ref|XP_010317663.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum lycopersicum]
Length=376

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+  +LSG C LNF A+ SM+++TSIDC APFA+YLANV+CCPQLETTLV+L+GQ S
Sbjct  73   FTNSTSLRLSGLCTLNFDAVKSMMAVTSIDCVAPFAEYLANVICCPQLETTLVILIGQSS  132

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K++N LALN TLA+HCLSDFQ++L S+GANDTLQ+ICSL+P
Sbjct  133  KHSNMLALNGTLAKHCLSDFQQLLVSQGANDTLQKICSLHP  173



>ref|XP_004234477.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum lycopersicum]
Length=465

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+  +LSG C LNF A+ SM+++TSIDC APFA+YLANV+CCPQLETTLV+L+GQ S
Sbjct  73   FTNSTSLRLSGLCTLNFDAVKSMMAVTSIDCVAPFAEYLANVICCPQLETTLVILIGQSS  132

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K++N LALN TLA+HCLSDFQ++L S+GANDTLQ+ICSL+P
Sbjct  133  KHSNMLALNGTLAKHCLSDFQQLLVSQGANDTLQKICSLHP  173



>emb|CDP04392.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNSS+PKLSG C LNFAA+ SM+ MTSIDC   FA YLANV+CCPQ++ TL VLVGQ S
Sbjct  78   FTNSSIPKLSGVCILNFAAVESMMRMTSIDCVGGFAPYLANVICCPQVDATLTVLVGQSS  137

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN TLAE CLSDF++IL  +GAND+L +ICS++PS
Sbjct  138  KDTNMLALNGTLAEPCLSDFEEILVGQGANDSLPRICSIHPS  179



>ref|XP_006449719.1| hypothetical protein CICLE_v10015200mg [Citrus clementina]
 gb|ESR62959.1| hypothetical protein CICLE_v10015200mg [Citrus clementina]
Length=456

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VPKLSG C LNF A  S++SMTSIDC A FA  LANV+CCPQLE T+++L+GQ S
Sbjct  76   FTNSTVPKLSGHCLLNFTAAESLMSMTSIDCHAVFAPLLANVVCCPQLEATILILIGQSS  135

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            + TN LALN TLAEHCLSDF++IL  +GA D L++ICS+N S
Sbjct  136  RKTNMLALNGTLAEHCLSDFEQILVGQGAADDLKKICSINAS  177



>gb|KDO78212.1| hypothetical protein CISIN_1g012690mg [Citrus sinensis]
Length=437

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VPKLSG C LNF A  S++SMTSIDC A FA  LANV+CCPQLE T+++L+GQ S
Sbjct  74   FTNSTVPKLSGHCLLNFTAAESLMSMTSIDCHAVFAPLLANVVCCPQLEATILILIGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            + TN LALN TLAEHCLSDF++IL  +GA D L++ICS+N S
Sbjct  134  RKTNMLALNGTLAEHCLSDFEQILVGQGAADDLKKICSINAS  175



>gb|KDO78211.1| hypothetical protein CISIN_1g012690mg [Citrus sinensis]
Length=458

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VPKLSG C LNF A  S++SMTSIDC A FA  LANV+CCPQLE T+++L+GQ S
Sbjct  74   FTNSTVPKLSGHCLLNFTAAESLMSMTSIDCHAVFAPLLANVVCCPQLEATILILIGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            + TN LALN TLAEHCLSDF++IL  +GA D L++ICS+N S
Sbjct  134  RKTNMLALNGTLAEHCLSDFEQILVGQGAADDLKKICSINAS  175



>ref|XP_006467443.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Citrus sinensis]
Length=459

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VPKLSG C LNF A  S++SMTSIDC A FA  LANV+CCPQLE T+++L+GQ S
Sbjct  74   FTNSTVPKLSGHCFLNFTAAESLMSMTSIDCHAVFAPLLANVVCCPQLEATILILIGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            + TN LALN TLAEHCLSDF++IL  +GA D L++ICS+N S
Sbjct  134  RKTNMLALNGTLAEHCLSDFEQILVGQGAADDLKKICSINAS  175



>ref|XP_006467444.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Citrus sinensis]
Length=458

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VPKLSG C LNF A  S++SMTSIDC A FA  LANV+CCPQLE T+++L+GQ S
Sbjct  74   FTNSTVPKLSGHCFLNFTAAESLMSMTSIDCHAVFAPLLANVVCCPQLEATILILIGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            + TN LALN TLAEHCLSDF++IL  +GA D L++ICS+N S
Sbjct  134  RKTNMLALNGTLAEHCLSDFEQILVGQGAADDLKKICSINAS  175



>ref|XP_011096070.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Sesamum indicum]
 ref|XP_011069400.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Sesamum indicum]
Length=427

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F NS++PKLSG C LNF AL +M+ +TS DC A FA  LANV+CCPQ+ETTLV+L+GQ S
Sbjct  44   FANSTIPKLSGLCVLNFTALTNMMVVTSTDCMAAFAPLLANVVCCPQVETTLVILIGQSS  103

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K+TNTLALN +LA HCLSDF++IL  +GAND+L +ICS++ S
Sbjct  104  KHTNTLALNGSLAAHCLSDFEQILVGQGANDSLSKICSVHSS  145



>ref|XP_010655406.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Vitis 
vinifera]
 emb|CBI23250.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  296  TNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSK  475
            TNS++PKLSG C LNF+A  SMISMTSIDC A FA  LANV+CCPQL+ TL +L+GQ SK
Sbjct  74   TNSTIPKLSGLCSLNFSAGESMISMTSIDCWAVFASVLANVICCPQLKATLHILIGQSSK  133

Query  476  YTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             TN LALN TLA+HCLSD ++IL S+GA+D L QICS++PS
Sbjct  134  DTNLLALNETLAKHCLSDVEQILVSQGASDKLHQICSIHPS  174



>ref|XP_007026059.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007026062.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY28681.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY28684.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=368

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNSSVPKLSG C LNF A  S++SMTSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  74   FTNSSVPKLSGLCILNFTAAQSLMSMTSIDCWAAFAPLLANVICCPQLHATLVILVGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA  CLSD +K+LE +GA + L+QICS++PS
Sbjct  134  KDTGVLALNRTLANPCLSDIEKVLEGQGAGENLKQICSIHPS  175



>ref|XP_007026061.1| Uncharacterized protein isoform 4, partial [Theobroma cacao]
 gb|EOY28683.1| Uncharacterized protein isoform 4, partial [Theobroma cacao]
Length=377

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNSSVPKLSG C LNF A  S++SMTSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  74   FTNSSVPKLSGLCILNFTAAQSLMSMTSIDCWAAFAPLLANVICCPQLHATLVILVGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA  CLSD +K+LE +GA + L+QICS++PS
Sbjct  134  KDTGVLALNRTLANPCLSDIEKVLEGQGAGENLKQICSIHPS  175



>ref|XP_007026060.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY28682.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=397

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNSSVPKLSG C LNF A  S++SMTSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  74   FTNSSVPKLSGLCILNFTAAQSLMSMTSIDCWAAFAPLLANVICCPQLHATLVILVGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA  CLSD +K+LE +GA + L+QICS++PS
Sbjct  134  KDTGVLALNRTLANPCLSDIEKVLEGQGAGENLKQICSIHPS  175



>ref|XP_007216480.1| hypothetical protein PRUPE_ppa024738mg, partial [Prunus persica]
 gb|EMJ17679.1| hypothetical protein PRUPE_ppa024738mg, partial [Prunus persica]
Length=351

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN S+PKLSG C LNF+A G+M+S+T+ DC A FA  LA+V+CCPQ + TL  L+GQ S
Sbjct  60   FTNYSIPKLSGLCTLNFSAAGNMMSVTATDCWASFAPLLADVVCCPQFDATLATLIGQSS  119

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            KY+  LALN T A+HCLSD QKILE +GAND +Q+ICS+ P
Sbjct  120  KYSRMLALNVTHAKHCLSDVQKILEGQGANDNIQKICSIEP  160



>gb|EYU27795.1| hypothetical protein MIMGU_mgv1a006122mg [Erythranthe guttata]
Length=455

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++P+LSG C LNF +L +M+++TS DC A FA  LANV+CCPQ+E TLV+L+GQ S
Sbjct  72   FTNSTIPQLSGLCVLNFTSLTNMLTVTSTDCMAAFAPLLANVVCCPQVEATLVILIGQSS  131

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KYTNTL+LN T + HCLSDF++IL  +GAND+L +ICS++ S
Sbjct  132  KYTNTLSLNGTTSTHCLSDFEQILVGQGANDSLSKICSVHSS  173



>gb|EYU27794.1| hypothetical protein MIMGU_mgv1a006122mg [Erythranthe guttata]
Length=456

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++P+LSG C LNF +L +M+++TS DC A FA  LANV+CCPQ+E TLV+L+GQ S
Sbjct  72   FTNSTIPQLSGLCVLNFTSLTNMLTVTSTDCMAAFAPLLANVVCCPQVEATLVILIGQSS  131

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KYTNTL+LN T + HCLSDF++IL  +GAND+L +ICS++ S
Sbjct  132  KYTNTLSLNGTTSTHCLSDFEQILVGQGANDSLSKICSVHSS  173



>ref|XP_007026058.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY28680.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=459

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNSSVPKLSG C LNF A  S++SMTSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  74   FTNSSVPKLSGLCILNFTAAQSLMSMTSIDCWAAFAPLLANVICCPQLHATLVILVGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA  CLSD +K+LE +GA + L+QICS++PS
Sbjct  134  KDTGVLALNRTLANPCLSDIEKVLEGQGAGENLKQICSIHPS  175



>gb|KDO54654.1| hypothetical protein CISIN_1g0440241mg, partial [Citrus sinensis]
Length=256

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
             +NSS+PKLSG C LNF+A  S +S T+ DC A FA YLANV+CCPQ + T+V+L+GQ+S
Sbjct  53   ISNSSLPKLSGLCTLNFSAAESFVSTTATDCWASFAPYLANVVCCPQFDATMVILMGQYS  112

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  L+LN T A+HCLSDF+KILE++GAN  L+ ICS++P+
Sbjct  113  KYSGMLSLNTTNAQHCLSDFEKILETQGANRNLKTICSIHPA  154



>ref|XP_008812638.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X5 [Phoenix dactylifera]
Length=387

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF+A+ S+IS T++DC A FA  LANV+CCPQ + TLV+L+GQ S
Sbjct  4    FFNNSTPKLSGRCTLNFSAVDSLISTTAVDCLASFAPLLANVICCPQFQATLVILIGQSS  63

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CLSDFQ+ILESR A+D L+QICS++P
Sbjct  64   KNTGMLALDSTHANYCLSDFQRILESRSASDDLEQICSIHP  104



>ref|XP_008441110.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Cucumis 
melo]
Length=457

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN++VPKLSG C LNF+A  +++SMT+IDC APFAK +ANV+CCPQLE TL +L+GQ S
Sbjct  74   FTNTTVPKLSGQCLLNFSATETLMSMTAIDCWAPFAKQMANVICCPQLEATLAILIGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            + TN LALN TLA++CLSD ++IL  +GA++ L+ IC+++P+
Sbjct  134  QDTNVLALNGTLAKYCLSDIEQILVGQGASERLRHICTVHPA  175



>ref|XP_010923892.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Elaeis guineensis]
Length=505

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF+A+ S+IS T++DC A FA +LANV+CCPQ + TLV+L+GQ S
Sbjct  122  FFNNSTPKLSGRCTLNFSAVDSLISTTAVDCLASFAPFLANVVCCPQFQATLVILIGQSS  181

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CLSDFQ+ILESRGA++ LQ+ICS++P
Sbjct  182  KNTGMLALDSTHANYCLSDFQQILESRGASNNLQKICSIHP  222



>ref|XP_008812631.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Phoenix dactylifera]
Length=425

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF+A+ S+IS T++DC A FA  LANV+CCPQ + TLV+L+GQ S
Sbjct  42   FFNNSTPKLSGRCTLNFSAVDSLISTTAVDCLASFAPLLANVICCPQFQATLVILIGQSS  101

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CLSDFQ+ILESR A+D L+QICS++P
Sbjct  102  KNTGMLALDSTHANYCLSDFQRILESRSASDDLEQICSIHP  142



>ref|XP_002518489.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43876.1| conserved hypothetical protein [Ricinus communis]
Length=433

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN S+PKLSG C LNF A  S++SMTSIDC   FA  LANV+CCPQLE TL +L+GQ S
Sbjct  54   FTNGSIPKLSGLCTLNFTAAESLMSMTSIDCLGVFAPLLANVICCPQLEATLAILIGQSS  113

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T+++HCLSD ++IL  +GA D +++ICS++PS
Sbjct  114  KETNVLALNGTVSKHCLSDIEQILVGQGAADNVKRICSVHPS  155



>ref|XP_008812636.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X4 [Phoenix dactylifera]
Length=423

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF+A+ S+IS T++DC A FA  LANV+CCPQ + TLV+L+GQ S
Sbjct  40   FFNNSTPKLSGRCTLNFSAVDSLISTTAVDCLASFAPLLANVICCPQFQATLVILIGQSS  99

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CLSDFQ+ILESR A+D L+QICS++P
Sbjct  100  KNTGMLALDSTHANYCLSDFQRILESRSASDDLEQICSIHP  140



>ref|XP_008812630.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Phoenix dactylifera]
Length=441

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF+A+ S+IS T++DC A FA  LANV+CCPQ + TLV+L+GQ S
Sbjct  58   FFNNSTPKLSGRCTLNFSAVDSLISTTAVDCLASFAPLLANVICCPQFQATLVILIGQSS  117

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CLSDFQ+ILESR A+D L+QICS++P
Sbjct  118  KNTGMLALDSTHANYCLSDFQRILESRSASDDLEQICSIHP  158



>ref|XP_006447552.1| hypothetical protein CICLE_v10015544mg [Citrus clementina]
 gb|ESR60792.1| hypothetical protein CICLE_v10015544mg [Citrus clementina]
Length=380

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
             +NSS+PKLSG C LNF+A  S +S T+ DC A FA YLANV+CCPQ + T+V+L+GQ+S
Sbjct  73   ISNSSLPKLSGLCTLNFSAAESFVSTTATDCWASFAPYLANVVCCPQFDATMVILMGQYS  132

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  L+LN T A+HCLSDF+KILE++GAN  L++ICS++P+
Sbjct  133  KYSGMLSLNTTNAQHCLSDFEKILETQGANRNLKKICSIHPA  174



>ref|XP_008812632.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008812633.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008812634.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008812635.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X3 [Phoenix dactylifera]
Length=424

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF+A+ S+IS T++DC A FA  LANV+CCPQ + TLV+L+GQ S
Sbjct  41   FFNNSTPKLSGRCTLNFSAVDSLISTTAVDCLASFAPLLANVICCPQFQATLVILIGQSS  100

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CLSDFQ+ILESR A+D L+QICS++P
Sbjct  101  KNTGMLALDSTHANYCLSDFQRILESRSASDDLEQICSIHP  141



>ref|XP_009789016.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009789017.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Nicotiana sylvestris]
Length=370

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  359  MISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTLALNATLAEHCLSDFQK  538
            M+++TSIDC APFA+YLANVMCCPQLETTLV+L+GQ SK TN LALN TLA+HCLSDFQ+
Sbjct  1    MMAVTSIDCVAPFAQYLANVMCCPQLETTLVILIGQSSKKTNMLALNGTLAKHCLSDFQQ  60

Query  539  ILESRGANDTLQQICSLNPS  598
            +L S+GANDTLQ ICSL+P+
Sbjct  61   LLVSQGANDTLQHICSLHPA  80



>ref|XP_004145108.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
 ref|XP_004153520.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
 ref|XP_004158012.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
 gb|KGN64526.1| hypothetical protein Csa_1G063500 [Cucumis sativus]
Length=457

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN++VPKLSG C LNF+A  +++SMT+IDC APFAK +ANV+CCPQLE TL +L+GQ S
Sbjct  74   FTNTTVPKLSGQCLLNFSATETLMSMTAIDCWAPFAKQMANVICCPQLEATLAILIGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T+ LALN TLA++CLSD ++IL  +GA++ L+ IC+++P+
Sbjct  134  KDTSVLALNGTLAKYCLSDIEQILVGQGASERLRHICTVHPA  175



>ref|XP_006469765.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Citrus sinensis]
Length=403

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
             +NSS+PKLSG C LNF+A  S +S T+ DC A FA YLANV+CCPQ + T+V+L+GQ+S
Sbjct  26   ISNSSLPKLSGLCTLNFSAAESFVSTTATDCWASFAPYLANVVCCPQFDATMVILMGQYS  85

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  L+LN T A+HCLSDF+KILE++GAN  L++ICS++P+
Sbjct  86   KYSGMLSLNTTNAQHCLSDFEKILETQGANRNLKKICSIHPA  127



>ref|XP_008224823.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Prunus mume]
Length=463

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN++VPKLSG C LNF+   S++S+TS+DC + FA  LANV+CCPQLE TL +L+GQ S
Sbjct  80   FTNTTVPKLSGLCTLNFSVAESLMSVTSVDCWSVFAPLLANVICCPQLEATLTILIGQSS  139

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T+A+HCLSD ++IL  +GAND+L QICS++ S
Sbjct  140  KETNVLALNGTIAKHCLSDIEQILVGQGANDSLAQICSVHSS  181



>ref|XP_008230068.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Prunus mume]
 ref|XP_008230069.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Prunus mume]
 ref|XP_008230070.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Prunus mume]
Length=441

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN S+PKLSG C LNF+A G+M+S+T+ DC A FA  LA+V+CCPQ + TL  L+GQ S
Sbjct  60   FTNYSIPKLSGLCTLNFSAAGNMMSVTATDCWASFAPLLADVVCCPQFDATLATLIGQSS  119

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            KY+  LALN T A+HCLSD +KILE +GAN+ +Q+ICS+ P
Sbjct  120  KYSRMLALNVTHAKHCLSDVEKILEGQGANENIQKICSIEP  160



>ref|XP_010052838.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Eucalyptus grandis]
 gb|KCW76958.1| hypothetical protein EUGRSUZ_D01317 [Eucalyptus grandis]
Length=450

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN++VPKLSG C LNF A  +++SMTSIDC A FA YLA+V+CCPQ E TL +L+GQ S
Sbjct  65   FTNTTVPKLSGLCTLNFTAAENLMSMTSIDCWAVFAPYLAHVICCPQYEATLTILIGQSS  124

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K TN LALN + AEHCLSD  +IL S+GA D L +IC+++P
Sbjct  125  KTTNLLALNGSQAEHCLSDMDQILASQGAGDNLNRICTIHP  165



>ref|XP_009361468.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345551.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345552.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345553.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Pyrus x bretschneideri]
Length=448

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            +TN++VP+LSG C LNF+   S++S+TSIDC + FA  LANVMCCPQLE TL +LVGQ S
Sbjct  66   YTNTTVPRLSGLCRLNFSVAESLMSVTSIDCWSVFAPLLANVMCCPQLEATLTILVGQSS  125

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T A+HCLSD ++IL  +GAND+L QICS++ S
Sbjct  126  KETNVLALNGTTAKHCLSDIEQILVGQGANDSLAQICSVHSS  167



>ref|XP_009361541.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009345554.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Pyrus x bretschneideri]
Length=430

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            +TN++VP+LSG C LNF+   S++S+TSIDC + FA  LANVMCCPQLE TL +LVGQ S
Sbjct  66   YTNTTVPRLSGLCRLNFSVAESLMSVTSIDCWSVFAPLLANVMCCPQLEATLTILVGQSS  125

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T A+HCLSD ++IL  +GAND+L QICS++ S
Sbjct  126  KETNVLALNGTTAKHCLSDIEQILVGQGANDSLAQICSVHSS  167



>ref|XP_007211589.1| hypothetical protein PRUPE_ppa005381mg [Prunus persica]
 gb|EMJ12788.1| hypothetical protein PRUPE_ppa005381mg [Prunus persica]
Length=464

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN++VPKLSG C LNF+   S++S+TS+DC + FA  LANV+CCPQLE TL +L+GQ S
Sbjct  81   FTNTTVPKLSGLCTLNFSVAESLMSVTSVDCWSVFAPLLANVICCPQLEATLTILIGQSS  140

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T+A+HCLSD ++IL  +GAND+L QICS++ S
Sbjct  141  KETNVLALNGTVAKHCLSDIEQILVGQGANDSLAQICSVHSS  182



>ref|XP_004486118.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cicer arietinum]
Length=458

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN S+PKLSG C LNF  + S++S+T++DC   FA YLANV+CCPQLE TL VL+GQ S
Sbjct  76   FTNISIPKLSGLCTLNFTTVESLLSVTALDCWEAFAPYLANVICCPQLEATLTVLIGQSS  135

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K+TN LALNAT+A+HCLSD ++IL  +GAN  L+ ICS+  S
Sbjct  136  KHTNVLALNATVAKHCLSDVEQILMGQGANGDLRHICSVRSS  177



>ref|XP_004293284.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN +VPK+SG C LNF+A  S++S T+IDC + FA  LANV+CCPQLE T+ +L+GQ S
Sbjct  63   FTNITVPKVSGQCLLNFSASESLMSTTAIDCWSVFAPLLANVICCPQLEATITILIGQSS  122

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            KYTN LALN T A++CLSD ++IL S+GANDTL QICS+ 
Sbjct  123  KYTNVLALNGTAAKYCLSDIKQILVSQGANDTLAQICSVR  162



>gb|KJB67181.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=365

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C LNF A  S+++MTS DC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  71   FTNSTIPKLSGLCMLNFTASQSLMTMTSTDCWAAFAPLLANVICCPQLHATLVILVGQLS  130

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++LE +GA+D L+Q+C ++PS
Sbjct  131  KETGVLALNRTLAKPCLSDIEQVLEGQGASDDLKQVCLIHPS  172



>ref|XP_007147733.1| hypothetical protein PHAVU_006G150200g [Phaseolus vulgaris]
 gb|ESW19727.1| hypothetical protein PHAVU_006G150200g [Phaseolus vulgaris]
Length=452

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+S+PKLSG C LNF+   S+IS+T+IDC   FA +LANV+CCPQLE TL +L+GQ S
Sbjct  68   FTNTSIPKLSGLCTLNFSTAESLISVTAIDCWEVFAPFLANVICCPQLEATLTILIGQSS  127

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KYTN LALN T A+HCL+D ++IL  +GA   L+QICS++ S
Sbjct  128  KYTNVLALNGTNAKHCLADVEQILMGQGATTNLKQICSIHSS  169



>ref|XP_009408659.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=443

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F NSS+PKLSG C LNF+A+ S+IS T++DC   FA +LANV+CCPQ + TL++L+GQ S
Sbjct  77   FFNSSIPKLSGQCILNFSAVDSLISTTAVDCWTSFAPFLANVICCPQFQATLIILIGQSS  136

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LAL++T A +CLSD Q+IL S+GAN  LQ+ICS++PS
Sbjct  137  KETGLLALDSTHANYCLSDIQQILGSQGANSDLQEICSVHPS  178



>gb|KHG11868.1| hypothetical protein F383_01404 [Gossypium arboreum]
Length=449

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C LNF A  S+++MTS DC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  71   FTNSTIPKLSGLCMLNFTASQSLMTMTSTDCWAAFAPLLANVICCPQLHATLVILVGQFS  130

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++LE +GA+D L+Q+C ++PS
Sbjct  131  KETGVLALNRTLAKPCLSDIEQVLEGQGASDDLKQVCLIHPS  172



>ref|XP_009408658.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=461

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F NSS+PKLSG C LNF+A+ S+IS T++DC   FA +LANV+CCPQ + TL++L+GQ S
Sbjct  77   FFNSSIPKLSGQCILNFSAVDSLISTTAVDCWTSFAPFLANVICCPQFQATLIILIGQSS  136

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LAL++T A +CLSD Q+IL S+GAN  LQ+ICS++PS
Sbjct  137  KETGLLALDSTHANYCLSDIQQILGSQGANSDLQEICSVHPS  178



>ref|XP_010278700.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Nelumbo nucifera]
Length=455

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VP LSG C LNF+A  SM+S T+ DC A FA +LANV+CCPQLE+TLVVL+GQ S
Sbjct  72   FTNSTVPSLSGFCTLNFSAAESMMSTTATDCWAVFAPFLANVICCPQLESTLVVLMGQSS  131

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL+ T A+HCLSD +KIL S+GA+  LQ ICS++P
Sbjct  132  KDTGVLALDGTHAKHCLSDVEKILASQGASTDLQNICSVHP  172



>gb|KJB67177.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
 gb|KJB67180.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=429

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C LNF A  S+++MTS DC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  71   FTNSTIPKLSGLCMLNFTASQSLMTMTSTDCWAAFAPLLANVICCPQLHATLVILVGQLS  130

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++LE +GA+D L+Q+C ++PS
Sbjct  131  KETGVLALNRTLAKPCLSDIEQVLEGQGASDDLKQVCLIHPS  172



>gb|KJB67173.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=453

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C LNF A  S+++MTS DC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  71   FTNSTIPKLSGLCMLNFTASQSLMTMTSTDCWAAFAPLLANVICCPQLHATLVILVGQLS  130

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++LE +GA+D L+Q+C ++PS
Sbjct  131  KETGVLALNRTLAKPCLSDIEQVLEGQGASDDLKQVCLIHPS  172



>ref|XP_010276075.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Nelumbo nucifera]
Length=367

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = +2

Query  152  CSPLNNLKSSELPEKTGNGllpqtaaptaapeaqpllpllapsplapFTNSSVPKLSGSC  331
            CSPL   + S L EK GN +LP T+   A     PLL    P+P   FTNSSVP+LSG C
Sbjct  26   CSPLGYQQGSALLEKKGNAMLPATSPIGAPQPFLPLLAPSPPTP---FTNSSVPRLSGLC  82

Query  332  PLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTLALNATLA  511
             LNF+A  SM+S T+ DC A FA +LANV+CCPQLE TL +L+GQ SK T  LAL+AT A
Sbjct  83   TLNFSASESMMSKTATDCWAVFAPFLANVICCPQLEATLAILMGQSSKDTGALALDATHA  142

Query  512  EHCLSDFQKILESRGANDTLQQICSLNP  595
            +HCLSD ++IL  +GA+  LQ+ICS+ P
Sbjct  143  KHCLSDVEQILAGQGASADLQKICSIYP  170



>ref|XP_009357443.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Pyrus x bretschneideri]
Length=449

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            +TN++VPKLSG C LNF+   S++++TSIDC + FA  LANVMCCPQL+ TL +L+GQ S
Sbjct  66   YTNTTVPKLSGLCRLNFSVAESLMTVTSIDCWSVFAPLLANVMCCPQLKATLTILIGQSS  125

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T A+HCLSD ++IL ++GAND+L +ICS++ S
Sbjct  126  KETNVLALNGTTAKHCLSDIEQILVAQGANDSLARICSVHSS  167



>gb|KJB67176.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
 gb|KJB67178.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=434

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG C LNF A  S+++MTS DC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  71   FTNSTIPKLSGLCMLNFTASQSLMTMTSTDCWAAFAPLLANVICCPQLHATLVILVGQLS  130

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++LE +GA+D L+Q+C ++PS
Sbjct  131  KETGVLALNRTLAKPCLSDIEQVLEGQGASDDLKQVCLIHPS  172



>ref|XP_011463310.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Fragaria vesca subsp. vesca]
Length=442

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN S+P LSG C LNF+ +G ++S T+ DC A FA  LANV+CCPQLE TL  L+G  S
Sbjct  61   FTNDSIPTLSGLCTLNFSVVGDLMSKTATDCWAFFAPVLANVVCCPQLEATLTTLIGHSS  120

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            KY+  L+L+ T A+HCLSD +KILES+GAN T+Q+ICS+ P
Sbjct  121  KYSRMLSLDTTHAKHCLSDVEKILESQGANKTIQKICSIQP  161



>ref|XP_006592374.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Glycine max]
 ref|XP_006592375.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X4 [Glycine max]
Length=446

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVPKLSG C LNF+A   +++ T+ DC   FA YLANV+CCPQ +  LV L+GQ S
Sbjct  75   FTNNSVPKLSGHCSLNFSAAQDIMTTTATDCWTSFAPYLANVVCCPQFDAMLVTLIGQSS  134

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  LALN T A HCLSD QK+L S+GAN  L++ICS++P+
Sbjct  135  KYSGVLALNTTHAHHCLSDVQKVLASQGANRDLKKICSVHPT  176



>ref|XP_006592373.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Glycine max]
Length=462

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVPKLSG C LNF+A   +++ T+ DC   FA YLANV+CCPQ +  LV L+GQ S
Sbjct  75   FTNNSVPKLSGHCSLNFSAAQDIMTTTATDCWTSFAPYLANVVCCPQFDAMLVTLIGQSS  134

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  LALN T A HCLSD QK+L S+GAN  L++ICS++P+
Sbjct  135  KYSGVLALNTTHAHHCLSDVQKVLASQGANRDLKKICSVHPT  176



>gb|KJB69285.1| hypothetical protein B456_011G014700 [Gossypium raimondii]
Length=295

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+ PKLSG C LNF A  S+IS+TSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  74   FTNSTSPKLSGLCMLNFTAAQSLISITSIDCWAAFAPLLANVICCPQLHATLVILVGQLS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++L  +GA D L Q+CS++ S
Sbjct  134  KETGVLALNRTLAKPCLSDIEQVLAGQGAGDGLNQVCSIHSS  175



>ref|XP_010665573.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS++PKLSG CP NF A  S++ +T+ DC   FA YLANV+CCPQL  TLV+L+GQ S
Sbjct  69   FTNSTIPKLSGVCPFNFTAADSILGITATDCFTAFAPYLANVVCCPQLHATLVILIGQSS  128

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TL++ CLSD  ++L S+GAND LQ+IC +  S
Sbjct  129  KDTMLLALNETLSKQCLSDVNQVLASQGANDNLQEICKVRAS  170



>ref|XP_010051000.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Eucalyptus grandis]
 ref|XP_010051006.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Eucalyptus grandis]
 ref|XP_010051014.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Eucalyptus grandis]
Length=371

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN++VPKLSG C LNF+   S++S+T+ DC A FA YLANV+CCPQ + TLV+L+GQ S
Sbjct  70   FTNATVPKLSGLCSLNFSVAQSIMSITATDCWASFAPYLANVVCCPQFDATLVILMGQSS  129

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K +  LALNAT + HCLSD   ILE++GAN TLQ ICS++P+
Sbjct  130  KNSGMLALNATHSNHCLSDVLTILEAQGANATLQSICSVSPA  171



>gb|KHN21235.1| Putative GPI-anchored protein [Glycine soja]
Length=452

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVPKLSG C LNF+A   +++ T+ DC   FA YLANV+CCPQ +  LV L+GQ S
Sbjct  75   FTNNSVPKLSGHCSLNFSAAQDIMTTTATDCWTSFAPYLANVVCCPQFDAMLVTLIGQSS  134

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  LALN T A HCLSD QK+L S+GAN  L++ICS++P+
Sbjct  135  KYSGVLALNTTHAHHCLSDVQKVLASQGANRDLKKICSVHPT  176



>ref|XP_003539868.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Glycine max]
Length=456

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVPKLSG C LNF+A   +++ T+ DC   FA YLANV+CCPQ +  LV L+GQ S
Sbjct  75   FTNNSVPKLSGHCSLNFSAAQDIMTTTATDCWTSFAPYLANVVCCPQFDAMLVTLIGQSS  134

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  LALN T A HCLSD QK+L S+GAN  L++ICS++P+
Sbjct  135  KYSGVLALNTTHAHHCLSDVQKVLASQGANRDLKKICSVHPT  176



>ref|XP_006592376.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X5 [Glycine max]
Length=444

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVPKLSG C LNF+A   +++ T+ DC   FA YLANV+CCPQ +  LV L+GQ S
Sbjct  57   FTNNSVPKLSGHCSLNFSAAQDIMTTTATDCWTSFAPYLANVVCCPQFDAMLVTLIGQSS  116

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  LALN T A HCLSD QK+L S+GAN  L++ICS++P+
Sbjct  117  KYSGVLALNTTHAHHCLSDVQKVLASQGANRDLKKICSVHPT  158



>gb|KHN33033.1| Putative GPI-anchored protein [Glycine soja]
Length=404

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+++PKLSG C LNF    S+IS+T+IDC   FA +LANV+CCPQLE TL +L+GQ S
Sbjct  25   FTNTTIPKLSGLCTLNFTTAESLISVTAIDCWEVFAPFLANVICCPQLEATLTILIGQSS  84

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T+A+HCL+D ++IL  +GA + L+Q+CS+  S
Sbjct  85   KLTNVLALNGTVAKHCLADVEQILMGQGATNNLKQVCSIRSS  126



>ref|XP_008384071.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Malus 
domestica]
Length=448

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            +TN++VPKLSG C LNF+   S++++TSIDC + FA  LANVMCCPQL+ TL +L+GQ S
Sbjct  66   YTNTTVPKLSGLCRLNFSVAESLMTVTSIDCWSVFAPLLANVMCCPQLKATLTILIGQSS  125

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T A+HCLSD ++IL ++GAND+L ++CS++ S
Sbjct  126  KETNVLALNGTTAKHCLSDIEQILVAQGANDSLARLCSVHSS  167



>ref|XP_010100635.1| hypothetical protein L484_001991 [Morus notabilis]
 gb|EXB83383.1| hypothetical protein L484_001991 [Morus notabilis]
Length=403

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
             TN S+P+LSG C L F+ + S++++T+ DC A FA YLANV+CCPQL ++LV L+GQ S
Sbjct  26   LTNGSIPELSGLCTLKFSGVESLLNITATDCWASFAPYLANVVCCPQLSSSLVTLIGQSS  85

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            KY+  LALN T ++HCLSD +KIL SRGAN  LQ+ICS+ P
Sbjct  86   KYSGMLALNLTHSKHCLSDVEKILTSRGANSKLQKICSIQP  126



>ref|XP_010276074.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Nelumbo nucifera]
Length=453

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = +2

Query  152  CSPLNNLKSSELPEKTGNGllpqtaaptaapeaqpllpllapsplapFTNSSVPKLSGSC  331
            CSPL   + S L EK GN +LP T+   A     PLL    P+P   FTNSSVP+LSG C
Sbjct  26   CSPLGYQQGSALLEKKGNAMLPATSPIGAPQPFLPLLAPSPPTP---FTNSSVPRLSGLC  82

Query  332  PLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTLALNATLA  511
             LNF+A  SM+S T+ DC A FA +LANV+CCPQLE TL +L+GQ SK T  LAL+AT A
Sbjct  83   TLNFSASESMMSKTATDCWAVFAPFLANVICCPQLEATLAILMGQSSKDTGALALDATHA  142

Query  512  EHCLSDFQKILESRGANDTLQQICSLNP  595
            +HCLSD ++IL  +GA+  LQ+ICS+ P
Sbjct  143  KHCLSDVEQILAGQGASADLQKICSIYP  170



>ref|XP_010093283.1| hypothetical protein L484_006297 [Morus notabilis]
 gb|EXB53808.1| hypothetical protein L484_006297 [Morus notabilis]
Length=452

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            +TN++ PKLSG C LNF A   ++S TSIDC + FA  LANV+CCPQLE TL +L+GQ S
Sbjct  74   YTNTTSPKLSGMCALNFTAAEGLMSTTSIDCWSVFAPLLANVICCPQLEATLAILIGQSS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K TN LALN T A+HCLSD ++IL  +GAND+L+QICS+ 
Sbjct  134  KDTNLLALNGTTAKHCLSDIEQILVGQGANDSLRQICSIR  173



>ref|XP_003546148.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Glycine max]
Length=454

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+++PKLSG C LNF    S+IS+T+IDC   FA +LANV+CCPQLE TL +L+GQ S
Sbjct  71   FTNTTIPKLSGLCTLNFTTAESLISVTAIDCWEVFAPFLANVICCPQLEATLTILIGQSS  130

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T+A+HCL+D ++IL  +GA + L+Q+CS+  S
Sbjct  131  KLTNVLALNGTVAKHCLADVEQILMGQGATNNLKQVCSIRSS  172



>ref|XP_006597581.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Glycine max]
Length=473

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+++PKLSG C LNF    S+IS+T+IDC   FA +LANV+CCPQLE TL +L+GQ S
Sbjct  71   FTNTTIPKLSGLCTLNFTTAESLISVTAIDCWEVFAPFLANVICCPQLEATLTILIGQSS  130

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T+A+HCL+D ++IL  +GA + L+Q+CS+  S
Sbjct  131  KLTNVLALNGTVAKHCLADVEQILMGQGATNNLKQVCSIRSS  172



>gb|KEH36841.1| hypothetical protein MTR_2g022990 [Medicago truncatula]
Length=442

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN S+PKLSG C LNF    S++S+T+IDC   FA ++AN+MCCPQLE T+ VL+GQ S
Sbjct  63   FTNISIPKLSGLCSLNFTNAKSLLSVTAIDCWGFFAPFVANIMCCPQLEATVTVLIGQSS  122

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K+TN LALN T+A+HCLSD ++IL  +GA+  L+QICS++ S
Sbjct  123  KHTNALALNGTVAKHCLSDVEQILMGQGASGDLRQICSISSS  164



>ref|XP_006389630.1| hypothetical protein POPTR_0021s00790g [Populus trichocarpa]
 gb|ERP48544.1| hypothetical protein POPTR_0021s00790g [Populus trichocarpa]
Length=458

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VPKLSG C LNF A  S++S TSIDC + FA  LANV+CCPQLE TL +LVGQ S
Sbjct  76   FTNSTVPKLSGQCTLNFTAAQSLMSTTSIDCWSVFAPLLANVICCPQLEATLAILVGQSS  135

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T++++CLSD ++IL  +GA   + +ICS++PS
Sbjct  136  KDTNALALNGTVSKYCLSDIEQILVGQGAAANVNKICSIHPS  177



>gb|KCW89407.1| hypothetical protein EUGRSUZ_A01709 [Eucalyptus grandis]
Length=453

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN++VPKLSG C LNF+   S++S+T+ DC A FA YLANV+CCPQ + TLV+L+GQ S
Sbjct  70   FTNATVPKLSGLCSLNFSVAQSIMSITATDCWASFAPYLANVVCCPQFDATLVILMGQSS  129

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K +  LALNAT + HCLSD   ILE++GAN TLQ ICS++P+
Sbjct  130  KNSGMLALNATHSNHCLSDVLTILEAQGANATLQSICSVSPA  171



>gb|KCW89408.1| hypothetical protein EUGRSUZ_A01709 [Eucalyptus grandis]
Length=452

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN++VPKLSG C LNF+   S++S+T+ DC A FA YLANV+CCPQ + TLV+L+GQ S
Sbjct  70   FTNATVPKLSGLCSLNFSVAQSIMSITATDCWASFAPYLANVVCCPQFDATLVILMGQSS  129

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K +  LALNAT + HCLSD   ILE++GAN TLQ ICS++P+
Sbjct  130  KNSGMLALNATHSNHCLSDVLTILEAQGANATLQSICSVSPA  171



>ref|XP_006389629.1| hypothetical protein POPTR_0021s00790g [Populus trichocarpa]
 gb|ERP48543.1| hypothetical protein POPTR_0021s00790g [Populus trichocarpa]
Length=440

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VPKLSG C LNF A  S++S TSIDC + FA  LANV+CCPQLE TL +LVGQ S
Sbjct  76   FTNSTVPKLSGQCTLNFTAAQSLMSTTSIDCWSVFAPLLANVICCPQLEATLAILVGQSS  135

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T++++CLSD ++IL  +GA   + +ICS++PS
Sbjct  136  KDTNALALNGTVSKYCLSDIEQILVGQGAAANVNKICSIHPS  177



>gb|EPS59099.1| hypothetical protein M569_15711, partial [Genlisea aurea]
Length=375

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N +VPKLSG C LNF AL  M+ +TSIDC A FA  LANV+CCPQ+E TLV L+GQ S
Sbjct  31   FENMTVPKLSGQCVLNFTALSDMMMVTSIDCMAAFAPLLANVVCCPQVEATLVALIGQSS  90

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN L+LN T A+ C SDF++IL  +GAND+L  ICS+  S
Sbjct  91   KSTNQLSLNRTHADLCFSDFEQILVGQGANDSLSTICSIRSS  132



>gb|KHG15461.1| hypothetical protein F383_19757 [Gossypium arboreum]
Length=471

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+ PKLSG C LNF A  S+IS+TSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  90   FTNSTSPKLSGLCMLNFTAAQSLISITSIDCWAAFAPLLANVICCPQLHATLVILVGQLS  149

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++L  +GA D L QICS++ S
Sbjct  150  KETGVLALNRTLAKPCLSDIEQVLAGQGAGDGLNQICSIHSS  191



>gb|KJB69288.1| hypothetical protein B456_011G014700 [Gossypium raimondii]
Length=371

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+ PKLSG C LNF A  S+IS+TSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  74   FTNSTSPKLSGLCMLNFTAAQSLISITSIDCWAAFAPLLANVICCPQLHATLVILVGQLS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++L  +GA D L Q+CS++ S
Sbjct  134  KETGVLALNRTLAKPCLSDIEQVLAGQGAGDGLNQVCSIHSS  175



>ref|XP_006447553.1| hypothetical protein CICLE_v10015544mg [Citrus clementina]
 gb|ESR60793.1| hypothetical protein CICLE_v10015544mg [Citrus clementina]
Length=389

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 83/111 (75%), Gaps = 9/111 (8%)
 Frame = +2

Query  293  FTNSSVPKLS---------GSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETT  445
             +NSS+PKLS         G C LNF+A  S +S T+ DC A FA YLANV+CCPQ + T
Sbjct  73   ISNSSLPKLSEGLILLYLSGLCTLNFSAAESFVSTTATDCWASFAPYLANVVCCPQFDAT  132

Query  446  LVVLVGQHSKYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            +V+L+GQ+SKY+  L+LN T A+HCLSDF+KILE++GAN  L++ICS++P+
Sbjct  133  MVILMGQYSKYSGMLSLNTTNAQHCLSDFEKILETQGANRNLKKICSIHPA  183



>ref|XP_006594428.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Glycine max]
Length=450

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+++PKLSG C LNF    S+IS+ +IDC   FA +LANV+CCPQLE TL +L+GQ S
Sbjct  67   FTNTTIPKLSGLCTLNFTTAESLISVAAIDCWEVFAPFLANVICCPQLEATLTILIGQSS  126

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K+TN LALN T A+HCL+D ++IL  +GA + L+QICS++ S
Sbjct  127  KHTNVLALNGTDAKHCLADVEQILMGQGATNNLKQICSIHSS  168



>gb|KJB69286.1| hypothetical protein B456_011G014700 [Gossypium raimondii]
Length=453

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+ PKLSG C LNF A  S+IS+TSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  74   FTNSTSPKLSGLCMLNFTAAQSLISITSIDCWAAFAPLLANVICCPQLHATLVILVGQLS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++L  +GA D L Q+CS++ S
Sbjct  134  KETGVLALNRTLAKPCLSDIEQVLAGQGAGDGLNQVCSIHSS  175



>gb|KHN37599.1| Putative GPI-anchored protein [Glycine soja]
Length=438

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+++PKLSG C LNF    S+IS+ +IDC   FA +LANV+CCPQLE TL +L+GQ S
Sbjct  59   FTNTTIPKLSGLCTLNFTTAESLISVAAIDCWEVFAPFLANVICCPQLEATLTILIGQSS  118

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K+TN LALN T A+HCL+D ++IL  +GA + L+QICS++ S
Sbjct  119  KHTNVLALNGTDAKHCLADVEQILMGQGATNNLKQICSIHSS  160



>gb|KJB69284.1| hypothetical protein B456_011G014700 [Gossypium raimondii]
Length=457

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+ PKLSG C LNF A  S+IS+TSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  74   FTNSTSPKLSGLCMLNFTAAQSLISITSIDCWAAFAPLLANVICCPQLHATLVILVGQLS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++L  +GA D L Q+CS++ S
Sbjct  134  KETGVLALNRTLAKPCLSDIEQVLAGQGAGDGLNQVCSIHSS  175



>gb|KJB69287.1| hypothetical protein B456_011G014700 [Gossypium raimondii]
Length=468

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+ PKLSG C LNF A  S+IS+TSIDC A FA  LANV+CCPQL  TLV+LVGQ S
Sbjct  74   FTNSTSPKLSGLCMLNFTAAQSLISITSIDCWAAFAPLLANVICCPQLHATLVILVGQLS  133

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN TLA+ CLSD +++L  +GA D L Q+CS++ S
Sbjct  134  KETGVLALNRTLAKPCLSDIEQVLAGQGAGDGLNQVCSIHSS  175



>ref|XP_007132551.1| hypothetical protein PHAVU_011G104100g [Phaseolus vulgaris]
 gb|ESW04545.1| hypothetical protein PHAVU_011G104100g [Phaseolus vulgaris]
Length=445

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVP LSG C LNF+A   +++ T+ DC A FA YLANV+CCPQ +  LV L+GQ S
Sbjct  64   FTNNSVPTLSGLCSLNFSAAQDIMTTTATDCWASFAPYLANVVCCPQFDAMLVTLIGQSS  123

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            KY+  LALNAT A  CLSD QK+L S+GAN+ L++ICS++P
Sbjct  124  KYSGVLALNATHASQCLSDVQKVLVSQGANENLKKICSVHP  164



>ref|XP_010930056.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X4 [Elaeis guineensis]
Length=376

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++S PKLSG C LNF+A+ S+IS T++DC + FA  LANV+CCPQ +  LV+L+GQ S
Sbjct  79   FFSNSTPKLSGRCTLNFSAVDSLISTTAVDCLSSFAPLLANVICCPQFQAMLVILIGQSS  138

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CL D+Q+ILESRGA+  L+QICS++P
Sbjct  139  KNTGMLALDSTQANYCLLDYQQILESRGASGNLEQICSIHP  179



>ref|XP_010930030.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
Length=462

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++S PKLSG C LNF+A+ S+IS T++DC + FA  LANV+CCPQ +  LV+L+GQ S
Sbjct  79   FFSNSTPKLSGRCTLNFSAVDSLISTTAVDCLSSFAPLLANVICCPQFQAMLVILIGQSS  138

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CL D+Q+ILESRGA+  L+QICS++P
Sbjct  139  KNTGMLALDSTQANYCLLDYQQILESRGASGNLEQICSIHP  179



>ref|XP_010930048.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Elaeis guineensis]
Length=446

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++S PKLSG C LNF+A+ S+IS T++DC + FA  LANV+CCPQ +  LV+L+GQ S
Sbjct  79   FFSNSTPKLSGRCTLNFSAVDSLISTTAVDCLSSFAPLLANVICCPQFQAMLVILIGQSS  138

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CL D+Q+ILESRGA+  L+QICS++P
Sbjct  139  KNTGMLALDSTQANYCLLDYQQILESRGASGNLEQICSIHP  179



>ref|XP_010930038.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Elaeis guineensis]
Length=458

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++S PKLSG C LNF+A+ S+IS T++DC + FA  LANV+CCPQ +  LV+L+GQ S
Sbjct  79   FFSNSTPKLSGRCTLNFSAVDSLISTTAVDCLSSFAPLLANVICCPQFQAMLVILIGQSS  138

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K T  LAL++T A +CL D+Q+ILESRGA+  L+QICS++P
Sbjct  139  KNTGMLALDSTQANYCLLDYQQILESRGASGNLEQICSIHP  179



>ref|XP_011047995.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Populus euphratica]
Length=525

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VPKLSG C LNF A  S++S  SIDC + FA  LANV+CCPQLE TL +LVGQ S
Sbjct  143  FTNSTVPKLSGQCTLNFTAAQSLMSTASIDCWSVFAPLLANVICCPQLEATLAILVGQSS  202

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T++++CLSD ++IL  +GA   +  ICS++PS
Sbjct  203  KDTNALALNGTVSKYCLSDIEQILAGQGAAANVNMICSIHPS  244



>ref|XP_011047994.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Populus euphratica]
Length=544

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNS+VPKLSG C LNF A  S++S  SIDC + FA  LANV+CCPQLE TL +LVGQ S
Sbjct  143  FTNSTVPKLSGQCTLNFTAAQSLMSTASIDCWSVFAPLLANVICCPQLEATLAILVGQSS  202

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K TN LALN T++++CLSD ++IL  +GA   +  ICS++PS
Sbjct  203  KDTNALALNGTVSKYCLSDIEQILAGQGAAANVNMICSIHPS  244



>dbj|BAK03275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF A+  +++ T++DC A FA +LANV+CCPQL+ TL +L+GQ S
Sbjct  78   FYNNSTPKLSGKCSLNFTAINGLMTTTAVDCFASFAPFLANVICCPQLQATLTILIGQSS  137

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ TLA +CLSD Q++L S+GA+D L  ICS++
Sbjct  138  KQTGSLALDPTLANYCLSDVQQLLMSQGASDDLHSICSVH  177



>gb|KDP20754.1| hypothetical protein JCGZ_21225 [Jatropha curcas]
Length=452

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTNSS+PKLSG C LNF A  S++S+T+IDC   FA  LANV+CCPQLE T+ +L+GQ S
Sbjct  69   FTNSSIPKLSGLCTLNFTAAESLMSITAIDCWGVFAPLLANVICCPQLEATVAILIGQSS  128

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K  N LALN T +++CLSD ++IL  +GA+  +++ICS++PS
Sbjct  129  KNNNVLALNGTASKYCLSDIEQILVGQGASVDVKRICSIHPS  170



>ref|XP_008348285.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized GPI-anchored 
protein At1g61900-like, partial [Malus domestica]
Length=299

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVP LSG C LNF+A  +M+++T+ DC A FA  LA+V+CCPQ + TL  L+G  S
Sbjct  70   FTNNSVPALSGLCTLNFSAAVNMMTITATDCWAFFAPLLADVVCCPQFDATLATLIGHSS  129

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K +  L+LNAT A+HCLSD +KILE +GAN+ +Q+ICS+ P
Sbjct  130  KSSGMLSLNATHAKHCLSDVEKILEGQGANENIQKICSIRP  170



>ref|XP_006858205.1| hypothetical protein AMTR_s00062p00176270 [Amborella trichopoda]
 gb|ERN19672.1| hypothetical protein AMTR_s00062p00176270 [Amborella trichopoda]
Length=424

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            +TN+SVP LSG CPLNF    S+ISMT+IDC A FA +LANV+CCPQ + TL VL+G +S
Sbjct  29   YTNNSVPVLSGLCPLNFTGGASIISMTAIDCWAFFAPFLANVICCPQYQATLHVLIGYYS  88

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            + T  LAL+   A +CLSD Q+ L S+GAN+ LQ ICS++PS
Sbjct  89   RDTGMLALDLKHANYCLSDVQQFLASQGANEDLQNICSIHPS  130



>gb|KEH29677.1| hypothetical protein MTR_4g048040 [Medicago truncatula]
Length=462

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVPKLSG C LNF+A   +++ T+ DC   FA YLANV+CCPQ +  LV L+GQ S
Sbjct  73   FTNNSVPKLSGLCSLNFSAAQHIMTQTATDCWTSFAPYLANVVCCPQFDAMLVTLIGQSS  132

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  LALN T A+HCLSD  K+L S+GA + L  ICS++ S
Sbjct  133  KYSGVLALNTTHAKHCLSDVHKVLVSQGATEDLNNICSIHSS  174



>ref|XP_008379634.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Malus domestica]
Length=441

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVP LSG C LNF+A  +M+++T+ DC A FA  LA+V+CCPQ + TL  L+G  S
Sbjct  70   FTNNSVPALSGLCTLNFSAAVNMMTITATDCWAFFAPLLADVVCCPQFDATLATLIGHSS  129

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K +  L+LNAT A+HCLSD +KILE +GAN+ +Q+ICS+ P
Sbjct  130  KSSGMLSLNATHAKHCLSDVEKILEGQGANENIQKICSIRP  170



>ref|XP_008379633.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Malus domestica]
Length=446

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVP LSG C LNF+A  +M+++T+ DC A FA  LA+V+CCPQ + TL  L+G  S
Sbjct  70   FTNNSVPALSGLCTLNFSAAVNMMTITATDCWAFFAPLLADVVCCPQFDATLATLIGHSS  129

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            K +  L+LNAT A+HCLSD +KILE +GAN+ +Q+ICS+ P
Sbjct  130  KSSGMLSLNATHAKHCLSDVEKILEGQGANENIQKICSIRP  170



>gb|KEH29676.1| hypothetical protein MTR_4g048040 [Medicago truncatula]
Length=454

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVPKLSG C LNF+A   +++ T+ DC   FA YLANV+CCPQ +  LV L+GQ S
Sbjct  73   FTNNSVPKLSGLCSLNFSAAQHIMTQTATDCWTSFAPYLANVVCCPQFDAMLVTLIGQSS  132

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  LALN T A+HCLSD  K+L S+GA + L  ICS++ S
Sbjct  133  KYSGVLALNTTHAKHCLSDVHKVLVSQGATEDLNNICSIHSS  174



>gb|AES88114.2| hypothetical protein MTR_4g048040 [Medicago truncatula]
Length=477

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVPKLSG C LNF+A   +++ T+ DC   FA YLANV+CCPQ +  LV L+GQ S
Sbjct  73   FTNNSVPKLSGLCSLNFSAAQHIMTQTATDCWTSFAPYLANVVCCPQFDAMLVTLIGQSS  132

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  LALN T A+HCLSD  K+L S+GA + L  ICS++ S
Sbjct  133  KYSGVLALNTTHAKHCLSDVHKVLVSQGATEDLNNICSIHSS  174



>ref|XP_006657387.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Oryza brachyantha]
Length=403

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N++ PKLSG+C LNF A+  +I+ T++DC A FA +LANV+CCPQL+  L +L+GQ S
Sbjct  25   FNNTTPPKLSGNCSLNFTAVNELITTTAVDCFASFAPFLANVICCPQLQAMLTILIGQSS  84

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L+ ICSL+
Sbjct  85   KQTGSLALDPTVANYCLSDVQQLLLSQGASDELRTICSLH  124



>ref|XP_009770909.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Nicotiana sylvestris]
Length=464

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FT + VPKLSG C  NF+A  +++   + DC    A YLANVMCCPQ + +LVVLVGQ S
Sbjct  79   FTYTGVPKLSGHCAFNFSAADTILRTAATDCWTSLAPYLANVMCCPQFDASLVVLVGQAS  138

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              + +LALNAT A HCLSD ++ILES+GA++ L +ICS++PS
Sbjct  139  IQSQSLALNATHARHCLSDVEQILESQGASEKLLEICSVDPS  180



>ref|XP_006366594.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Solanum tuberosum]
Length=456

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FT ++VPKLSG C  NF A  S++  T+ DC +  A YLANV+CCPQ + +LVVLVGQ S
Sbjct  71   FTYTNVPKLSGHCAFNFTAADSILRTTATDCWSTLAPYLANVVCCPQFDASLVVLVGQAS  130

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              + +LALN T A HCLSD ++ILES+GA++ L +ICS++PS
Sbjct  131  SQSQSLALNVTHARHCLSDVEQILESQGASEELLEICSVDPS  172



>ref|XP_003605917.1| GPI-anchored protein, putative [Medicago truncatula]
Length=626

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN+SVPKLSG C LNF+A   +++ T+ DC   FA YLANV+CCPQ +  LV L+GQ S
Sbjct  73   FTNNSVPKLSGLCSLNFSAAQHIMTQTATDCWTSFAPYLANVVCCPQFDAMLVTLIGQSS  132

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            KY+  LALN T A+HCLSD  K+L S+GA + L  ICS++ S
Sbjct  133  KYSGVLALNTTHAKHCLSDVHKVLVSQGATEDLNNICSIHSS  174



>gb|EEE66424.1| hypothetical protein OsJ_22777 [Oryza sativa Japonica Group]
Length=439

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N++ P LSG C LNF A+G +I+ T++DC A FA +LANV+CCPQL+  L +L+GQ S
Sbjct  62   FFNTTPPNLSGKCSLNFTAVGDLITTTAVDCFASFAPFLANVICCPQLQAMLTILIGQSS  121

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L  ICSL+
Sbjct  122  KQTGSLALDPTVATYCLSDVQQLLLSQGASDELHNICSLH  161



>ref|XP_002304912.2| hypothetical protein POPTR_0004s01590g [Populus trichocarpa]
 gb|EEE85423.2| hypothetical protein POPTR_0004s01590g [Populus trichocarpa]
Length=440

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN ++PKLSG C LNF A  S++  TS DC + FA  LANV+CCPQLE TL +L+GQ S
Sbjct  62   FTNITIPKLSGQCTLNFTAAQSLMRTTSTDCWSIFAPLLANVICCPQLEATLAILMGQSS  121

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T TLALN T+++HCLSD ++IL  +GA   + +ICS++ S
Sbjct  122  KDTRTLALNETVSKHCLSDIEQILAGQGAESNVNKICSIHLS  163



>dbj|BAD31837.1| unknown protein [Oryza sativa Japonica Group]
Length=437

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N++ P LSG C LNF A+G +I+ T++DC A FA +LANV+CCPQL+  L +L+GQ S
Sbjct  62   FFNTTPPNLSGKCSLNFTAVGDLITTTAVDCFASFAPFLANVICCPQLQAMLTILIGQSS  121

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L  ICSL+
Sbjct  122  KQTGSLALDPTVATYCLSDVQQLLLSQGASDELHNICSLH  161



>ref|NP_001058682.1| Os07g0102300 [Oryza sativa Japonica Group]
 dbj|BAF20596.1| Os07g0102300 [Oryza sativa Japonica Group]
 dbj|BAG95285.1| unnamed protein product [Oryza sativa Japonica Group]
Length=441

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N++ P LSG C LNF A+G +I+ T++DC A FA +LANV+CCPQL+  L +L+GQ S
Sbjct  62   FFNTTPPNLSGKCSLNFTAVGDLITTTAVDCFASFAPFLANVICCPQLQAMLTILIGQSS  121

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L  ICSL+
Sbjct  122  KQTGSLALDPTVATYCLSDVQQLLLSQGASDELHNICSLH  161



>ref|XP_010323825.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum lycopersicum]
Length=438

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FT + +PKLSG C  NF+A  S++  T+ DC +  A YLANV+CCPQ + +LVVLVGQ S
Sbjct  55   FTYTKMPKLSGHCAFNFSAADSILRTTATDCWSTLAPYLANVVCCPQFDASLVVLVGQAS  114

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              + +LALN T A HCLSD ++ILES+GA++ L +ICS++PS
Sbjct  115  SQSQSLALNVTHARHCLSDVKQILESQGASEELLEICSVDPS  156



>ref|XP_010323826.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum lycopersicum]
Length=437

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FT + +PKLSG C  NF+A  S++  T+ DC +  A YLANV+CCPQ + +LVVLVGQ S
Sbjct  55   FTYTKMPKLSGHCAFNFSAADSILRTTATDCWSTLAPYLANVVCCPQFDASLVVLVGQAS  114

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              + +LALN T A HCLSD ++ILES+GA++ L +ICS++PS
Sbjct  115  SQSQSLALNVTHARHCLSDVKQILESQGASEELLEICSVDPS  156



>gb|ACN25434.1| unknown [Zea mays]
 tpg|DAA59336.1| TPA: hypothetical protein ZEAMMB73_763936 [Zea mays]
Length=413

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF A+  +++ T++DC   FA +LANV+CCPQL+ TL +L+GQ S
Sbjct  86   FFNNSTPKLSGKCTLNFTAVDKLMTTTAVDCFTSFAPFLANVICCPQLQATLTILIGQSS  145

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L  +CS++
Sbjct  146  KQTGSLALDPTVANYCLSDVQELLLSQGASDNLHSLCSVH  185



>gb|EEC81371.1| hypothetical protein OsI_24575 [Oryza sativa Indica Group]
Length=497

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F +++ P LSG C LNF A+G +I+ T++DC A FA +LANV+CCPQL+  L +L+GQ S
Sbjct  62   FFHTTPPNLSGKCSLNFTAVGDLITTTAVDCFASFAPFLANVICCPQLQAMLTILIGQSS  121

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L  ICSL+
Sbjct  122  KQTGSLALDPTVATYCLSDVQQLLLSQGASDELHNICSLH  161



>ref|XP_004987275.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Setaria italica]
Length=464

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF A+  +++ T++DC   FA +LANV+CCPQL+ TL +L+GQ S
Sbjct  85   FFNNSTPKLSGKCTLNFTAVDKLMTTTAVDCFTSFAPFLANVICCPQLQATLTILIGQSS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L  +CS++
Sbjct  145  KQTGSLALDPTVANYCLSDVQELLLSQGASDNLHSLCSVH  184



>ref|NP_001143619.1| uncharacterized protein LOC100276335 precursor [Zea mays]
 gb|ACG33583.1| hypothetical protein [Zea mays]
Length=465

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF A+  +++ T++DC   FA +LANV+CCPQL+ TL +L+GQ S
Sbjct  86   FFNNSTPKLSGKCTLNFTAVDKLMTTTAVDCFTSFAPFLANVICCPQLQATLTILIGQSS  145

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L  +CS++
Sbjct  146  KQTGSLALDPTVANYCLSDVQELLLSQGASDNLHSLCSVH  185



>tpg|DAA59335.1| TPA: hypothetical protein ZEAMMB73_763936 [Zea mays]
Length=465

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF A+  +++ T++DC   FA +LANV+CCPQL+ TL +L+GQ S
Sbjct  86   FFNNSTPKLSGKCTLNFTAVDKLMTTTAVDCFTSFAPFLANVICCPQLQATLTILIGQSS  145

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L  +CS++
Sbjct  146  KQTGSLALDPTVANYCLSDVQELLLSQGASDNLHSLCSVH  185



>ref|XP_002461296.1| hypothetical protein SORBIDRAFT_02g000365 [Sorghum bicolor]
 gb|EER97817.1| hypothetical protein SORBIDRAFT_02g000365 [Sorghum bicolor]
Length=469

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+S PKLSG C LNF A+  +++ T++DC   FA +LANV+CCPQL+ TL +L+GQ S
Sbjct  90   FFNNSTPKLSGKCTLNFTAVDKLMTTTAVDCFTSFAPFLANVICCPQLQATLTILIGQSS  149

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T+A +CLSD Q++L S+GA+D L  +CS++
Sbjct  150  KQTGSLALDPTVANYCLSDVQELLLSQGASDNLHSLCSVH  189



>ref|XP_011037655.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Populus euphratica]
Length=458

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN ++PKLSG C LNF A  S++  TS DC + FA  LANV+CCPQLE TL +L+GQ S
Sbjct  76   FTNITIPKLSGKCTLNFTAAQSLMRTTSTDCWSIFAPLLANVICCPQLEATLAILMGQSS  135

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T TLALN T++++CLSD ++IL  +GA   + +ICS++ S
Sbjct  136  KDTRTLALNETVSKYCLSDIEQILAGQGAESNVNKICSIHLS  177



>ref|XP_011037654.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Populus euphratica]
Length=471

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FTN ++PKLSG C LNF A  S++  TS DC + FA  LANV+CCPQLE TL +L+GQ S
Sbjct  89   FTNITIPKLSGKCTLNFTAAQSLMRTTSTDCWSIFAPLLANVICCPQLEATLAILMGQSS  148

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T TLALN T++++CLSD ++IL  +GA   + +ICS++ S
Sbjct  149  KDTRTLALNETVSKYCLSDIEQILAGQGAESNVNKICSIHLS  190



>ref|XP_009397174.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=461

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++S PKLSG C LNF ++ S++S T++DC   FA +LANV+CCPQ + TL +L+GQ S
Sbjct  77   FFHNSTPKLSGRCTLNFTSVDSLMSTTAVDCWTSFAPFLANVICCPQFQATLTILIGQSS  136

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LAL +T +++CLSD Q+IL S+GA+  LQ+ICS++ S
Sbjct  137  KETGMLALGSTHSKYCLSDIQQILGSQGASSDLQEICSIHSS  178



>ref|XP_009397173.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=462

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++S PKLSG C LNF ++ S++S T++DC   FA +LANV+CCPQ + TL +L+GQ S
Sbjct  77   FFHNSTPKLSGRCTLNFTSVDSLMSTTAVDCWTSFAPFLANVICCPQFQATLTILIGQSS  136

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LAL +T +++CLSD Q+IL S+GA+  LQ+ICS++ S
Sbjct  137  KETGMLALGSTHSKYCLSDIQQILGSQGASSDLQEICSIHSS  178



>ref|XP_003557710.2| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Brachypodium 
distachyon]
Length=466

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N++ PKLSG C LNF+A+  +++ T++DC A FA  LANV+CCPQL+ T+ +L+GQ S
Sbjct  79   FYNNTTPKLSGKCSLNFSAIDGLMTTTAVDCFASFAPLLANVICCPQLQATITILMGQSS  138

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T +LAL+ T A +CLSD Q++L S+GA+D L  ICS++
Sbjct  139  KQTGSLALDPTAANYCLSDVQQLLLSQGASDNLHSICSVH  178



>ref|XP_009590299.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            FT + VPKLSG C  NF+A  S++  T+ +C +  A YLANV+CCPQ + +LVVLVGQ S
Sbjct  71   FTYTGVPKLSGHCAFNFSAADSILRTTATNCWSSLAPYLANVICCPQFDASLVVLVGQAS  130

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +  LALN T A HCLSD ++ILES+GA+  L +ICS++PS
Sbjct  131  IQSQRLALNLTHATHCLSDVEQILESQGASKKLLEICSVDPS  172



>ref|XP_006391949.1| hypothetical protein EUTSA_v10023466mg [Eutrema salsugineum]
 gb|ESQ29235.1| hypothetical protein EUTSA_v10023466mg [Eutrema salsugineum]
Length=433

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NSS+PKLSG C LNF A  S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  57   YINSSIPKLSGLCSLNFTASESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  116

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
            K T  LALN T ++HCLSD ++IL  +GA+  L +ICS++
Sbjct  117  KETGLLALNRTQSKHCLSDIEQILAGKGASSQLWRICSIH  156



>ref|XP_002886500.1| hypothetical protein ARALYDRAFT_475141 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62759.1| hypothetical protein ARALYDRAFT_475141 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF+A  S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  57   YINSTMPKLSGLCSLNFSASESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  116

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T ++HCLSD ++IL  +GA+  L +ICS++ S
Sbjct  117  KETGMLALNRTQSKHCLSDLEQILVGKGASGQLNKICSIHSS  158



>ref|XP_010546889.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Tarenaya 
hassleriana]
Length=432

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N + PKLSG C LNF+A  S+I  TS +C    A  LA+VMCCPQL+ TL +L+G+ S
Sbjct  53   FINRTTPKLSGLCSLNFSASESLIETTSYNCWLVLAPVLADVMCCPQLDATLAILLGESS  112

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K +  LALN T ++HCLSD +KIL +RGA++ L +ICS+  S
Sbjct  113  KESGLLALNGTQSKHCLSDLEKILVARGASNELMKICSVRAS  154



>gb|KJB67174.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
 gb|KJB67175.1| hypothetical protein B456_010G180100 [Gossypium raimondii]
Length=370

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  335  LNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTLALNATLAE  514
            LNF A  S+++MTS DC A FA  LANV+CCPQL  TLV+LVGQ SK T  LALN TLA+
Sbjct  2    LNFTASQSLMTMTSTDCWAAFAPLLANVICCPQLHATLVILVGQLSKETGVLALNRTLAK  61

Query  515  HCLSDFQKILESRGANDTLQQICSLNPS  598
             CLSD +++LE +GA+D L+Q+C ++PS
Sbjct  62   PCLSDIEQVLEGQGASDDLKQVCLIHPS  89



>ref|NP_974068.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33901.1| uncharacterized protein AT1G61900 [Arabidopsis thaliana]
Length=413

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF+A  S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  57   YINSTMPKLSGLCSLNFSASESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  116

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T ++HCLSD ++IL  +GA+  L +ICS++ S
Sbjct  117  KETGLLALNRTQSKHCLSDLEQILVGKGASGQLNKICSIHSS  158



>ref|NP_176382.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8GUI4.1|UGPI6_ARATH RecName: Full=Uncharacterized GPI-anchored protein At1g61900; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAO00850.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP31921.1| At1g61900 [Arabidopsis thaliana]
 dbj|BAF02087.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|AEE33900.1| uncharacterized protein AT1G61900 [Arabidopsis thaliana]
Length=433

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF+A  S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  57   YINSTMPKLSGLCSLNFSASESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  116

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T ++HCLSD ++IL  +GA+  L +ICS++ S
Sbjct  117  KETGLLALNRTQSKHCLSDLEQILVGKGASGQLNKICSIHSS  158



>gb|AAC28508.1| ESTs gb|AA728658 and gb|N95943 come from this gene [Arabidopsis 
thaliana]
Length=421

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF+A  S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  49   YINSTMPKLSGLCSLNFSASESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  108

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T ++HCLSD ++IL  +GA+  L +ICS++ S
Sbjct  109  KETGLLALNRTQSKHCLSDLEQILVGKGASGQLNKICSIHSS  150



>ref|NP_001185289.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE33902.1| uncharacterized protein AT1G61900 [Arabidopsis thaliana]
Length=429

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF+A  S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  57   YINSTMPKLSGLCSLNFSASESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  116

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T ++HCLSD ++IL  +GA+  L +ICS++ S
Sbjct  117  KETGLLALNRTQSKHCLSDLEQILVGKGASGQLNKICSIHSS  158



>emb|CDY47167.1| BnaA01g22930D [Brassica napus]
Length=431

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+++PKLSG C LNF A   +I  TS +C   FA  LANVMCCPQL+ TL + +G+ S
Sbjct  55   FINTTIPKLSGLCSLNFTASEGLIQTTSHNCWTVFAPLLANVMCCPQLDATLTITLGKAS  114

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
            K T  LALN T ++HC+SD +KIL ++GA+  L+ ICSL
Sbjct  115  KETGLLALNRTQSKHCVSDLEKILVAKGASSKLRSICSL  153



>ref|XP_009105804.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Brassica rapa]
Length=431

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+++PKLSG C LNF A   +I  TS +C   FA  LANVMCCPQL+ TL + +G+ S
Sbjct  55   FINTTIPKLSGLCSLNFTASEGLIQTTSHNCWTVFAPLLANVMCCPQLDATLTITLGKAS  114

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
            K T  LALN T ++HC+SD +KIL ++GA+  L+ ICSL
Sbjct  115  KETGLLALNRTQSKHCVSDLEKILVAKGASSKLRSICSL  153



>ref|XP_009105812.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Brassica rapa]
Length=429

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+++PKLSG C LNF A   +I  TS +C   FA  LANVMCCPQL+ TL + +G+ S
Sbjct  55   FINTTIPKLSGLCSLNFTASEGLIQTTSHNCWTVFAPLLANVMCCPQLDATLTITLGKAS  114

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
            K T  LALN T ++HC+SD +KIL ++GA+  L+ ICSL
Sbjct  115  KETGLLALNRTQSKHCVSDLEKILVAKGASSKLRSICSL  153



>emb|CDY25331.1| BnaC01g30000D [Brassica napus]
Length=432

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+++PKLSG C LNF A   +I  TS +C   FA  LANVMCCPQL+ TL + +G+ S
Sbjct  56   FINTTIPKLSGLCSLNFTASEGLIQTTSHNCWTVFAPLLANVMCCPQLDATLTITLGKAS  115

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
            K T  LALN T ++HC+SD +KIL  +GA+  L+ ICSL
Sbjct  116  KETGLLALNRTQSKHCVSDLEKILVGKGASSRLRSICSL  154



>emb|CDY19508.1| BnaC09g13950D [Brassica napus]
Length=430

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + N+++PKLSG C LNF A  S+I  TS +C   FA  LANVMCCPQL+  L +++G+ S
Sbjct  54   YINTTIPKLSGLCSLNFTASESLIQTTSHNCWTVFAPLLANVMCCPQLDAALTIILGKSS  113

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T ++HCLSD ++IL  +GA+  L  ICSL+ S
Sbjct  114  KQTGQLALNRTQSKHCLSDLEQILVGKGASSKLGSICSLHSS  155



>ref|XP_009113111.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Brassica 
rapa]
 emb|CDY12917.1| BnaA09g13570D [Brassica napus]
Length=430

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + N+++PKLSG C LNF A  S+I  TS +C   FA  LANVMCCPQL+  L +++G+ S
Sbjct  54   YINTTIPKLSGLCSLNFTASESLIQTTSHNCWTVFAPLLANVMCCPQLDAALTIILGKAS  113

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T ++HCLSD ++IL  +GA+  L  ICSL+ S
Sbjct  114  KETGQLALNRTQSKHCLSDLEQILVGKGASSKLGSICSLHSS  155



>ref|XP_006301249.1| hypothetical protein CARUB_v10021649mg [Capsella rubella]
 gb|EOA34147.1| hypothetical protein CARUB_v10021649mg [Capsella rubella]
Length=430

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF    S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  58   YINSTMPKLSGLCSLNFTDSESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  117

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T ++HC+SD ++IL  +GA+  L +ICS++ S
Sbjct  118  KETGLLALNRTQSKHCISDLEQILVGKGASTQLNKICSVHSS  159



>gb|KFK37988.1| hypothetical protein AALP_AA3G055500 [Arabis alpina]
Length=430

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF A  S+I  TS +C   FA  LANVMCCPQL+ +L +++G+ S
Sbjct  54   YINSTMPKLSGLCSLNFTASESLIQTTSHNCWTVFAPLLANVMCCPQLDASLTIILGKAS  113

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            + T  LALN T ++HCLSD ++IL  +GA+  + +ICS++ S
Sbjct  114  EETGLLALNRTQSKHCLSDLEQILVGKGASSQIGRICSIHSS  155



>ref|XP_010418167.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Camelina sativa]
Length=433

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF A  S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  59   YINSTMPKLSGLCSLNFTASESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  118

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T +++C+SD ++IL  +G +  L +ICS++ S
Sbjct  119  KETGLLALNRTQSKYCISDLEQILVGKGGSSQLNKICSVHSS  160



>ref|XP_010430217.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Camelina 
sativa]
Length=434

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF A  S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  58   YINSTMPKLSGLCSLNFTASESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  117

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T +++C+SD ++IL  +G +  L +ICS++ S
Sbjct  118  KETGLLALNRTQSKYCISDLEQILVGKGGSSQLNKICSVHSS  159



>ref|XP_010473411.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Camelina sativa]
Length=433

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + NS++PKLSG C LNF A  S+I  TS +C   FA  LANVMCCPQL+ TL +++G+ S
Sbjct  59   YINSTMPKLSGLCSLNFTASESLIQTTSHNCWTVFAPLLANVMCCPQLDATLTIILGKAS  118

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            K T  LALN T +++C+SD ++IL  +G +  L +ICS++ S
Sbjct  119  KETGLLALNRTQSKYCISDLEQILVGKGGSSQLNKICSVHSS  160



>gb|EMT03899.1| hypothetical protein F775_29914 [Aegilops tauschii]
Length=247

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 15/109 (14%)
 Frame = +2

Query  293  FTNSSVPKLSG---------------SCPLNFAALGSMISMTSIDCAAPFAKYLANVMCC  427
            F N+S PKLSG                C LNF A+  +++ T++DC A FA +LANV+CC
Sbjct  77   FYNNSTPKLSGPNSLHISISILSVSGKCSLNFTAINGLMTTTAVDCFASFAPFLANVICC  136

Query  428  PQLETTLVVLVGQHSKYTNTLALNATLAEHCLSDFQKILESRGANDTLQ  574
            PQL+ TL +L+GQ SK T +LAL+ TLA +CLSD Q++L S+G     Q
Sbjct  137  PQLQATLTILIGQSSKQTGSLALDPTLANYCLSDVQQLLMSQGRKRLRQ  185



>ref|XP_010672282.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Beta 
vulgaris subsp. vulgaris]
Length=475

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G CP+NF+A+  +I  T++DC+ P A ++ NV+CCPQ  + L +  G HS  ++ L
Sbjct  96   PLLTGKCPVNFSAISDVIERTALDCSQPLASFVGNVICCPQFASLLHIFQGYHSTISDRL  155

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
                 +A+ C SD   IL S+GAN ++ Q+CS+ PS
Sbjct  156  VFQDAVADDCFSDIISILASKGANSSIPQLCSVKPS  191



>ref|XP_010268250.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Nelumbo 
nucifera]
 ref|XP_010268252.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Nelumbo 
nucifera]
Length=467

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+A+ +++  T+ DCAAP A  + NV+CCPQL + L +  G ++
Sbjct  84   FPTTYEPVLTGRCPVNFSAISNVMDKTAHDCAAPLAALVGNVICCPQLSSLLHIFQGHYN  143

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +N L L   +A  C SD   IL SRGANDT+  +CS+  S
Sbjct  144  GSSNKLVLENAVANDCFSDIVSILASRGANDTIPALCSVKSS  185



>ref|XP_010930243.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Elaeis guineensis]
Length=454

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +NTL L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESNTLVLHQAAANDCFSDVMNILASRGANSTIPTLCSVKPS  186



>ref|XP_010930241.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010930242.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
Length=468

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +NTL L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESNTLVLHQAAANDCFSDVMNILASRGANSTIPTLCSVKPS  186



>ref|XP_002978387.1| hypothetical protein SELMODRAFT_108739 [Selaginella moellendorffii]
 gb|EFJ20373.1| hypothetical protein SELMODRAFT_108739 [Selaginella moellendorffii]
Length=379

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +2

Query  323  GSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTLALNA  502
            G C LNF+AL   I  T+ DC AP A Y+  V+CCPQL+T   +  G HS  +  L  N 
Sbjct  7    GHCKLNFSALTPAIDRTAQDCLAPLALYVGEVICCPQLQTLFRLAQGHHSNTSGRLTFNR  66

Query  503  TLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            T A +C SD   +L S+GAN T+ +ICSL P
Sbjct  67   TEASYCFSDISSLLVSKGANTTVSEICSLEP  97



>ref|XP_009383433.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
Length=461

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  +I  T+ DC+AP A  + NV+CCPQ+ + + +  G + 
Sbjct  79   FPSTYEPVLTGKCPVNFSSMSDIIDKTASDCSAPLAALVGNVICCPQVNSLMHIFQGAYG  138

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
              +N L LN   A +C SD   IL SRGAN T+  +CS+ 
Sbjct  139  SESNMLVLNQATATYCFSDLISILASRGANSTIPTLCSVK  178



>gb|KDO50752.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
 gb|KDO50753.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
Length=392

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+A+ S++  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  85   FPTTYEPNLTGRCPVNFSAMSSIMQKTASDCSQPLAPLVGNVICCPQLGSLLHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L L  T+A  C SD   IL SRGAN T+  +CS+
Sbjct  145  MKSDKLVLQNTVANDCFSDILSILASRGANHTIPTLCSV  183



>ref|XP_006442927.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
 gb|ESR56167.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
Length=392

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+A+ S++  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  85   FPTTYEPNLTGRCPVNFSAMSSIMQKTASDCSQPLAPLVGNVICCPQLGSLLHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L L  T+A  C SD   IL SRGAN T+  +CS+
Sbjct  145  MKSDKLVLQNTVANDCFSDILSILASRGANHTIPTLCSV  183



>ref|XP_011047725.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Populus 
euphratica]
 ref|XP_011047726.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Populus 
euphratica]
Length=469

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 61/99 (62%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF AL ++I  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  85   FPTTYKPNLTGKCPVNFTALSNIIDKTASDCSQPLAALVGNVICCPQLGSLLHIFQGHYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L L   +A+ C SD   IL SRGAN T+  +CS+
Sbjct  145  VNSDKLVLQNAVADDCFSDIISILASRGANKTIPTLCSV  183



>ref|XP_008788195.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008788196.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
Length=420

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++ +++  T+ DCA P A  + N +CCPQ+ + + + +G ++
Sbjct  37   FPDTYQPVLTGRCPMNFSSISNILDRTASDCAEPLAALIGNAICCPQVNSLMHIFLGAYN  96

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +N L L+   A+ C SD   IL SRGAN T+  +CS+  S
Sbjct  97   NVSNALVLHPAAADDCFSDITSILASRGANSTIPTLCSVKSS  138



>gb|KDP43911.1| hypothetical protein JCGZ_20921 [Jatropha curcas]
Length=471

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+A+ +++  T+ DC+ P A  + NV+CCPQL + L +  G ++
Sbjct  85   FPTTYEPNLTGKCPVNFSAMSNLMDKTASDCSVPLAALVGNVICCPQLGSLLHIFQGYYN  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L  ++A  C SD   ILESRGAN+T+  +CS+  S
Sbjct  145  INSDGLVLENSVASDCFSDIISILESRGANNTIPTLCSVKSS  186



>ref|XP_002309774.2| hypothetical protein POPTR_0007s01500g [Populus trichocarpa]
 gb|EEE90224.2| hypothetical protein POPTR_0007s01500g [Populus trichocarpa]
Length=437

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 61/99 (62%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF AL ++I  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  85   FPTTYKPNLTGKCPVNFTALSNIIDKTASDCSQPLAALVGNVICCPQLGSLLHIFQGYYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L L   +A+ C SD   IL SRGAN T+  +CS+
Sbjct  145  VNSDKLVLQNAVADDCFSDIISILASRGANKTIPTLCSV  183



>ref|XP_007223287.1| hypothetical protein PRUPE_ppa005555mg [Prunus persica]
 gb|EMJ24486.1| hypothetical protein PRUPE_ppa005555mg [Prunus persica]
Length=454

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 63/100 (63%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+A+ S++  T+ DC+ P A  + NV+CCPQ  + + +  G +S
Sbjct  85   FPTRYEPVLTGKCPVNFSAISSIMDKTASDCSLPLAAVVGNVICCPQFSSLIRIFQGLYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
              ++ LAL  ++A +C +D   IL SRGAN T+  +CS+N
Sbjct  145  FTSDKLALQNSVANNCFTDITNILASRGANSTIPTLCSIN  184



>ref|XP_008800397.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800406.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800412.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800419.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800427.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
 ref|XP_008800435.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Phoenix dactylifera]
Length=468

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  +  V+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPVLTGKCPVNFSSISDIVDKTASDCSAPLAALVGKVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++TL L+   A  C SD   IL SRGAN+T+  +CS+ PS
Sbjct  145  SESDTLVLHQAAANDCFSDVMSILASRGANNTIPTLCSVKPS  186



>ref|XP_008800391.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Phoenix dactylifera]
Length=469

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  +  V+CCPQ+ + + +    +S
Sbjct  86   FPSTYEPVLTGKCPVNFSSISDIVDKTASDCSAPLAALVGKVICCPQVNSLMHIFQATYS  145

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++TL L+   A  C SD   IL SRGAN+T+  +CS+ PS
Sbjct  146  SESDTLVLHQAAANDCFSDVMSILASRGANNTIPTLCSVKPS  187



>ref|XP_008788193.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Phoenix dactylifera]
Length=468

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++ +++  T+ DCA P A  + N +CCPQ+ + + + +G ++
Sbjct  85   FPDTYQPVLTGRCPMNFSSISNILDRTASDCAEPLAALIGNAICCPQVNSLMHIFLGAYN  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +N L L+   A+ C SD   IL SRGAN T+  +CS+  S
Sbjct  145  NVSNALVLHPAAADDCFSDITSILASRGANSTIPTLCSVKSS  186



>ref|XP_010909048.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Elaeis guineensis]
Length=468

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++ S+I  T+ DCA P A  + N +CCPQ+ + + + +G ++
Sbjct  85   FPDTYEPVLTGRCPVNFSSISSIIDRTASDCAEPLAALIGNAICCPQVNSLMHIFLGAYN  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +N L L+   A  C SD   IL SRGAN T+  +CS+  S
Sbjct  145  NVSNALVLHQAAANDCFSDIISILVSRGANSTIPTLCSVKSS  186



>gb|KDO50747.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
 gb|KDO50748.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
 gb|KDO50749.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
 gb|KDO50750.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
 gb|KDO50751.1| hypothetical protein CISIN_1g012117mg [Citrus sinensis]
Length=470

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+A+ S++  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  85   FPTTYEPNLTGRCPVNFSAMSSIMQKTASDCSQPLAPLVGNVICCPQLGSLLHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L L  T+A  C SD   IL SRGAN T+  +CS+
Sbjct  145  MKSDKLVLQNTVANDCFSDILSILASRGANHTIPTLCSV  183



>ref|XP_006442928.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
 ref|XP_006442929.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
 ref|XP_006478823.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Citrus sinensis]
 ref|XP_006478824.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Citrus sinensis]
 gb|ESR56168.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
 gb|ESR56169.1| hypothetical protein CICLE_v10020018mg [Citrus clementina]
Length=470

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+A+ S++  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  85   FPTTYEPNLTGRCPVNFSAMSSIMQKTASDCSQPLAPLVGNVICCPQLGSLLHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L L  T+A  C SD   IL SRGAN T+  +CS+
Sbjct  145  MKSDKLVLQNTVANDCFSDILSILASRGANHTIPTLCSV  183



>ref|XP_010907821.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X8 [Elaeis guineensis]
Length=451

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESDMLVLHQAAANDCFSDVMSILASRGANSTIPALCSVKPS  186



>ref|XP_010907822.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X9 [Elaeis guineensis]
Length=450

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESDMLVLHQAAANDCFSDVMSILASRGANSTIPALCSVKPS  186



>ref|XP_006478825.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Citrus sinensis]
Length=468

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+A+ S++  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  85   FPTTYEPNLTGRCPVNFSAMSSIMQKTASDCSQPLAPLVGNVICCPQLGSLLHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L L  T+A  C SD   IL SRGAN T+  +CS+
Sbjct  145  MKSDKLVLQNTVANDCFSDILSILASRGANHTIPTLCSV  183



>ref|XP_010907820.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X7 [Elaeis guineensis]
Length=463

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESDMLVLHQAAANDCFSDVMSILASRGANSTIPALCSVKPS  186



>ref|XP_010907818.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X6 [Elaeis guineensis]
Length=465

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESDMLVLHQAAANDCFSDVMSILASRGANSTIPALCSVKPS  186



>ref|XP_010907816.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X4 [Elaeis guineensis]
Length=468

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESDMLVLHQAAANDCFSDVMSILASRGANSTIPALCSVKPS  186



>ref|XP_010907817.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X5 [Elaeis guineensis]
Length=468

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESDMLVLHQAAANDCFSDVMSILASRGANSTIPALCSVKPS  186



>ref|XP_010907815.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Elaeis guineensis]
Length=468

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESDMLVLHQAAANDCFSDVMSILASRGANSTIPALCSVKPS  186



>ref|XP_002530300.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32067.1| conserved hypothetical protein [Ricinus communis]
Length=448

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 63/100 (63%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G+CP+NF+A+  ++  T+ DC+ P A  + NV+CCPQ  + L +  G +S
Sbjct  83   FPTTYEPNLTGNCPVNFSAMSDLMDKTASDCSLPLAALVGNVICCPQFSSLLHIFQGYYS  142

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
              ++ L L  ++A+ C SD   IL SRGAN T+ ++CS+ 
Sbjct  143  TNSDKLVLGNSVADDCFSDIISILASRGANSTIPKLCSVK  182



>ref|XP_010907814.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Elaeis guineensis]
Length=495

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESDMLVLHQAAANDCFSDVMSILASRGANSTIPALCSVKPS  186



>ref|XP_010907812.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010907813.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
Length=500

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +    +S
Sbjct  85   FPSTYEPILTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVICCPQVNSLMHIFQATYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L+   A  C SD   IL SRGAN T+  +CS+ PS
Sbjct  145  SESDMLVLHQAAANDCFSDVMSILASRGANSTIPALCSVKPS  186



>gb|AAC02741.2| hypothetical protein [Arabidopsis thaliana]
Length=474

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F A+ S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  93   FPDTYEPKLTGKCPTDFQAISSVIDTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHN  152

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +N L L   +A  C SD   IL SR AN T+  +CS+  S
Sbjct  153  VKSNKLVLPDAVATDCFSDIVSILVSRRANMTIPALCSVTSS  194



>ref|XP_010522039.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Tarenaya hassleriana]
Length=482

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N   P L+G CP NF+A+ +++  T+ DC+ PFA  + NV+CCPQ  + L + +GQH+
Sbjct  94   FPNMYEPNLTGKCPANFSAISTILDRTASDCSQPFAALVGNVVCCPQFASLLHIFLGQHN  153

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD  +IL SR AN ++  +CS+  S
Sbjct  154  VKSDKLVLPDAVAADCFSDVIRILVSRRANMSIPSLCSVTSS  195



>ref|XP_002970227.1| hypothetical protein SELMODRAFT_33447, partial [Selaginella moellendorffii]
 gb|EFJ28357.1| hypothetical protein SELMODRAFT_33447, partial [Selaginella moellendorffii]
Length=324

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +2

Query  323  GSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTLALNA  502
            G C LNF+AL   I  T+ DC AP A Y+  V+CCPQL+T   +  G H   +  L  N 
Sbjct  1    GHCKLNFSALTPAIDRTAQDCLAPLALYVGEVICCPQLQTLFRLAQGHHINTSGRLTFNR  60

Query  503  TLAEHCLSDFQKILESRGANDTLQQICSLNP  595
            T A +C SD   +L S+GAN T+ +ICS+ P
Sbjct  61   TEASYCFSDISSLLVSKGANTTVSEICSMEP  91



>ref|XP_010522037.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522038.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Tarenaya hassleriana]
Length=483

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N   P L+G CP NF+A+ +++  T+ DC+ PFA  + NV+CCPQ  + L + +GQH+
Sbjct  94   FPNMYEPNLTGKCPANFSAISTILDRTASDCSQPFAALVGNVVCCPQFASLLHIFLGQHN  153

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD  +IL SR AN ++  +CS+  S
Sbjct  154  VKSDKLVLPDAVAADCFSDVIRILVSRRANMSIPSLCSVTSS  195



>ref|NP_850153.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM13145.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43553.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08430.1| uncharacterized protein AT2G30700 [Arabidopsis thaliana]
Length=480

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F A+ S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  93   FPDTYEPKLTGKCPTDFQAISSVIDTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHN  152

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +N L L   +A  C SD   IL SR AN T+  +CS+  S
Sbjct  153  VKSNKLVLPDAVATDCFSDIVSILVSRRANMTIPALCSVTSS  194



>ref|XP_008245348.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Prunus mume]
Length=470

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+A+ S++  T+ DC+ P A  + NV+CCPQ  + + +  G +S
Sbjct  85   FPTRYEPVLTGKCPVNFSAISSIMDKTASDCSLPLAAVVGNVICCPQFSSLIRIFQGLYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
              ++ LAL  ++A  C +D   IL SRGAN T+  +CS+N
Sbjct  145  FSSDKLALQNSVANDCFTDIINILASRGANSTIPTLCSIN  184



>ref|XP_008245345.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Prunus mume]
 ref|XP_008245347.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Prunus mume]
Length=471

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 62/100 (62%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+A+ S++  T+ DC+ P A  + NV+CCPQ  + + +  G +S
Sbjct  85   FPTRYEPVLTGKCPVNFSAISSIMDKTASDCSLPLAAVVGNVICCPQFSSLIRIFQGLYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
              ++ LAL  ++A  C +D   IL SRGAN T+  +CS+N
Sbjct  145  FSSDKLALQNSVANDCFTDIINILASRGANSTIPTLCSIN  184



>ref|XP_002273850.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Vitis 
vinifera]
Length=470

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G CP+NF+A+ S+++ T+ DC+ P A  + NV+CCPQ  + L +  G +S  ++ L
Sbjct  91   PVLTGKCPVNFSAISSILNKTASDCSLPLASLVGNVICCPQFSSLLHIFQGYYSTNSDKL  150

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             L   +A  C SD   IL SRGAN T+  ICS+  S
Sbjct  151  VLQDGMANDCFSDIISILASRGANSTIPTICSVKSS  186



>emb|CAN82818.1| hypothetical protein VITISV_030074 [Vitis vinifera]
Length=467

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+A+ S+++ T+ DC+ P A  + NV+CCPQ  + L +  G +S
Sbjct  125  FPATYEPVLTGKCPVNFSAISSILNKTASDCSLPLASLVGNVICCPQFSSLLHIFQGYYS  184

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  ICS+  S
Sbjct  185  TNSDKLVLQDGMANDCFSDIISILASRGANSTIPTICSVKSS  226



>ref|XP_010542709.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Tarenaya hassleriana]
Length=469

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+  P L+G CP +F+A+ S++  T+ DC+ PFA  + NV+CCPQ  + L + +GQH+
Sbjct  80   FPNTYEPNLTGRCPADFSAISSIMDRTASDCSQPFAALVGNVICCPQFASLLHIFLGQHN  139

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +  L L   +A  C SD   IL SR AN ++  +CS+  S
Sbjct  140  AKSEKLVLPDAVASDCFSDVISILVSRRANMSIPSLCSVTSS  181



>ref|XP_010542708.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Tarenaya hassleriana]
Length=475

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F N+  P L+G CP +F+A+ S++  T+ DC+ PFA  + NV+CCPQ  + L + +GQH+
Sbjct  86   FPNTYEPNLTGRCPADFSAISSIMDRTASDCSQPFAALVGNVICCPQFASLLHIFLGQHN  145

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +  L L   +A  C SD   IL SR AN ++  +CS+  S
Sbjct  146  AKSEKLVLPDAVASDCFSDVISILVSRRANMSIPSLCSVTSS  187



>ref|XP_006410172.1| hypothetical protein EUTSA_v10016766mg [Eutrema salsugineum]
 gb|ESQ51625.1| hypothetical protein EUTSA_v10016766mg [Eutrema salsugineum]
Length=392

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F A+ S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  5    FPDTYEPKLTGKCPADFQAISSVIDTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHN  64

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SR AN T+  +CS+  S
Sbjct  65   VKSDKLVLPDAVATDCFSDIVSILVSRRANMTIPALCSVTSS  106



>ref|XP_008791793.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Phoenix dactylifera]
 ref|XP_008791794.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Phoenix dactylifera]
 ref|XP_008791795.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Phoenix dactylifera]
 ref|XP_008791796.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Phoenix dactylifera]
Length=468

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F +   P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +  G +S
Sbjct  85   FPSPYEPVLTGKCPVNFSSISDIVDKTASDCSAPLAALVGNVVCCPQVNSLMHIFQGTYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++TL L+   A  C SD   IL SRGAN T+  +CS+  S
Sbjct  145  SGSDTLVLHQATANDCFSDVISILASRGANSTIPTLCSVKSS  186



>ref|XP_002881126.1| hypothetical protein ARALYDRAFT_481988 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57385.1| hypothetical protein ARALYDRAFT_481988 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F A+ S+    + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  93   FPDTYEPKLTGKCPTDFQAISSVFDTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHN  152

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A +C SD   IL SR AN T+  +CS+  S
Sbjct  153  VESDKLVLPDAVATYCFSDIVSILVSRRANRTIPALCSVKSS  194



>ref|XP_010469811.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Camelina 
sativa]
Length=466

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G+CP +F A+ S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  80   FPDTYEPKLTGNCPTDFQAISSVIDTAASDCSQPFAALVGNVICCPQFISLLHIFQGQHN  139

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SR AN T+  +CS+  S
Sbjct  140  VKSDKLVLPDAVATDCFSDIVSILVSRRANMTIPALCSVRSS  181



>ref|XP_007033843.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY04769.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=449

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+AL +++  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  85   FPRTYEPNLTGRCPVNFSALSNIMGKTASDCSLPLAALVGNVICCPQLGSLLHIFQGYYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  +C++  S
Sbjct  145  INSDMLVLRNAVANDCFSDIISILASRGANSTIPTVCTVKSS  186



>ref|XP_010510299.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Camelina sativa]
Length=466

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G+CP +F A+ S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  80   FPDTYEPKLTGNCPTDFQAISSVIDTAASDCSQPFAALVGNVICCPQFISLLHIFQGQHN  139

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SR AN T+  +CS+  S
Sbjct  140  VKSDKLVLPDAVATDCFSDIVSILVSRRANMTIPALCSVRSS  181



>ref|XP_009356791.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Pyrus x bretschneideri]
Length=473

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+ + S+I  T+ DC  P A  L NVMCCPQ  + + +  G +S
Sbjct  88   FPTRYEPVLTGKCPVNFSTISSVIEKTATDCFQPLAAILGNVMCCPQFSSLIRIFQGLYS  147

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L  ++A  C  D   IL SRGAN ++  +CS+N S
Sbjct  148  INSDKLVLQNSVANDCFKDIISILASRGANSSVPTLCSINSS  189



>ref|XP_010510301.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Camelina sativa]
Length=480

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G+CP +F A+ S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  94   FPDTYEPKLTGNCPTDFQAISSVIDTAASDCSQPFAALVGNVICCPQFISLLHIFQGQHN  153

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SR AN T+  +CS+  S
Sbjct  154  VKSDKLVLPDAVATDCFSDIVSILVSRRANMTIPALCSVRSS  195



>ref|XP_010912783.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Elaeis guineensis]
Length=460

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +  G + 
Sbjct  85   FPSTYEPVLTGKCPVNFSSISDVVDKTASDCSAPLAALVGNVVCCPQVNSLMHIFQGTYG  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++TL L+   A  C SD   IL SRGAN T+  +CS+  S
Sbjct  145  SGSDTLVLHQATANDCFSDVISILASRGANSTIPTLCSVKSS  186



>ref|XP_007033842.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY04768.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=470

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+AL +++  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  85   FPRTYEPNLTGRCPVNFSALSNIMGKTASDCSLPLAALVGNVICCPQLGSLLHIFQGYYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  +C++  S
Sbjct  145  INSDMLVLRNAVANDCFSDIISILASRGANSTIPTVCTVKSS  186



>ref|XP_007033841.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY04767.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=509

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+AL +++  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  124  FPRTYEPNLTGRCPVNFSALSNIMGKTASDCSLPLAALVGNVICCPQLGSLLHIFQGYYS  183

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  +C++  S
Sbjct  184  INSDMLVLRNAVANDCFSDIISILASRGANSTIPTVCTVKSS  225



>ref|XP_010912782.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Elaeis guineensis]
Length=466

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +  G + 
Sbjct  85   FPSTYEPVLTGKCPVNFSSISDVVDKTASDCSAPLAALVGNVVCCPQVNSLMHIFQGTYG  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++TL L+   A  C SD   IL SRGAN T+  +CS+  S
Sbjct  145  SGSDTLVLHQATANDCFSDVISILASRGANSTIPTLCSVKSS  186



>ref|XP_007033840.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY04766.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=505

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+AL +++  T+ DC+ P A  + NV+CCPQL + L +  G +S
Sbjct  120  FPRTYEPNLTGRCPVNFSALSNIMGKTASDCSLPLAALVGNVICCPQLGSLLHIFQGYYS  179

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  +C++  S
Sbjct  180  INSDMLVLRNAVANDCFSDIISILASRGANSTIPTVCTVKSS  221



>ref|XP_010414232.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Camelina sativa]
Length=466

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G+CP +F A+ S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  80   FPDTYEPKLTGNCPTDFQAISSVIDTAASDCSQPFAALVGNVICCPQFISLLHIFQGQHN  139

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SR AN T+  +CS+  S
Sbjct  140  VKSDKLVLPDAVATDCFSDIVSILVSRRANMTIPALCSVTSS  181



>ref|XP_010912780.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010912781.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Elaeis guineensis]
Length=468

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF+++  ++  T+ DC+AP A  + NV+CCPQ+ + + +  G + 
Sbjct  85   FPSTYEPVLTGKCPVNFSSISDVVDKTASDCSAPLAALVGNVVCCPQVNSLMHIFQGTYG  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++TL L+   A  C SD   IL SRGAN T+  +CS+  S
Sbjct  145  SGSDTLVLHQATANDCFSDVISILASRGANSTIPTLCSVKSS  186



>gb|KEH16340.1| transmembrane protein, putative [Medicago truncatula]
Length=475

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFA--ALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQ  466
            F +   P L+G CP+NF+   +  ++  T+ DCA P A  + NV+CCPQ  + + ++ G 
Sbjct  90   FPSRYEPVLTGKCPVNFSLPEISEILDRTAFDCAVPLASLVGNVICCPQFSSLIHIVQGL  149

Query  467  HSKYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              + +N L L  T+A+HC SD   IL SRGAN +L  +CS+  S
Sbjct  150  FGRKSNNLVLPNTVADHCFSDVISILASRGANSSLSTLCSIKSS  193



>gb|KEH16341.1| transmembrane protein, putative [Medicago truncatula]
Length=479

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFA--ALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQ  466
            F +   P L+G CP+NF+   +  ++  T+ DCA P A  + NV+CCPQ  + + ++ G 
Sbjct  90   FPSRYEPVLTGKCPVNFSLPEISEILDRTAFDCAVPLASLVGNVICCPQFSSLIHIVQGL  149

Query  467  HSKYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              + +N L L  T+A+HC SD   IL SRGAN +L  +CS+  S
Sbjct  150  FGRKSNNLVLPNTVADHCFSDVISILASRGANSSLSTLCSIKSS  193



>ref|XP_006372774.1| hypothetical protein POPTR_0017s04930g [Populus trichocarpa]
 gb|ERP50571.1| hypothetical protein POPTR_0017s04930g [Populus trichocarpa]
Length=472

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (61%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF A+ ++I  T+ DC+ P A  + NV+CCPQL + L +  G  S
Sbjct  85   FPTTYEPNLTGKCPVNFTAMSNVIDRTASDCSQPLAALVGNVICCPQLGSLLHIFQGYFS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L L   +A+ C SD   IL SRGAN T+  +CS+
Sbjct  145  GNSDKLVLQNAVADDCFSDIISILASRGANITIPTLCSV  183



>emb|CDP03434.1| unnamed protein product [Coffea canephora]
Length=471

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G CP+NF+A+ S+   T+ DC+ P A  + NV+CCPQL + L +  G +SK ++ L
Sbjct  92   PVLTGRCPVNFSAISSITQKTASDCSQPLAAIVGNVICCPQLGSLLHIFQGFYSKNSSNL  151

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICS  586
             L   +A+ C  D   IL SRGAN +L  ICS
Sbjct  152  VLQDAVADDCFKDIISILASRGANSSLPVICS  183



>ref|XP_001774402.1| predicted protein [Physcomitrella patens]
 gb|EDQ60765.1| predicted protein, partial [Physcomitrella patens]
Length=340

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +2

Query  320  SGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTLALN  499
            +G CP +F+ L   +  T+ DC AP A Y+ +V+CCPQLE+   V +GQ+S  +  L LN
Sbjct  1    TGFCPFDFSTLEGTLIRTAGDCPAPLALYVGSVICCPQLESLFQVSLGQYSLDSGNLGLN  60

Query  500  ATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             T AE+C SD Q ++ S GAN +L  +C+  P+
Sbjct  61   VTEAEYCFSDTQNLMASLGANTSLGDLCAAQPA  93



>ref|XP_010094091.1| hypothetical protein L484_018108 [Morus notabilis]
 gb|EXB55181.1| hypothetical protein L484_018108 [Morus notabilis]
Length=464

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+A+ S++  T+ DC+ P A  + NV+CCPQL + + +  G HS
Sbjct  81   FPTRYDPVLTGKCPVNFSAISSIMDKTASDCSQPLAALVGNVICCPQLNSLVHIFQGFHS  140

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +  L    + A  C  D   ILESRGAN T+  +CS+  S
Sbjct  141  ITSGKLVFQNSSANDCFKDIISILESRGANGTIPMLCSVKSS  182



>gb|KFK31261.1| hypothetical protein AALP_AA6G089400 [Arabis alpina]
Length=468

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F A+ S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  80   FPDTYEPKLTGKCPADFQAISSVIDTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHN  139

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L    A  C SD   IL SR AN T+  +CS++ S
Sbjct  140  VKSDKLVLPDADATDCFSDIVSILVSRRANMTIPALCSVSSS  181



>ref|XP_009413428.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413429.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413430.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413431.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413432.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Musa acuminata subsp. malaccensis]
Length=461

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  P L+G CP+NF++L  +   T+ DC+AP A  + NV+CCPQ+ + + +  G +S
Sbjct  79   FPSTYEPVLTGRCPVNFSSLSDIFDKTASDCSAPLAALVGNVICCPQVNSLMHIFQGVYS  138

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L    A +C SD   IL SRGAN T+  +C +  S
Sbjct  139  SESDMLVLQQATANYCFSDLINILASRGANSTIPTLCPVKSS  180



>ref|XP_011043593.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Populus euphratica]
Length=469

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF A+ ++I  T+ DC+ P A  + NV+CCPQL + L +  G  S
Sbjct  85   FPTTYEPNLTGKCPVNFTAMSNVIDRTASDCSQPLAALVGNVICCPQLGSLLHIFQGYFS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L +   +A+ C SD   IL SRGAN T+  +CS+
Sbjct  145  GNSDKLVVQNAVADDCFSDIISILASRGANITIPTLCSV  183



>ref|XP_006294136.1| hypothetical protein CARUB_v10023131mg [Capsella rubella]
 gb|EOA27034.1| hypothetical protein CARUB_v10023131mg [Capsella rubella]
Length=467

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F  + S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  80   FPDTYKPKLTGKCPTDFQEISSVIDTAASDCSQPFAALVGNVICCPQFISLLHIFQGQHN  139

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SR AN T+  +CS+  S
Sbjct  140  MKSDKLVLPDAVATDCFSDIVSILVSRRANMTIPALCSVTSS  181



>ref|XP_006294137.1| hypothetical protein CARUB_v10023131mg [Capsella rubella]
 gb|EOA27035.1| hypothetical protein CARUB_v10023131mg [Capsella rubella]
Length=472

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F  + S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  86   FPDTYKPKLTGKCPTDFQEISSVIDTAASDCSQPFAALVGNVICCPQFISLLHIFQGQHN  145

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SR AN T+  +CS+  S
Sbjct  146  MKSDKLVLPDAVATDCFSDIVSILVSRRANMTIPALCSVTSS  187



>gb|KHN11705.1| Putative GPI-anchored protein [Glycine soja]
Length=473

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALG--SMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQ  466
            F     P L+G CP+NF+  G  S++  T+ DC+ P A  + NV+CCPQL + + +  G 
Sbjct  88   FPTRYEPVLTGKCPVNFSHSGISSILDKTASDCSGPLAALVGNVICCPQLSSLIHIFQGY  147

Query  467  HSKYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             S  ++ L L   +A+HC SD   IL SRGAN T+ ++CS+  S
Sbjct  148  FSMKSDHLVLPNAVADHCFSDIISILASRGANSTIPRLCSIKSS  191



>ref|XP_006587693.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Glycine max]
Length=477

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALG--SMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQ  466
            F     P L+G CP+NF+  G  S++  T+ DC+ P A  + NV+CCPQL + + +  G 
Sbjct  88   FPTRYEPVLTGKCPVNFSHSGISSILDKTASDCSGPLAALVGNVICCPQLSSLIHIFQGY  147

Query  467  HSKYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             S  ++ L L   +A+HC SD   IL SRGAN T+ ++CS+  S
Sbjct  148  FSMKSDHLVLPNAVADHCFSDIISILASRGANSTIPRLCSIKSS  191



>ref|XP_006858875.1| hypothetical protein AMTR_s00066p00196830 [Amborella trichopoda]
 gb|ERN20342.1| hypothetical protein AMTR_s00066p00196830 [Amborella trichopoda]
Length=489

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP++F+ +  ++  T+ DC AP A  + NV+CCPQ+ + L +  G +S
Sbjct  101  FPATYQPVLTGRCPVSFSLIDGILDKTASDCIAPLASLVGNVICCPQVYSLLHIFQGVYS  160

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              + +L LN   A  C SD   IL SRGAN+TL  +CS++ S
Sbjct  161  MESGSLVLNNATANDCFSDIMSILSSRGANNTLPLLCSVSSS  202



>emb|CDY68454.1| BnaCnng59080D, partial [Brassica napus]
Length=314

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G C  +F A+ S+I+  + DC+ PFA  + NV+CCPQ  + L +  GQH 
Sbjct  87   FPDTYEPKLTGKCTADFQAISSIINTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHD  146

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              +  L L   +A  C SD   IL S+ AN T+ ++CS+  S
Sbjct  147  VKSEKLVLPDAVAADCFSDIVSILVSKRANMTIPELCSVTSS  188



>gb|EPS68793.1| hypothetical protein M569_05967, partial [Genlisea aurea]
Length=440

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 61/98 (62%), Gaps = 0/98 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            + N+  P L+G CP+NF+A+ S+I  T+ DC  P A+ + NV+CCPQ  + L +  G +S
Sbjct  72   YPNTYNPVLTGRCPVNFSAVSSIIERTASDCDQPLAEVVGNVICCPQFHSLLHIFQGFYS  131

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICS  586
              ++ L L  + A+ C  D   IL SRGA++++  IC+
Sbjct  132  SDSDKLVLQISDADDCFQDIISILSSRGASNSIPAICT  169



>ref|XP_007212309.1| hypothetical protein PRUPE_ppa006724mg [Prunus persica]
 gb|EMJ13508.1| hypothetical protein PRUPE_ppa006724mg [Prunus persica]
Length=398

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+ + S++  T+ DC+ P A  + NV+CCPQ  + + +  G  S
Sbjct  88   FPTRYEPVLTGKCPVNFSTISSVMEKTASDCSQPLAALVGNVICCPQFSSLIRIFRGLDS  147

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
               + L L  ++A  C +D   IL SRGAN T+  +CS+N S
Sbjct  148  FKPDKLVLQNSVANDCFTDIISILVSRGANSTIATLCSINSS  189



>ref|XP_008226610.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Prunus mume]
Length=472

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+ + S++  T+ DC+ P A  + NV+CCPQ  + + +  G  S
Sbjct  87   FPTRYEPVLTGKCPVNFSTISSVMEKTASDCSQPLAALVGNVICCPQFSSLIRIFPGLDS  146

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
               + L L  ++A  C +D   IL SRGAN T+  +CS+N S
Sbjct  147  FKPDKLVLQNSVANDCFTDIISILASRGANSTIATLCSINSS  188



>gb|EEE51310.1| hypothetical protein OsJ_32270 [Oryza sativa Japonica Group]
Length=441

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL  M+  T+ DC+ P A  +A+V+CCPQ+ + + +    +    NTL
Sbjct  86   PVLTGKCHVNFSALSYMMDKTASDCSIPLAPLVADVICCPQVNSLMNIFQATYGAGNNTL  145

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             LN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  146  VLNQASANACFSDVMSILASKGANTNIPELCTLRPS  181



>ref|XP_008226609.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Prunus mume]
Length=473

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+ + S++  T+ DC+ P A  + NV+CCPQ  + + +  G  S
Sbjct  87   FPTRYEPVLTGKCPVNFSTISSVMEKTASDCSQPLAALVGNVICCPQFSSLIRIFPGLDS  146

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
               + L L  ++A  C +D   IL SRGAN T+  +CS+N S
Sbjct  147  FKPDKLVLQNSVANDCFTDIISILASRGANSTIATLCSINSS  188



>gb|AAM88643.1| hypothetical protein [Oryza sativa Japonica Group]
Length=459

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL  M+  T+ DC+ P A  +A+V+CCPQ+ + + +    +    NTL
Sbjct  86   PVLTGKCHVNFSALSYMMDKTASDCSIPLAPLVADVICCPQVNSLMNIFQATYGAGNNTL  145

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             LN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  146  VLNQASANACFSDVMSILASKGANTNIPELCTLRPS  181



>gb|EEC67358.1| hypothetical protein OsI_34458 [Oryza sativa Indica Group]
Length=468

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL  M+  T+ DC+ P A  +A+V+CCPQ+ + + +    +    NTL
Sbjct  86   PVLTGKCHVNFSALSYMMDKTASDCSIPLAPLVADVICCPQVNSLMNIFQATYGAGNNTL  145

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             LN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  146  VLNQASANACFSDVMSILASKGANTNIPELCTLRPS  181



>gb|ABB47927.2| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG92746.1| unnamed protein product [Oryza sativa Japonica Group]
Length=455

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL  M+  T+ DC+ P A  +A+V+CCPQ+ + + +    +    NTL
Sbjct  95   PVLTGKCHVNFSALSYMMDKTASDCSIPLAPLVADVICCPQVNSLMNIFQATYGAGNNTL  154

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             LN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  155  VLNQASANACFSDVMSILASKGANTNIPELCTLRPS  190



>ref|XP_009141092.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Brassica rapa]
Length=470

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G C  +F A+ S+I+  + DC+ PFA  + NV+CCPQ  + L +  GQH 
Sbjct  81   FPDTYEPKLTGKCTADFQAISSIINTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHD  140

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL S+ AN T+ ++CS+  S
Sbjct  141  VKSDKLVLPDAVAADCFSDIVSILVSKRANMTIPELCSVTSS  182



>gb|ABB47928.2| expressed protein [Oryza sativa Japonica Group]
Length=472

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL  M+  T+ DC+ P A  +A+V+CCPQ+ + + +    +    NTL
Sbjct  95   PVLTGKCHVNFSALSYMMDKTASDCSIPLAPLVADVICCPQVNSLMNIFQATYGAGNNTL  154

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             LN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  155  VLNQASANACFSDVMSILASKGANTNIPELCTLRPS  190



>ref|NP_001065159.1| Os10g0534100 [Oryza sativa Japonica Group]
 gb|ABB47926.2| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27073.1| Os10g0534100 [Oryza sativa Japonica Group]
Length=473

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL  M+  T+ DC+ P A  +A+V+CCPQ+ + + +    +    NTL
Sbjct  95   PVLTGKCHVNFSALSYMMDKTASDCSIPLAPLVADVICCPQVNSLMNIFQATYGAGNNTL  154

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             LN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  155  VLNQASANACFSDVMSILASKGANTNIPELCTLRPS  190



>ref|XP_009141091.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Brassica rapa]
 emb|CDY29650.1| BnaA04g17770D [Brassica napus]
Length=476

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G C  +F A+ S+I+  + DC+ PFA  + NV+CCPQ  + L +  GQH 
Sbjct  87   FPDTYEPKLTGKCTADFQAISSIINTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHD  146

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL S+ AN T+ ++CS+  S
Sbjct  147  VKSDKLVLPDAVAADCFSDIVSILVSKRANMTIPELCSVTSS  188



>ref|XP_008386190.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Malus 
domestica]
Length=474

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+ + S++  T+ DC  P A  + NV+CCPQ  + + +  G +S
Sbjct  88   FPTRYEPVLTGKCPVNFSTISSLMDKTATDCFQPLAAIVGNVICCPQFSSLIRIFQGLYS  147

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L  ++A  C  D   IL SRGAN ++  +CS+N S
Sbjct  148  FNSDKLVLQNSVANDCFKDIISILASRGANSSVPTLCSINSS  189



>ref|XP_006356959.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Solanum tuberosum]
Length=469

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+ + S+ + T+ DC    +  + NV+CCPQ  + L +  G +S
Sbjct  85   FPKTYDPVLTGRCPVNFSVISSITAKTASDCTQSLSTVVGNVICCPQFNSLLHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             +++TL L   +A+ C  D   IL SRGAN++L  +CS+  S
Sbjct  145  NHSDTLVLQNAVADDCFKDIISILASRGANNSLSSMCSVKSS  186



>ref|XP_004983825.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Setaria italica]
 ref|XP_004983826.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Setaria italica]
Length=464

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL   I  T+ DC+ P A  +A+V+CCPQ+ + + +    +    +TL
Sbjct  86   PVLTGKCHVNFSALSYTIDKTASDCSIPLAPLVADVICCPQVNSLMNIFQAAYGSGNDTL  145

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            ALN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  146  ALNQASANACFSDIMSILASKGANTNIPELCTLRPS  181



>ref|XP_006356958.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Solanum tuberosum]
Length=470

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+ + S+ + T+ DC    +  + NV+CCPQ  + L +  G +S
Sbjct  85   FPKTYDPVLTGRCPVNFSVISSITAKTASDCTQSLSTVVGNVICCPQFNSLLHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             +++TL L   +A+ C  D   IL SRGAN++L  +CS+  S
Sbjct  145  NHSDTLVLQNAVADDCFKDIISILASRGANNSLSSMCSVKSS  186



>ref|XP_006661998.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X1 [Oryza brachyantha]
Length=472

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL  ++  T+ DC+ P A  +A+V+CCPQ+ + + +    +    NTL
Sbjct  94   PVLTGKCHVNFSALSYIMDKTAFDCSIPLAPLVADVICCPQVNSLMNIFQAAYGAGNNTL  153

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             LN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  154  VLNQASANACFSDVMSILASKGANTNIPELCTLRPS  189



>ref|XP_006661999.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X2 [Oryza brachyantha]
Length=471

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL  ++  T+ DC+ P A  +A+V+CCPQ+ + + +    +    NTL
Sbjct  94   PVLTGKCHVNFSALSYIMDKTAFDCSIPLAPLVADVICCPQVNSLMNIFQAAYGAGNNTL  153

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             LN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  154  VLNQASANACFSDVMSILASKGANTNIPELCTLRPS  189



>ref|XP_004156974.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
Length=475

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+ + +++  T+ DC+ P A  + NV+CCPQL + L +  G + 
Sbjct  88   FPTRYDPVLTGRCPVNFSVISNVMDKTASDCSQPMAALVGNVICCPQLSSLLHIFQGFYG  147

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  +CS+  S
Sbjct  148  LSSDQLVLQEAVANDCFSDIISILASRGANQTIPSLCSVKSS  189



>emb|CDY23986.1| BnaC03g17050D [Brassica napus]
Length=460

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F A+ S+I   + DC+ PFA  + NV+CCPQ  + L +  GQH 
Sbjct  80   FPDTYQPKLTGKCPADFQAISSVIDTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHK  139

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSL  589
              ++ L L   +A  C SD   IL S+ AN T+ ++CS+
Sbjct  140  --SDKLVLPDAVAADCFSDIVSILVSKRANMTIPELCSV  176



>ref|XP_004983827.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
isoform X3 [Setaria italica]
Length=463

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL   I  T+ DC+ P A  +A+V+CCPQ+ + + +    +    +TL
Sbjct  86   PVLTGKCHVNFSALSYTIDKTASDCSIPLAPLVADVICCPQVNSLMNIFQAAYGSGNDTL  145

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
            ALN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  146  ALNQASANACFSDIMSILASKGANTNIPELCTLRPS  181



>ref|XP_004152141.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Cucumis sativus]
 gb|KGN52997.1| hypothetical protein Csa_4G010960 [Cucumis sativus]
Length=474

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+ + +++  T+ DC+ P A  + NV+CCPQL + L +  G + 
Sbjct  88   FPTRYDPVLTGRCPVNFSVISNVMDKTASDCSQPMAALVGNVICCPQLSSLLHIFQGFYG  147

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  +CS+  S
Sbjct  148  LSSDQLVLQEAVANDCFSDIISILASRGANQTIPSLCSVKSS  189



>ref|XP_009132748.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900-like 
[Brassica rapa]
Length=463

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F A+ ++I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  80   FPDTYQPKLTGKCPADFQAISAVIDTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHN  139

Query  473  -KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             K +  L +  ++A  C SD   IL S+ AN T+ ++CS+  S
Sbjct  140  LKKSEKLVVPDSVAADCFSDLVSILVSKRANMTIPELCSVTSS  182



>ref|XP_011091606.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 [Sesamum 
indicum]
Length=470

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G CP+NF+A+ S++  T+ DC  P A  + NV+CCPQ  + L +  G +S  ++ L
Sbjct  91   PVLTGRCPVNFSAISSIMEKTASDCNQPLAAIVGNVICCPQFSSLLHIFQGFYSTSSDNL  150

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             L    A+ C  D   IL SRGAN ++  ICS   S
Sbjct  151  VLQNAAADDCFKDIVSILASRGANSSIPTICSTKSS  186



>gb|EYU41043.1| hypothetical protein MIMGU_mgv1a005775mg [Erythranthe guttata]
Length=470

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G CP+NF+A+ S++  T+ DC  P A  + NV+CCPQ  + L +  G +S  ++ L
Sbjct  91   PVLTGRCPVNFSAVSSIMERTASDCNQPLAAVVGNVICCPQFSSLLRIFQGLYSTGSDNL  150

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICS  586
             L    A+ C  D   IL SRGAN ++  ICS
Sbjct  151  VLQTAHADDCFKDIVSILASRGANSSIPFICS  182



>gb|KCW87645.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=388

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P LSG CP+NF+AL  ++S T+ DCA P A  + N +CCPQ  + + +  G +S
Sbjct  85   FPATYEPVLSGKCPVNFSALSDILSKTASDCAQPMAMLVGNAICCPQFSSLVHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
              ++ L +   +A  C SD   IL S+GAN T+  IC++ 
Sbjct  145  ISSDKLVVPNAVANDCFSDIMSILISKGANATIPSICTIK  184



>gb|EYU41042.1| hypothetical protein MIMGU_mgv1a005775mg [Erythranthe guttata]
Length=471

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G CP+NF+A+ S++  T+ DC  P A  + NV+CCPQ  + L +  G +S  ++ L
Sbjct  91   PVLTGRCPVNFSAVSSIMERTASDCNQPLAAVVGNVICCPQFSSLLRIFQGLYSTGSDNL  150

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICS  586
             L    A+ C  D   IL SRGAN ++  ICS
Sbjct  151  VLQTAHADDCFKDIVSILASRGANSSIPFICS  182



>ref|XP_002465025.1| hypothetical protein SORBIDRAFT_01g030650 [Sorghum bicolor]
 gb|EER92023.1| hypothetical protein SORBIDRAFT_01g030650 [Sorghum bicolor]
Length=463

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +2

Query  311  PKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHSKYTNTL  490
            P L+G C +NF+AL  ++  T+ DC+ P A  +A+V+CCPQ+ + + +    +    NTL
Sbjct  86   PVLTGKCHVNFSALSYVMEKTAYDCSIPLAPLVADVICCPQVNSLMNIFQAAYGSGNNTL  145

Query  491  ALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             LN   A  C SD   IL S+GAN  + ++C+L PS
Sbjct  146  VLNQASANACFSDIVNILASKGANTNIPELCTLRPS  181



>gb|KCW87643.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=437

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P LSG CP+NF+AL  ++S T+ DCA P A  + N +CCPQ  + + +  G +S
Sbjct  85   FPATYEPVLSGKCPVNFSALSDILSKTASDCAQPMAMLVGNAICCPQFSSLVHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
              ++ L +   +A  C SD   IL S+GAN T+  IC++ 
Sbjct  145  ISSDKLVVPNAVANDCFSDIMSILISKGANATIPSICTIK  184



>ref|XP_008454095.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X1 [Cucumis melo]
Length=475

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+ + + +  T+ DC+ P A  + NV+CCPQL + L +  G + 
Sbjct  88   FPTRYDPVLTGRCPVNFSVISNAMDKTASDCSQPMAALVGNVICCPQLSSLLHIFQGFYG  147

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  +CS+  S
Sbjct  148  LTSDRLVLQEAVANDCFSDIISILASRGANQTIPSLCSVKSS  189



>ref|XP_008454096.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X2 [Cucumis melo]
Length=474

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F     P L+G CP+NF+ + + +  T+ DC+ P A  + NV+CCPQL + L +  G + 
Sbjct  88   FPTRYDPVLTGRCPVNFSVISNAMDKTASDCSQPMAALVGNVICCPQLSSLLHIFQGFYG  147

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  +CS+  S
Sbjct  148  LTSDRLVLQEAVANDCFSDIISILASRGANQTIPSLCSVKSS  189



>gb|KCW87641.1| hypothetical protein EUGRSUZ_A00037 [Eucalyptus grandis]
Length=456

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P LSG CP+NF+AL  ++S T+ DCA P A  + N +CCPQ  + + +  G +S
Sbjct  85   FPATYEPVLSGKCPVNFSALSDILSKTASDCAQPMAMLVGNAICCPQFSSLVHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
              ++ L +   +A  C SD   IL S+GAN T+  IC++ 
Sbjct  145  ISSDKLVVPNAVANDCFSDIMSILISKGANATIPSICTIK  184



>emb|CDX84821.1| BnaA03g14090D [Brassica napus]
Length=659

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F ++  PKL+G CP +F A+ ++I   + DC+ PFA  + NV+CCPQ  + L +  GQH+
Sbjct  80   FPDTYQPKLTGKCPTDFQAISAVIDTAASDCSQPFAALVGNVICCPQFVSLLHIFQGQHN  139

Query  473  -KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
             K +  L +  ++A  C SD   IL S+ AN T+ ++CS+  S
Sbjct  140  LKKSEKLVVPDSVAADCFSDLVSILVSKRANMTIPELCSVTSS  182



>ref|XP_010069980.1| PREDICTED: uncharacterized GPI-anchored protein At1g61900 isoform 
X6 [Eucalyptus grandis]
Length=470

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P LSG CP+NF+AL  ++S T+ DCA P A  + N +CCPQ  + + +  G +S
Sbjct  85   FPATYEPVLSGKCPVNFSALSDILSKTASDCAQPMAMLVGNAICCPQFSSLVHIFQGFYS  144

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLN  592
              ++ L +   +A  C SD   IL S+GAN T+  IC++ 
Sbjct  145  ISSDKLVVPNAVANDCFSDIMSILISKGANATIPSICTIK  184



>gb|KJB37983.1| hypothetical protein B456_006G230000 [Gossypium raimondii]
Length=389

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 1/102 (1%)
 Frame = +2

Query  293  FTNSSVPKLSGSCPLNFAALGSMISMTSIDCAAPFAKYLANVMCCPQLETTLVVLVGQHS  472
            F  +  P L+G CP+NF+A+ +++  T+ DC+ P A  + NV+CCPQL + L +  G + 
Sbjct  5    FPTTYEPNLTGRCPVNFSAISNIMGKTASDCSLPLAALVGNVICCPQLGSLLHIFQG-YG  63

Query  473  KYTNTLALNATLAEHCLSDFQKILESRGANDTLQQICSLNPS  598
              ++ L L   +A  C SD   IL SRGAN T+  +CS+  S
Sbjct  64   IDSDKLVLGNAVANDCFSDVISILASRGANKTIPTVCSVKSS  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510