BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006L04

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     199   1e-80   Nicotiana sylvestris
ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     192   1e-78   Nicotiana tomentosiformis
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     187   2e-77   Nicotiana sylvestris
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     186   3e-77   Nicotiana tomentosiformis
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    186   7e-77   Solanum tuberosum [potatoes]
ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          186   8e-77   Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     185   2e-76   Solanum tuberosum [potatoes]
emb|CDP13326.1|  unnamed protein product                                175   2e-73   Coffea canephora [robusta coffee]
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          176   2e-73   Vitis vinifera
gb|KHG25400.1|  Proteasome subunit beta type-5                          174   9e-73   Gossypium arboreum [tree cotton]
gb|KJB15718.1|  hypothetical protein B456_002G192400                    174   1e-72   Gossypium raimondii
gb|KJB78067.1|  hypothetical protein B456_012G175200                    174   2e-72   Gossypium raimondii
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     172   2e-72   Sesamum indicum [beniseed]
gb|KHG05622.1|  Proteasome subunit beta type-5                          173   2e-72   Gossypium arboreum [tree cotton]
gb|KDP26783.1|  hypothetical protein JCGZ_17941                         172   3e-72   Jatropha curcas
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          172   4e-72   
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          172   5e-72   Pyrus x bretschneideri [bai li]
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5-like     170   1e-71   Cucumis sativus [cucumbers]
ref|XP_007045045.1|  N-terminal nucleophile aminohydrolases (Ntn ...    171   1e-71   
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    170   1e-71   
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          170   2e-71   Prunus mume [ume]
gb|EPS61043.1|  hypothetical protein M569_13757                         169   2e-71   Genlisea aurea
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          171   4e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          169   4e-71   Cucumis melo [Oriental melon]
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             168   5e-71   Prunus persica
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    170   6e-71   Spinacia oleracea
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             167   2e-70   Eutrema salsugineum [saltwater cress]
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        166   3e-70   Eucalyptus grandis [rose gum]
gb|KCW61971.1|  hypothetical protein EUGRSUZ_H04655                     166   4e-70   Eucalyptus grandis [rose gum]
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     165   5e-70   
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     164   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_010105786.1|  Proteasome subunit beta type-5                     164   1e-69   Morus notabilis
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    165   1e-69   Tarenaya hassleriana [spider flower]
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                162   2e-69   Erythranthe guttata [common monkey flower]
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             164   2e-69   Capsella rubella
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        164   2e-69   Camelina sativa [gold-of-pleasure]
ref|NP_189265.1|  proteasome subunit beta type-5-B                      164   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002312631.2|  20S proteasome beta subunit family protein         162   3e-69   
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    162   3e-69   Populus euphratica
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          162   4e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    163   4e-69   Camelina sativa [gold-of-pleasure]
emb|CDY26610.1|  BnaA09g46670D                                          162   7e-69   Brassica napus [oilseed rape]
emb|CDX98014.1|  BnaA06g07650D                                          162   8e-69   
emb|CDY21081.1|  BnaA08g24440D                                          162   8e-69   Brassica napus [oilseed rape]
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    162   8e-69   Brassica rapa
emb|CDY34594.1|  BnaC03g56940D                                          162   8e-69   Brassica napus [oilseed rape]
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        162   8e-69   Tarenaya hassleriana [spider flower]
emb|CDY16054.1|  BnaC08g40690D                                          162   9e-69   Brassica napus [oilseed rape]
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        162   9e-69   Brassica rapa
emb|CDY19402.1|  BnaC05g09110D                                          161   2e-68   Brassica napus [oilseed rape]
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             160   2e-68   Eutrema salsugineum [saltwater cress]
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    160   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     157   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             160   4e-68   
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     160   5e-68   Nelumbo nucifera [Indian lotus]
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     157   6e-68   Phoenix dactylifera
ref|XP_006842100.1|  hypothetical protein AMTR_s00078p00083100          159   6e-68   
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     156   2e-67   Glycine max [soybeans]
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     155   3e-67   Elaeis guineensis
gb|ABK25888.1|  unknown                                                 156   4e-67   Picea sitchensis
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             155   5e-67   Phaseolus vulgaris [French bean]
gb|KHN31904.1|  Proteasome subunit beta type-5                          155   6e-67   Glycine soja [wild soybean]
gb|ACU23791.1|  unknown                                                 154   8e-67   Glycine max [soybeans]
gb|ACP43315.1|  20S proteasome beta subunit 5                           154   8e-67   Citrus maxima [buntan]
gb|KDO81953.1|  hypothetical protein CISIN_1g022125mg                   155   1e-66   Citrus sinensis [apfelsine]
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    154   1e-66   Citrus sinensis [apfelsine]
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg             154   1e-66   
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     158   1e-66   Cucumis sativus [cucumbers]
ref|XP_002315619.1|  20S proteasome beta subunit family protein         154   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    154   1e-66   Camelina sativa [gold-of-pleasure]
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       158   1e-66   Cucumis sativus [cucumbers]
gb|ABK25785.1|  unknown                                                 154   2e-66   Picea sitchensis
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    154   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     152   2e-66   Phoenix dactylifera
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             153   2e-66   Citrus clementina [clementine]
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    154   2e-66   Brassica rapa
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        154   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    153   3e-66   Populus euphratica
gb|AFK46055.1|  unknown                                                 153   3e-66   Lotus japonicus
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             153   3e-66   Capsella rubella
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    152   4e-66   Glycine max [soybeans]
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             153   5e-66   
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     154   6e-66   Elaeis guineensis
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     151   7e-66   Fragaria vesca subsp. vesca
ref|NP_172765.1|  20S proteasome beta subunit E1                        152   7e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602092.1|  Proteasome subunit beta type                       150   9e-66   Medicago truncatula
gb|AAK92808.1|  putative proteasome epsilon chain precursor             151   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34329.1|  unknown                                                 149   3e-65   Medicago truncatula
gb|AFK38197.1|  unknown                                                 150   5e-65   Medicago truncatula
gb|ACJ85344.1|  unknown                                                 151   5e-65   Medicago truncatula
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative         150   7e-65   
gb|KDO81951.1|  hypothetical protein CISIN_1g022125mg                   157   4e-64   Citrus sinensis [apfelsine]
ref|XP_006484069.1|  PREDICTED: proteasome subunit beta type-5-B-...    156   7e-64   Citrus sinensis [apfelsine]
ref|XP_006438070.1|  hypothetical protein CICLE_v10032238mg             155   1e-63   
ref|NP_001184978.1|  20S proteasome beta subunit E1                     138   8e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     146   2e-60   Phoenix dactylifera
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     147   2e-60   Elaeis guineensis
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    131   2e-60   Oryza brachyantha
ref|XP_010440898.1|  PREDICTED: proteasome subunit beta type-5-B-...    145   1e-59   
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    128   4e-59   
ref|XP_001759925.1|  predicted protein                                  137   5e-59   
gb|ACU51028.1|  20S proteasome beta5 subunit                            138   5e-59   Conocephalum conicum
ref|NP_001132821.1|  uncharacterized protein LOC100194311               128   6e-59   Zea mays [maize]
gb|AFW85805.1|  hypothetical protein ZEAMMB73_646691                    128   7e-59   
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    129   1e-58   Setaria italica
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       127   2e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          127   2e-58   Sorghum bicolor [broomcorn]
gb|EEE65108.1|  hypothetical protein OsJ_20167                          127   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056842.1|  Os06g0153800                                       127   3e-58   
gb|EEC80034.1|  hypothetical protein OsI_21721                          127   3e-58   Oryza sativa Indica Group [Indian rice]
gb|AAT44125.1|  20S proteasome beta subunit E                           161   5e-57   Saussurea medusa
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    124   8e-56   Brachypodium distachyon [annual false brome]
gb|AAU82107.1|  20S proteasome beta 5 subunit                           124   1e-55   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             125   4e-55   Selaginella moellendorffii
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             125   4e-55   Selaginella moellendorffii
dbj|BAJ97061.1|  predicted protein                                      124   5e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        124   3e-54   
gb|AAT80906.1|  26S proteasome beta subunit                             120   6e-52   Lemna minor
dbj|BAG92607.1|  unnamed protein product                                127   3e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751936.1|  predicted protein                                  115   3e-51   
gb|EMS57921.1|  Proteasome subunit beta type-5                          124   1e-49   Triticum urartu
ref|XP_003061052.1|  predicted protein                                  115   2e-48   Micromonas pusilla CCMP1545
ref|NP_001265983.1|  proteasome subunit beta type-5-like                125   2e-48   Cicer arietinum [garbanzo]
ref|XP_002506817.1|  predicted protein                                  110   3e-48   Micromonas commoda
ref|XP_001421201.1|  predicted protein                                  117   4e-48   Ostreococcus lucimarinus CCE9901
ref|XP_007514496.1|  predicted protein                                  116   7e-48   Bathycoccus prasinos
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5         116   4e-47   Coccomyxa subellipsoidea C-169
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...    113   4e-47   Ostreococcus tauri
gb|ABD61730.2|  26S proteasome beta subunit                             118   5e-47   Lupinus albus
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983              109   5e-47   Chlorella variabilis
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5         109   8e-46   Chlamydomonas reinhardtii
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437              108   2e-45   Volvox carteri f. nagariensis
gb|ABQ50544.1|  hypothetical protein                                    154   4e-43   Brassica rapa
gb|KDD75121.1|  proteasome subunit protein                              102   1e-42   Helicosporidium sp. ATCC 50920
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        125   2e-40   Prunus persica
emb|CBY21147.1|  unnamed protein product                              98.6    3e-40   Oikopleura dioica
gb|EIE77859.1|  proteasome component PRE2                             98.6    5e-40   Rhizopus delemar RA 99-880
emb|CEP17612.1|  hypothetical protein                                 95.5    1e-39   Parasitella parasitica
ref|XP_002889983.1|  hypothetical protein ARALYDRAFT_888660             111   1e-39   
dbj|GAN10935.1|  20S proteasome subunit                               95.1    1e-39   Mucor ambiguus
gb|EPB87271.1|  proteasome component PRE2                             95.1    1e-39   Mucor circinelloides f. circinelloides 1006PhL
gb|ABE68720.1|  20S proteasome beta subunit                             125   2e-39   Arachis hypogaea [goober]
ref|XP_002678668.1|  predicted protein                                95.1    3e-39   Naegleria gruberi strain NEG-M
emb|CEG76257.1|  Putative Proteasome subunit beta type                98.6    7e-39   Rhizopus microsporus
emb|CEG76258.1|  Putative Proteasome subunit beta type                98.6    9e-39   Rhizopus microsporus
ref|XP_005537552.1|  20S core proteasome subunit beta 5               97.1    9e-39   Cyanidioschyzon merolae strain 10D
ref|XP_001730616.1|  hypothetical protein MGL_2412                    95.9    3e-38   Malassezia globosa CBS 7966
emb|CEJ04297.1|  Putative Proteasome subunit beta type                98.6    3e-38   Rhizopus microsporus
gb|KFH71396.1|  20S proteasome subunit beta 5                         93.6    3e-38   Mortierella verticillata NRRL 6337
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                96.7    4e-38   Capitella teleta
emb|CDH56820.1|  20s proteasome subunit                               94.7    4e-38   Lichtheimia corymbifera JMRC:FSU:9682
gb|EJU05281.1|  proteasome-domain-containing protein                  94.0    5e-38   Dacryopinax primogenitus
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223           97.4    1e-37   Lottia gigantea
ref|XP_006957104.1|  20S proteasome subunit                           93.2    1e-37   Wallemia mellicola CBS 633.66
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5        93.6    1e-37   Otolemur garnettii
ref|XP_008036606.1|  proteasome component pts1                        92.4    2e-37   Trametes versicolor FP-101664 SS1
gb|KDQ60928.1|  hypothetical protein JAAARDRAFT_125152                93.2    2e-37   Jaapia argillacea MUCL 33604
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510            92.4    2e-37   Batrachochytrium dendrobatidis JAM81
ref|XP_009265754.1|  Proteasome component PRE2                        93.6    2e-37   Wallemia ichthyophaga EXF-994
gb|ACP43316.1|  20S proteasome beta subunit 5                           125   2e-37   Citrus maxima [buntan]
emb|CCO27714.1|  20S proteasome subunit beta 5                        95.1    3e-37   Rhizoctonia solani AG-1 IB
ref|XP_003332961.2|  20S proteasome subunit beta 5                    95.5    3e-37   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5        93.2    3e-37   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5        93.6    3e-37   Dasypus novemcinctus
ref|XP_007006996.1|  hypothetical protein TREMEDRAFT_34309            92.8    3e-37   Tremella mesenterica DSM 1558
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371              100   3e-37   Helobdella robusta
emb|CCF49354.1|  probable PRE2-20S core proteasome subunit (beta5)    94.4    4e-37   Ustilago hordei
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5        93.6    4e-37   Tupaia chinensis
ref|XP_007395513.1|  hypothetical protein PHACADRAFT_255622           93.2    4e-37   Phanerochaete carnosa HHB-10118-sp
gb|EUC61688.1|  proteasome subunit beta type-5 protein                95.1    4e-37   Rhizoctonia solani AG-3 Rhs1AP
gb|KEP54479.1|  proteasome subunit beta type-5 protein                94.7    4e-37   Rhizoctonia solani 123E
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like   93.6    4e-37   Haplochromis burtoni
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    5e-37   Physeter catodon
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like   93.2    5e-37   Pundamilia nyererei
emb|CCU99044.1|  unnamed protein product                              94.7    5e-37   Malassezia sympodialis ATCC 42132
ref|XP_007863011.1|  20S proteasome subunit                           92.4    5e-37   Gloeophyllum trabeum ATCC 11539
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5        93.2    5e-37   Carlito syrichta
emb|CBN74512.1|  conserved unknown protein                            93.6    5e-37   Ectocarpus siliculosus
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like   93.2    5e-37   Oreochromis niloticus
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5        93.6    5e-37   Ovis aries [domestic sheep]
gb|KDE05583.1|  proteasome component PRE2                             93.6    6e-37   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    6e-37   Condylura cristata
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like   93.2    6e-37   
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like   94.4    6e-37   Myotis brandtii
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    6e-37   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...  94.0    6e-37   
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5        93.6    6e-37   Saimiri boliviensis boliviensis
emb|CCM00020.1|  predicted protein                                    92.4    6e-37   Fibroporia radiculosa
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5        93.2    6e-37   Peromyscus maniculatus bairdii
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...  93.2    6e-37   Pantholops hodgsonii [Tibetan antelope]
dbj|BAA06097.1|  proteasome subunit X                                 94.0    6e-37   Homo sapiens [man]
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    6e-37   Lipotes vexillifer [baiji]
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    6e-37   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...  94.0    7e-37   synthetic construct
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    7e-37   Orcinus orca [Orca]
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    7e-37   
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5        93.6    7e-37   Cricetulus griseus [Chinese hamsters]
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5        93.6    7e-37   Myotis davidii
gb|KIY65291.1|  proteasome-domain-containing protein                  93.2    7e-37   Cylindrobasidium torrendii FP15055 ss-10
gb|ELU16739.1|  hypothetical protein CAPTEDRAFT_41193                 96.7    7e-37   Capitella teleta
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5        93.6    8e-37   Ochotona princeps [southern American pika]
ref|XP_007418509.1|  20S proteasome subunit                           94.0    8e-37   Melampsora larici-populina 98AG31
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5        94.0    8e-37   
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5        93.2    8e-37   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009242876.1|  PREDICTED: proteasome subunit beta type-5-like   93.2    8e-37   Pongo abelii [orang utan]
ref|XP_005139397.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...  93.2    9e-37   
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5        93.6    9e-37   Equus przewalskii [Przewalski horse]
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...  93.6    9e-37   
emb|CAA66313.1|  LMP7-like protein                                    91.3    1e-36   Botryllus schlosseri
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5        93.6    1e-36   Callithrix jacchus [common marmoset]
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5        93.6    1e-36   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    1e-36   Mustela putorius furo [black ferret]
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5        94.0    1e-36   Ursus maritimus [white bear]
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    1e-36   Eptesicus fuscus
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like   92.8    1e-36   Neolamprologus brichardi [lyretail cichlid]
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5        93.6    1e-36   Myotis lucifugus
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5        93.2    1e-36   Canis lupus familiaris [dogs]
ref|NP_001099197.2|  proteasome subunit beta type-5                   93.6    1e-36   Rattus norvegicus [brown rat]
gb|ELR56586.1|  Proteasome subunit beta type-5                        93.6    1e-36   Bos mutus
ref|XP_004609529.1|  PREDICTED: proteasome subunit beta type-5        93.2    1e-36   Sorex araneus [Eurasian shrew]
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5        93.6    1e-36   Bubalus bubalis [domestic water buffalo]
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5        93.2    1e-36   Microtus ochrogaster [prairie voles]
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5        93.6    1e-36   Jaculus jaculus
ref|NP_001032701.1|  proteasome subunit beta type-5                   93.2    1e-36   Bos taurus [bovine]
ref|XP_007880004.1|  hypothetical protein PFL1_04286                  94.4    1e-36   Anthracocystis flocculosa PF-1
ref|XP_007326468.1|  hypothetical protein AGABI1DRAFT_111072          90.9    1e-36   Agaricus bisporus var. burnettii JB137-S8
ref|XP_001626004.1|  predicted protein                                94.0    1e-36   Nematostella vectensis
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    1e-36   Oryctolagus cuniculus [domestic rabbit]
gb|EST08741.1|  20S proteasome, regulatory subunit beta type PSMB...  94.7    1e-36   Kalmanozyma brasiliensis GHG001
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5        93.6    1e-36   Ailuropoda melanoleuca
ref|XP_006457891.1|  20S proteasome subunit                           90.9    1e-36   Agaricus bisporus var. bisporus H97
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5        93.6    1e-36   Cavia porcellus [guinea pig]
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5        93.6    1e-36   Odobenus rosmarus divergens
emb|CAD97956.1|  hypothetical protein                                 93.6    1e-36   Homo sapiens [man]
dbj|GAC98484.1|  20S proteasome subunit                               94.4    1e-36   Pseudozyma hubeiensis SY62
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5        93.6    1e-36   Fukomys damarensis [Damara mole rat]
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                94.7    1e-36   
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5        93.6    2e-36   Felis catus [cat]
ref|XP_007385467.1|  N-terminal nucleophile aminohydrolase            90.9    2e-36   Punctularia strigosozonata HHB-11173 SS5
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    2e-36   
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5        93.6    2e-36   
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5        93.6    2e-36   Balaenoptera acutorostrata scammoni
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5        93.6    2e-36   Rhinopithecus roxellana
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5        93.2    2e-36   Octodon degus
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...  93.2    2e-36   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004347536.2|  hypothetical protein CAOG_04785                  90.9    2e-36   Capsaspora owczarzaki ATCC 30864
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5        92.8    2e-36   
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1            93.2    2e-36   Homo sapiens [man]
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5        93.2    2e-36   Nannospalax galili
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...  93.2    2e-36   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5        92.0    2e-36   Myotis brandtii
ref|XP_005713380.1|  20S core proteasome subunit beta 5               91.7    2e-36   Chondrus crispus [carageen]
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5        94.0    2e-36   Sus scrofa [pigs]
gb|KDQ18004.1|  hypothetical protein BOTBODRAFT_104582                93.2    2e-36   Botryobasidium botryosum FD-172 SS1
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...  93.2    2e-36   Chlorocebus sabaeus
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5        93.2    2e-36   Erinaceus europaeus [common hedgehog]
ref|NP_001247774.1|  proteasome subunit beta type-5                   93.6    2e-36   Macaca mulatta [rhesus macaque]
ref|XP_005809292.1|  PREDICTED: proteasome subunit beta type-5-like   93.2    2e-36   Xiphophorus maculatus
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5        93.6    2e-36   Pteropus alecto
ref|XP_007552653.1|  PREDICTED: proteasome subunit beta type-5        93.2    2e-36   Poecilia formosa
gb|KIJ17479.1|  hypothetical protein PAXINDRAFT_168130                90.9    2e-36   Paxillus involutus ATCC 200175
gb|KDR73611.1|  hypothetical protein GALMADRAFT_124865                90.1    2e-36   Galerina marginata CBS 339.88
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5        93.6    2e-36   Xenopus tropicalis [western clawed frog]
gb|ADO27969.1|  proteasome subunit beta type-5                        93.2    2e-36   Ictalurus furcatus
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                94.0    2e-36   Homo sapiens [man]
gb|KII89158.1|  hypothetical protein PLICRDRAFT_109139                92.0    2e-36   Plicaturopsis crispa FD-325 SS-3
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...  94.0    2e-36   
gb|AAI55951.1|  LOC100127332 protein                                  93.6    3e-36   Xenopus laevis [clawed frog]
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5        93.2    3e-36   Vicugna pacos
ref|XP_008431210.1|  PREDICTED: proteasome subunit beta type-5        93.2    3e-36   
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...  94.0    3e-36   Bos taurus [bovine]
gb|KDQ33416.1|  hypothetical protein PLEOSDRAFT_1110569               90.5    3e-36   Pleurotus ostreatus PC15
dbj|BAA08204.1|  proteasome subunit RCX                               94.0    3e-36   Rattus rattus [house rat]
gb|EMS25821.1|  20S proteasome subunit beta 5                         93.6    3e-36   Rhodotorula toruloides NP11
ref|XP_007361365.1|  N-terminal nucleophile aminohydrolase            92.4    3e-36   Dichomitus squalens LYAD-421 SS1
emb|CDI55907.1|  probable PRE2-20S core proteasome subunit (beta5...  94.4    3e-36   Melanopsichium pennsylvanicum 4
ref|NP_035316.1|  proteasome subunit beta type-5                      93.6    3e-36   Mus musculus [mouse]
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...  93.6    3e-36   Rattus norvegicus [brown rat]
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5  93.2    3e-36   Mus musculus [mouse]
gb|KIK08153.1|  hypothetical protein K443DRAFT_672633                 89.4    3e-36   
ref|XP_001875479.1|  20S proteasome subunit                           89.4    3e-36   
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5        93.6    3e-36   
gb|KIL00906.1|  hypothetical protein PAXRUDRAFT_821100                90.1    4e-36   
ref|XP_001509497.1|  PREDICTED: proteasome subunit beta type-5        93.6    4e-36   
gb|KIM65350.1|  hypothetical protein SCLCIDRAFT_542814                90.5    4e-36   
gb|KIK59625.1|  hypothetical protein GYMLUDRAFT_201809                90.5    4e-36   
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5        93.2    4e-36   
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5        93.6    4e-36   
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5        93.6    4e-36   
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5        93.6    4e-36   
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5-like   92.8    4e-36   
ref|XP_009541838.1|  subunit beta type peptidase T1A, 20S proteasome  93.2    4e-36   
gb|AAI53590.1|  Psmb5 protein                                         93.2    4e-36   
dbj|BAE93066.1|  low molecular mass polypeptide                       94.0    5e-36   
emb|CAQ14651.1|  proteasome (prosome, macropain) subunit, beta ty...  93.2    5e-36   
ref|NP_571226.1|  proteasome subunit beta type-5                      93.2    5e-36   
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...  93.6    5e-36   
ref|XP_005707411.1|  20S proteasome subunit beta 5                    91.3    5e-36   
ref|XP_002911819.1|  proteasome component pts1                        91.3    5e-36   
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor              93.2    5e-36   
gb|AAD53518.1|AF155578_1  proteasome subunit beta 5                   92.8    5e-36   
emb|CDO73558.1|  hypothetical protein BN946_scf185014.g28             91.7    6e-36   
emb|CAF97719.1|  unnamed protein product                              92.8    6e-36   
ref|XP_007764597.1|  20S proteasome subunit                           90.9    6e-36   
emb|CAA66312.1|  LMP7-like protein                                    92.8    6e-36   
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5        93.2    6e-36   
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5        92.8    6e-36   
gb|KJA27011.1|  hypothetical protein HYPSUDRAFT_35526                 89.0    6e-36   
gb|KFH65162.1|  20S proteasome subunit beta 5                         89.4    7e-36   
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5        93.2    7e-36   
emb|CDQ73245.1|  unnamed protein product                              92.4    8e-36   
ref|XP_010870425.1|  PREDICTED: proteasome subunit beta type-5-like   92.4    8e-36   
gb|AAB33092.1|  proteasome subunit MB1                                92.0    8e-36   
ref|XP_007850837.1|  proteasome component pre2 precursor              90.1    8e-36   
dbj|BAA10932.1|  LMPX of lamprey                                      93.6    8e-36   
gb|EWM22648.1|  proteasome subunit beta type 5                        90.9    8e-36   
gb|ACH85299.1|  proteasome (prosome, macropain) subunit beta type 5   92.4    9e-36   
gb|ACM08263.1|  Proteasome subunit beta type-5 precursor              92.4    9e-36   
ref|XP_007723577.1|  proteasome component PRE2                        94.7    9e-36   
gb|AAB87680.1|  proteasome subunit X                                  92.8    9e-36   
ref|XP_007730075.1|  proteasome component PRE2                        94.7    9e-36   
gb|KIJ69319.1|  hypothetical protein HYDPIDRAFT_79749                 89.0    9e-36   
ref|XP_008121563.1|  PREDICTED: proteasome subunit beta type-5        93.6    9e-36   
gb|ACI67172.1|  Proteasome subunit beta type-5 precursor              92.4    9e-36   
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...  94.0    1e-35   
gb|KIW10869.1|  proteasome subunit beta type-5                        94.4    1e-35   
emb|CDQ86611.1|  unnamed protein product                              92.4    1e-35   
gb|ACM08758.1|  Proteasome subunit beta type-5 precursor              92.0    1e-35   
ref|XP_011391773.1|  putative proteasome core particle subunit be...  94.4    1e-35   
ref|XP_007300583.1|  N-terminal nucleophile aminohydrolase            95.1    1e-35   
dbj|BAB26942.1|  unnamed protein product                              91.3    1e-35   
ref|XP_007321997.1|  hypothetical protein SERLADRAFT_475676           89.7    1e-35   
ref|XP_007319616.1|  hypothetical protein SERLADRAFT_470232           90.1    1e-35   
gb|KIO13433.1|  hypothetical protein M404DRAFT_122218                 89.7    1e-35   
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative       94.0    1e-35   
ref|XP_007100520.1|  PREDICTED: proteasome subunit beta type-5 is...  88.6    2e-35   
ref|XP_007739562.1|  proteasome component PRE2                        94.0    2e-35   
ref|XP_005994469.1|  PREDICTED: proteasome subunit beta type-5-like   93.6    2e-35   
ref|XP_007439509.1|  PREDICTED: proteasome subunit beta type-5        93.2    2e-35   
gb|KIX98319.1|  proteasome subunit beta type-5                        94.0    2e-35   
ref|XP_008731643.1|  proteasome component PRE2                        93.6    2e-35   
gb|KIW80298.1|  hypothetical protein Z517_06913                       93.6    2e-35   
ref|XP_006883201.1|  PREDICTED: proteasome subunit beta type-5        93.2    2e-35   
gb|EDL31171.1|  mCG118255                                             91.3    2e-35   
gb|KIW62885.1|  proteasome subunit beta type-5                        93.6    2e-35   
ref|XP_007761346.1|  proteasome component PRE2                        93.6    2e-35   
gb|KIY43500.1|  N-terminal nucleophile aminohydrolase                 89.4    2e-35   
gb|KIW29970.1|  proteasome subunit beta type-5                        93.6    2e-35   
gb|KIP12266.1|  hypothetical protein PHLGIDRAFT_17679                 91.3    2e-35   
emb|CDQ73519.1|  unnamed protein product                              89.4    2e-35   
gb|ETS60462.1|  hypothetical protein PaG_05302                        93.6    2e-35   
gb|EPS96804.1|  hypothetical protein FOMPIDRAFT_1025230               89.7    2e-35   
gb|KIW59603.1|  proteasome subunit beta type-5                        93.2    2e-35   
ref|XP_009160370.1|  proteasome component PRE2                        93.2    2e-35   
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit             90.5    2e-35   
ref|XP_005110562.1|  PREDICTED: proteasome subunit beta type-5-like   96.7    2e-35   
gb|KIW41006.1|  proteasome subunit beta type-5                        93.2    2e-35   
gb|EIF47547.1|  proteasome component pre2 precursor                   89.4    2e-35   
ref|XP_007449603.1|  PREDICTED: proteasome subunit beta type-5 is...  87.8    3e-35   
gb|KFH47961.1|  Proteasome subunit beta type-like protein             93.6    3e-35   
ref|XP_006040730.1|  PREDICTED: proteasome subunit beta type-5-like   89.4    3e-35   
ref|XP_004283229.1|  PREDICTED: proteasome subunit beta type-5 is...  87.8    3e-35   
gb|ETO17068.1|  hypothetical protein RFI_20264                        88.6    3e-35   
gb|KIV81807.1|  proteasome subunit beta type-5                        92.8    3e-35   
ref|XP_006696296.1|  hypothetical protein CTHT_0059780                90.9    3e-35   
ref|XP_005267928.1|  PREDICTED: proteasome subunit beta type-5 is...  89.4    3e-35   
emb|CBQ69839.1|  probable PRE2-20S core proteasome subunit (beta5)    92.4    4e-35   
ref|NP_001270574.1|  uncharacterized protein LOC101865806             89.0    4e-35   
gb|KIK46362.1|  hypothetical protein CY34DRAFT_420304                 88.6    5e-35   
ref|XP_004755395.1|  PREDICTED: proteasome subunit beta type-5 is...  87.8    5e-35   
emb|CCX09778.1|  Similar to Proteasome component PRE2; acc. no. P...  95.5    5e-35   
dbj|GAK66792.1|  proteasome-domain-containing protein                 94.0    5e-35   
ref|XP_003036093.1|  hypothetical protein SCHCODRAFT_81440            88.6    5e-35   
gb|EAW66194.1|  proteasome (prosome, macropain) subunit, beta typ...  87.8    5e-35   
gb|KIM79653.1|  hypothetical protein PILCRDRAFT_823192                87.4    5e-35   
emb|CCA68455.1|  probable PRE2-20S core proteasome subunit (beta5...  92.8    5e-35   
ref|XP_003363600.1|  PREDICTED: proteasome subunit beta type-5 is...  87.4    5e-35   
dbj|BAA10935.1|  nurse shark LMPX                                     93.2    5e-35   
ref|XP_008718323.1|  hypothetical protein HMPREF1541_05764            92.0    6e-35   
dbj|BAA10931.1|  LMPX of hagfish                                      91.3    6e-35   
gb|KIL61310.1|  hypothetical protein M378DRAFT_861259                 89.4    6e-35   
ref|XP_008156743.1|  PREDICTED: proteasome subunit beta type-5 is...  87.8    7e-35   
ref|XP_006175925.1|  PREDICTED: proteasome subunit beta type-5        93.2    7e-35   
ref|XP_003388964.1|  PREDICTED: proteasome subunit beta type-5-like   88.2    7e-35   
gb|KEF54386.1|  proteasome component PRE2                             91.3    8e-35   
dbj|GAC77344.1|  20S proteasome, regulatory subunit beta type PSM...  94.4    8e-35   
ref|XP_010887395.1|  PREDICTED: proteasome subunit beta type-5 is...  89.0    8e-35   
gb|EGU89011.1|  hypothetical protein FOXB_00423                       95.9    8e-35   
ref|XP_007821942.1|  hypothetical protein MAA_05753                   92.0    8e-35   
ref|XP_007989006.1|  PREDICTED: proteasome subunit beta type-5 is...  87.0    9e-35   
gb|EPQ17641.1|  Proteasome subunit beta type-5                        87.8    9e-35   
ref|XP_005290231.1|  PREDICTED: proteasome subunit beta type-5        88.6    1e-34   
ref|XP_011276949.1|  Proteasome subunit beta type-5                   89.4    1e-34   
dbj|GAA98585.1|  hypothetical protein E5Q_05272                       91.7    1e-34   
ref|XP_005560889.1|  PREDICTED: proteasome subunit beta type-5 is...  87.4    1e-34   
ref|XP_009209435.1|  PREDICTED: proteasome subunit beta type-5 is...  87.0    1e-34   
ref|NP_001138404.1|  proteasome subunit beta type-5 isoform 3         87.4    1e-34   
emb|CAD62626.1|  unnamed protein product                              87.4    1e-34   
gb|KJE01830.1|  proteasome subunit beta type-5                        93.2    1e-34   
ref|XP_003260674.1|  PREDICTED: proteasome subunit beta type-5 is...  87.4    1e-34   
ref|XP_003954551.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...  87.4    1e-34   
dbj|BAA10933.1|  LMP7 of nurse shark                                  90.9    1e-34   
gb|KHN95162.1|  proteasome component PRE2 precursor                   91.7    1e-34   
ref|XP_628966.1|  proteasome subunit beta type 5                      91.7    1e-34   
gb|KIV93101.1|  proteasome subunit beta type-5                        90.9    2e-34   
dbj|GAM85683.1|  hypothetical protein ANO11243_036910                 90.1    2e-34   
gb|KIJ26450.1|  hypothetical protein M422DRAFT_236567                 93.2    2e-34   
gb|AFR96090.1|  proteasome component PRE2                             92.4    2e-34   
emb|CBK22690.2|  unnamed protein product                              92.0    2e-34   
gb|KIX03620.1|  hypothetical protein Z518_07173                       90.1    2e-34   
gb|KEQ99430.1|  hypothetical protein AUEXF2481DRAFT_76056             89.7    2e-34   
gb|KEQ89998.1|  proteasome-domain-containing protein                  89.7    2e-34   
gb|KEQ71620.1|  proteasome-domain-containing protein                  89.7    2e-34   
gb|ACM09015.1|  Proteasome subunit beta type-5 precursor              90.1    2e-34   
gb|KFZ15392.1|  hypothetical protein V501_02728                       92.8    2e-34   
ref|XP_006036581.1|  PREDICTED: proteasome subunit beta type-5        93.6    3e-34   
ref|XP_005778345.1|  hypothetical protein EMIHUDRAFT_443537           87.4    3e-34   
gb|KEQ58949.1|  proteasome-domain-containing protein                  89.4    3e-34   
gb|KFY29536.1|  hypothetical protein V493_02281                       90.9    3e-34   
ref|XP_571562.1|  proteasome component pts1                           92.0    3e-34   
gb|KIR99960.1|  proteasome subunit beta type-5                        92.0    3e-34   
ref|XP_003194765.1|  proteasome component                             92.0    3e-34   
gb|KFY57071.1|  hypothetical protein V496_06571                       92.8    3e-34   
gb|KEZ44601.1|  Proteasome subunit beta type-5                        91.7    3e-34   
gb|KGB75936.1|  proteasome component pts1                             92.0    3e-34   
ref|XP_006261242.1|  PREDICTED: proteasome subunit beta type-5        93.6    3e-34   
ref|XP_010887405.1|  PREDICTED: proteasome subunit beta type-5 is...  87.4    3e-34   
emb|CDK27355.1|  unnamed protein product                              86.7    4e-34   
ref|XP_002435468.1|  20S proteasome, regulatory subunit beta, put...  92.4    4e-34   
emb|CEJ94974.1|  Putative Proteasome subunit beta type                93.2    4e-34   
ref|XP_009226325.1|  proteasome component PRE2                        89.7    4e-34   
ref|XP_007806219.1|  Proteasome component PRE2                        91.7    4e-34   
gb|KFY37637.1|  hypothetical protein V494_04681                       92.8    5e-34   
ref|XP_001745267.1|  hypothetical protein                             89.0    5e-34   
gb|KFY97219.1|  hypothetical protein V500_02188                       92.8    5e-34   
gb|KFY70486.1|  hypothetical protein V499_09130                       92.8    5e-34   
ref|NP_593825.1|  20S proteasome component beta 5                     86.3    5e-34   
gb|KFY15031.1|  hypothetical protein V492_02264                       92.8    5e-34   
emb|CDR40695.1|  CYFA0S05e03378g1_1                                   87.0    5e-34   
gb|EMD38457.1|  20S proteasome subunit                                87.4    6e-34   
gb|KFY87090.1|  hypothetical protein V498_07297                       92.4    6e-34   
ref|XP_007289258.1|  proteasome A-type and B-type                     92.4    6e-34   
ref|XP_003303688.1|  hypothetical protein PTT_16006                   91.3    7e-34   
ref|XP_008027551.1|  hypothetical protein SETTUDRAFT_163798           90.9    7e-34   
ref|XP_007683699.1|  hypothetical protein COCMIDRAFT_83732            90.9    8e-34   
ref|XP_007584467.1|  putative proteasome component pre2 protein       90.9    8e-34   
ref|XP_003287743.1|  proteasome subunit beta type 5                   91.7    8e-34   
ref|XP_003845348.1|  similar to proteasome subunit beta type-5        90.9    8e-34   
gb|EHK15431.1|  hypothetical protein TRIVIDRAFT_87262                 92.0    9e-34   
ref|XP_004833459.1|  proteasome beta 5 subunit, putative              88.2    9e-34   
ref|XP_001932350.1|  proteasome subunit beta type-5 precursor         90.9    9e-34   
ref|XP_003652191.1|  hypothetical protein THITE_2065666               91.7    9e-34   
ref|XP_006963913.1|  proteasome catalytic subunit 3                   92.0    1e-33   
ref|XP_003051739.1|  predicted protein                                91.7    1e-33   
gb|EKG17638.1|  Peptidase T1A proteasome beta-subunit                 90.9    1e-33   
ref|XP_005825075.1|  20S proteasome subunit beta type 5               86.7    1e-33   
gb|KFA45931.1|  hypothetical protein S40293_09534                     92.0    1e-33   
ref|XP_009263168.1|  hypothetical protein FPSE_11776                  91.7    1e-33   
ref|XP_002835466.1|  hypothetical protein                             89.7    1e-33   
ref|XP_003851747.1|  proteasome core particle subunit beta 5          90.1    1e-33   
ref|XP_008594307.1|  proteasome component PRE2                        91.7    1e-33   
ref|XP_003005184.1|  proteasome component PRE2                        91.7    1e-33   
gb|EMT65514.1|  Proteasome component PRE2                             91.7    1e-33   
gb|KFA67504.1|  hypothetical protein S40285_00247                     91.7    1e-33   
gb|EHK42320.1|  hypothetical protein TRIATDRAFT_135900                92.0    1e-33   
gb|EWG55946.1|  proteasome component PRE2                             91.7    1e-33   
gb|KDB13437.1|  proteasome component PRE2 precursor                   91.3    1e-33   
emb|CCE40402.1|  hypothetical protein CPAR2_104380                    88.2    1e-33   
gb|KEY71291.1|  hypothetical protein S7711_08872                      91.7    1e-33   
ref|XP_006667564.1|  proteasome component PRE2 precursor              91.3    1e-33   
ref|XP_007928014.1|  hypothetical protein MYCFIDRAFT_55997            89.7    1e-33   
ref|XP_003718955.1|  proteasome component PRE2                        90.1    1e-33   
ref|XP_007828102.1|  Proteasome component PRE2                        90.1    1e-33   
ref|XP_007596580.1|  proteasome component PRE2                        91.7    2e-33   
emb|CCF34208.1|  proteasome component PRE2                            91.3    2e-33   
gb|EFQ26512.1|  proteasome A-type and B-type                          91.3    2e-33   
gb|ENH88518.1|  proteasome component pre2                             91.7    2e-33   
gb|KDN66676.1|  putative proteasome A-type and B-type                 91.3    2e-33   
ref|XP_002842765.1|  proteasome component PRE2                        90.9    2e-33   
ref|XP_003235737.1|  proteasome subunit beta                          90.9    2e-33   
gb|EMF13044.1|  proteasome subunit beta type-5 precursor              90.1    2e-33   
ref|XP_007789613.1|  putative proteasome component pre2 protein       90.9    2e-33   
dbj|BAO00928.1|  proteasome subunit beta type 8,V-type                92.4    2e-33   
ref|XP_007676937.1|  hypothetical protein BAUCODRAFT_70978            89.4    2e-33   
ref|XP_003013825.1|  proteasome component Pre3, putative              90.9    2e-33   
ref|XP_003169204.1|  proteasome component PRE2                        90.9    2e-33   
ref|XP_002626185.1|  proteasome component PRE2                        89.7    2e-33   
ref|XP_007779133.1|  proteasome component PRE2                        91.3    2e-33   
gb|ELR08191.1|  20S proteasome subunit beta 5                         90.5    2e-33   
ref|XP_002139075.1|  proteasome subunit beta type 5 precursor         85.5    2e-33   
ref|XP_007347836.1|  proteasome-domain-containing protein             89.0    2e-33   
ref|XP_007264066.1|  N-terminal nucleophile aminohydrolase            88.6    2e-33   
ref|XP_003659396.1|  hypothetical protein MYCTH_2296370               90.5    3e-33   
ref|XP_002541549.1|  proteasome component PRE2                        89.0    3e-33   
gb|KIL90937.1|  proteasome component pre2                             91.7    3e-33   
ref|XP_003021770.1|  proteasome component Pre3, putative              90.9    3e-33   
ref|XP_714824.1|  hypothetical protein CaO19.2233                     86.3    3e-33   
gb|KGR00284.1|  proteasome component PRE2                             86.3    3e-33   
gb|KGQ95684.1|  proteasome component PRE2                             86.3    3e-33   
ref|XP_007913197.1|  putative proteasome component pre2 protein       90.1    3e-33   



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   199 bits (505),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP+RGESSELFD+IP  PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLRGESSELFDDIPSSPSFQIPNTTNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   128 bits (321),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DEKGPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   192 bits (487),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD IP  PSFQIP+  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGIPSSPSFQIPDTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   128 bits (321),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DEKGPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   187 bits (474),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAPI+GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPIKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   129 bits (324),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 60/62 (97%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG DEKGPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   186 bits (472),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP++GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   129 bits (324),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 60/62 (97%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG DEKGPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   186 bits (473),  Expect(2) = 7e-77, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   127 bits (320),  Expect(2) = 7e-77, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DEKGPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   186 bits (473),  Expect(2) = 8e-77, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   127 bits (320),  Expect(2) = 8e-77, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DEKGPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   185 bits (470),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE  AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPRAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   127 bits (320),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DEKGPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   175 bits (444),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            VTM++IDFSGLE  + +RG  +EL   +   P FQIPN  DFDGFQK+++QMVKPAKGTT
Sbjct  66   VTMMKIDFSGLEPNSLLRGNPNELLSGLSTAPEFQIPNTNDFDGFQKESVQMVKPAKGTT  125

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  126  TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  173


 Score =   127 bits (320),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DEKGPG
Sbjct  174  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  233

Query  571  LY  576
            LY
Sbjct  234  LY  235



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   176 bits (446),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G +SEL       PSF++PN TDFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTVPLFGANSELLGGFSAAPSFELPNTTDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   174 bits (442),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   174 bits (441),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPVWGAPSELVDGFSAGPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   174 bits (442),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   125 bits (313),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGTKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   172 bits (435),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDF GL+ +AP++G + +L +EI   PSF++P   DFDGFQK A+QMVKPAKGTTTL
Sbjct  1    MMKIDFGGLDPSAPLKGNTDDLHNEILAAPSFKLPITADFDGFQKAAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   127 bits (320),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG DE+GPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDEQGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   173 bits (438),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE  AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLEPAAPVSGAPSELVDGFSAAPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   172 bits (436),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G + ELF+     PSF++P  TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLFGATGELFNGFSTAPSFELPVTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (317),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   172 bits (436),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESXAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   172 bits (435),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESHAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004171974.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   170 bits (431),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G + E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPLFGPTMEAMEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (317),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLGVKCRLH+LANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGVKCRLHKLANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_007045045.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY00877.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=213

 Score =   171 bits (432),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (317),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   170 bits (431),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   170 bits (430),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   169 bits (429),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++ID SGL+  AP++G S +L DEI   PSF++P   DFDGFQK A+QMVKPAKGTTTL
Sbjct  2    MMKIDLSGLDPLAPVKGNSDDLDDEIMAAPSFKLPTTVDFDGFQKAAVQMVKPAKGTTTL  61

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIF +GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  62   AFIFDKGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   126 bits (317),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISVAGASKLL NILYSYRGMGLSVGTMIAG DE+GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVAGASKLLGNILYSYRGMGLSVGTMIAGWDEQGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   171 bits (432),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAP+   S+ +FD +   PSF++PN  DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPLFRSSNVIFDGLQMTPSFELPNALDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFK GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKHGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   124 bits (312),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILY+YRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   169 bits (428),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G   E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPMFGPRMEALEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   125 bits (315),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLGVKCR HELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGVKCRRHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   168 bits (426),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   170 bits (430),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAPI   S  +FD +   PSF +PN TDFDGFQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPIFRRSDFVFDGLQMTPSFDLPNPTDFDGFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKHGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   124 bits (312),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILY+YRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   167 bits (423),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPMIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   166 bits (420),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|KCW61971.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=201

 Score =   166 bits (419),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAA  105


 Score =   125 bits (315),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   165 bits (418),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   125 bits (315),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   164 bits (416),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   P+F++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPAFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   125 bits (315),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   164 bits (414),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTA + G S+E  D +   PSF +P+  D DGF K+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTASLFGASNEFHDGLSTAPSFDLPSNVDLDGFLKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   165 bits (417),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLES  P+ G +  SE+ D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGLESNVPMFGRNCESEMLDGLSDVPSFDLPLANDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   124 bits (312),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   162 bits (411),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++ID SGL+ +AP++  + +L +EI   PSF +P   DFDGFQK +IQMVKPA+GTTTL
Sbjct  1    MMKIDLSGLDPSAPMKRNTDDLDNEILATPSFALPTTVDFDGFQKASIQMVKPARGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   127 bits (319),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRIS+AGASK+LANILYSYRGMGLSVGTMIAG DE+GPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISIAGASKMLANILYSYRGMGLSVGTMIAGWDEQGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   164 bits (415),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   164 bits (415),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   164 bits (415),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D     PSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSAPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (313),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   162 bits (410),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   126 bits (317),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   162 bits (410),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   126 bits (317),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   162 bits (411),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            ++ID SGLES  P+ G  +EL D     PSF++P  TDFDGFQK+A Q +KPAKGTTTLA
Sbjct  1    MKIDLSGLESAFPLFGGGNELSDGFSAAPSFELPCSTDFDGFQKEAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   125 bits (315),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   163 bits (412),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (313),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   162 bits (410),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   162 bits (410),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTVGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   162 bits (410),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   162 bits (410),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   162 bits (409),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFESSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   162 bits (410),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE--LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG EST P+ G ++E  + D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFESTLPMFGGNTETEMLDGLSSVPSFDLPFTKDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (313),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVPGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   162 bits (409),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   162 bits (409),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFTTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   161 bits (407),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPA+GTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPARGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (313),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   160 bits (406),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPLIGFGSSNDMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (313),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   160 bits (406),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG+MAGG+A
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGSMAGGSA  107


 Score =   125 bits (313),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   157 bits (398),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGL+S   I G + + L +++   PSFQ+P  +DFDGFQKDAIQMVKPAKGTTTL
Sbjct  1    MKLDLSGLQSFTSIPGGAVDGLGEDLFAAPSFQLPACSDFDGFQKDAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score =   127 bits (320),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DEKGPG
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDEKGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   160 bits (404),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 91/108 (84%), Gaps = 3/108 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D    VPSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSVPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS-SQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYI  SQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYICMSQSVKKIIEINPYMLGTMAGGAA  108


 Score =   125 bits (313),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  109  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  168

Query  571  LY  576
            LY
Sbjct  169  LY  170



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   160 bits (404),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES +P+    +E  +     PSF++P  TDFDGFQKDA Q +KPAKGTTTLA
Sbjct  1    MKLDLSGLESASPLFAVGNEFSNGFSAAPSFELPCTTDFDGFQKDAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   124 bits (312),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLL NILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLTNILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   157 bits (396),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAA  105


 Score =   127 bits (320),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_006842100.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
 gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   159 bits (402),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGL S AP    + EL +    +PSFQ+PN  DFD FQK A+QMVKPAKGTTTLA
Sbjct  6    MRLDTSGLNSLAPAHVVNDELCEGFMSLPSFQLPNSADFDTFQKKAVQMVKPAKGTTTLA  65

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPY++GT+AGGAA
Sbjct  66   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYLIGTLAGGAA  110


 Score =   125 bits (314),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  111  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  170

Query  571  LY  576
            LY
Sbjct  171  LY  172



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   156 bits (395),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   155 bits (392),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP+ G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPLSGSIDDVCSDLSAHQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            F+FKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAA
Sbjct  61   FVFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAA  105


 Score =   127 bits (318),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   156 bits (394),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +  +  L D     PSF+IPN  DFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQLSNDNLCDVFSPTPSFEIPNDADFDGFQKAAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINPY+LGTMAGGAA
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPYLLGTMAGGAA  105


 Score =   125 bits (315),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   155 bits (392),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    S++   +   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPSLLAPQSDVVGALSAAPSFDLPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   155 bits (391),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   PSF +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPSFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   154 bits (390),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGT+AGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTVAGGAA  105


 Score =   126 bits (316),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   154 bits (390),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>gb|KDO81953.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=212

 Score =   155 bits (391),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   125 bits (315),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   154 bits (389),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_006438071.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51311.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=271

 Score =   154 bits (389),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004159677.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   158 bits (400),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAA
Sbjct  61   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAA  106


 Score =   121 bits (304),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCR HEL NKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  107  DCQFWHRNLGIKCRRHELENKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   154 bits (390),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 90/108 (83%), Gaps = 3/108 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESS-ELFD--EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            ++ D SGLEST+ + G +  EL D       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTSSVFGTAGRELVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  108


 Score =   125 bits (314),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANIL+SYRGMGLSVGTMIAG DE GPG
Sbjct  109  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILFSYRGMGLSVGTMIAGWDETGPG  168

Query  571  LY  576
            LY
Sbjct  169  LY  170



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   154 bits (390),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   158 bits (400),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  17   MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  76

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAA
Sbjct  77   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAA  122


 Score =   121 bits (304),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCR HEL NKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  123  DCQFWHRNLGIKCRRHELENKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  182

Query  571  LY  576
            LY
Sbjct  183  LY  184



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   154 bits (390),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +     L D     PSF+IPN TDFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQRSDDNLCDVFSPSPSFKIPNDTDFDGFQKAALQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINP++LGTMAGGAA
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPHLLGTMAGGAA  105


 Score =   125 bits (313),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLS+GTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSIGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   154 bits (390),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   152 bits (385),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP  G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPRSGLIDDVCSDLSAQQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAA
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAA  105


 Score =   127 bits (318),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   153 bits (387),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   154 bits (389),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIF EG MVAA SRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFIEGAMVAAASRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   154 bits (389),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   153 bits (387),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 88/108 (81%), Gaps = 3/108 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDE---IPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            ++ D SGLESTA + G +   F +       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTASVFGTAGREFVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGG A
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGGA  108


 Score =   125 bits (314),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANIL+SYRGMGLSVGTMIAG DE GPG
Sbjct  109  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILFSYRGMGLSVGTMIAGWDETGPG  168

Query  571  LY  576
            LY
Sbjct  169  LY  170



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   153 bits (387),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPKLVAPGNDVVGEFTAPPSFELPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   125 bits (314),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASK+LANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKMLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   153 bits (387),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKEASNMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (313),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   152 bits (383),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   P F +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPFFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   126 bits (316),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   153 bits (386),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKEAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (313),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   154 bits (389),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL+S  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQSFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAA
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAA  105


 Score =   124 bits (310),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAG DE G G
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGWDETGAG  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   151 bits (382),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 4/110 (4%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIP----RVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            M ++DFS L++TAP+ G+SS      P      PSF++P   DFDGFQK+A  MVK  KG
Sbjct  1    MRQLDFSSLQTTAPLLGDSSGFSGGFPGDFSAAPSFEVPVTDDFDGFQKEARDMVKSKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   TTTLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  110


 Score =   126 bits (316),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  111  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  170

Query  571  LY  576
            LY
Sbjct  171  LY  172



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   152 bits (384),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   150 bits (380),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  104


 Score =   126 bits (316),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  105  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  164

Query  571  LY  576
            LY
Sbjct  165  LY  166



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   151 bits (382),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDVLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   125 bits (314),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   149 bits (377),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FKEGVMVAADSRASMGGYISS SVKKIIEINPYMLGTMAGGAA
Sbjct  62   FKEGVMVAADSRASMGGYISSHSVKKIIEINPYMLGTMAGGAA  104


 Score =   126 bits (316),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  105  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  164

Query  571  LY  576
            LY
Sbjct  165  LY  166



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   150 bits (380),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  104


 Score =   124 bits (310),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMG SVGTMIAG DE GPG
Sbjct  105  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGSSVGTMIAGWDETGPG  164

Query  571  LY  576
            LY
Sbjct  165  LY  166



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   151 bits (381),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  104


 Score =   124 bits (310),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMG SVGTMIAG DE GPG
Sbjct  105  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGSSVGTMIAGWDETGPG  164

Query  571  LY  576
            LY
Sbjct  165  LY  166



>ref|XP_002514943.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
 gb|EEF47497.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
Length=249

 Score =   150 bits (378),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG ESTAP+ G   SSE+ +      SF++P  +DFDGFQ +A Q +K AKGTTT
Sbjct  1    MKLDTSGFESTAPLFGASSSSEMVNGFSAPASFELPVTSDFDGFQSEAKQTLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  107


 Score =   124 bits (312),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILY+YRGMGLSVGTM+AG DE GPG
Sbjct  108  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNYRGMGLSVGTMVAGWDETGPG  167

Query  571  LY  576
            LY
Sbjct  168  LY  169



>gb|KDO81951.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=302

 Score =   157 bits (396),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   114 bits (286),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDE  558
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDE  161



>ref|XP_006484069.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X1 [Citrus 
sinensis]
Length=302

 Score =   156 bits (394),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   114 bits (286),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDE  558
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDE  161



>ref|XP_006438070.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51310.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=302

 Score =   155 bits (392),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  105


 Score =   114 bits (286),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDE  558
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE
Sbjct  106  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDE  161



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   138 bits (348),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 88/131 (67%), Gaps = 26/131 (20%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS------------------------SQSVKKIIEINP  356
            LAFIFK GVMVAADSRASMGGYIS                        SQSVKKIIEINP
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISVSSLKNSSKNMHPFDIVDFGRNTTSQSVKKIIEINP  120

Query  357  YMLGTMAGGAA  389
            YMLGTMAGGAA
Sbjct  121  YMLGTMAGGAA  131


 Score =   125 bits (314),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE GPG
Sbjct  132  DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPG  191

Query  571  LY  576
            LY
Sbjct  192  LY  193



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   146 bits (369),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES A   GE  +L  E    PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFASFHGEMDDLHGEFWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINPYM+ T+AGGAA
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPYMIATVAGGAA  105


 Score =   113 bits (282),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FWHRNLG+KCRL+EL NKRRISVAGASKLL N+LYSYRGMGLS+GTM+AG DE GP 
Sbjct  106  DCIFWHRNLGMKCRLYELENKRRISVAGASKLLTNMLYSYRGMGLSIGTMVAGCDEMGPS  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   147 bits (372),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES AP+ G   +L  E+   PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFAPLHGGMDDLHGELWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINP+M+ T+AGGAA
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPHMIATVAGGAA  105


 Score =   111 bits (278),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FWHRNLGVKCRL+EL NKRRISVAGASKLL N+LYSYRGM LSVGTMIAG DE GP 
Sbjct  106  DCIFWHRNLGVKCRLYELENKRRISVAGASKLLTNMLYSYRGMELSVGTMIAGWDEMGPS  165

Query  571  LY  576
            LY
Sbjct  166  LY  167



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   131 bits (329),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 85/109 (78%), Gaps = 4/109 (4%)
 Frame = +3

Query  75   VRIDFSGLESTAPIR--GESSE--LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D S +E+   +R  GE  +  +F     +P+ ++P   DFDGFQK+A +++K  KGT
Sbjct  1    MKLDVSAMENNFAVRCGGEDDDGGIFGAGADLPAMELPTCADFDGFQKEAKELMKNKKGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  61   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  109


 Score =   128 bits (321),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISVAGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  110  DCQFWHRNLGIKCRLHELANKRRISVAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171



>ref|XP_010440898.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=160

 Score =   145 bits (367),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 80/90 (89%), Gaps = 1/90 (1%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  299
            G ++E+FD +  VPSF +P  TDFDGFQK +++MVKPAKGTTTLAFIFKEGVMVAADSRA
Sbjct  7    GSNNEMFDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTTLAFIFKEGVMVAADSRA  66

Query  300  SMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            SMGGYISS S+ KIIEINPYMLGTMAGGAA
Sbjct  67   SMGGYISSPSM-KIIEINPYMLGTMAGGAA  95


 Score =   111 bits (277),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDE  558
            DCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGM LSVGTMIAG DE
Sbjct  96   DCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMRLSVGTMIAGWDE  151



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   128 bits (321),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  111


 Score =   126 bits (317),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  112  DCQFWHRNLGTKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  171

Query  571  LY  576
            LY
Sbjct  172  LY  173



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   137 bits (344),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PSF++P + D DGFQK A+QMVKPAKGTTTLAF+FK GV+VAADSRASMG YISSQSVKK
Sbjct  27   PSFELPAVADLDGFQKAAVQMVKPAKGTTTLAFVFKHGVIVAADSRASMGNYISSQSVKK  86

Query  339  IIEINPYMLGTMAGGAA  389
            I+EINPY+LGTMAGGAA
Sbjct  87   ILEINPYLLGTMAGGAA  103


 Score =   118 bits (295),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG +CRLHELANKRRISV GASKLLAN LYSYRGMGLS+GTMIAG DE GPG
Sbjct  104  DCQFWQRNLGTRCRLHELANKRRISVTGASKLLANTLYSYRGMGLSMGTMIAGWDETGPG  163

Query  571  LY  576
            LY
Sbjct  164  LY  165



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   138 bits (348),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-----LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            +R+DF+GL+     R  S +      +D I   PSF +P + D DGF+K A+ MVKP  G
Sbjct  1    MRLDFAGLDPVTLRRPSSGDGGFDVAYDSIGSAPSFNLPAVADLDGFEKAAVDMVKPLHG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTLAF+FKEGV+VAADSRASMG YISSQ VKKI+EINPY+LGTMAGGAA
Sbjct  61   TTTLAFVFKEGVIVAADSRASMGNYISSQDVKKILEINPYLLGTMAGGAA  110


 Score =   116 bits (291),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG +CRLHEL NKRRISV GASKLLAN LYSYRGMGLS+GTMIAG DE GPG
Sbjct  111  DCQFWQRNLGTRCRLHELGNKRRISVTGASKLLANTLYSYRGMGLSMGTMIAGWDETGPG  170

Query  571  LY  576
            LY
Sbjct  171  LY  172



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   128 bits (321),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  111


 Score =   126 bits (317),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  112  DCQFWHRNLGTKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  171

Query  571  LY  576
            LY
Sbjct  172  LY  173



>gb|AFW85805.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=203

 Score =   128 bits (321),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  111


 Score =   126 bits (317),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  112  DCQFWHRNLGTKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  171

Query  571  LY  576
            LY
Sbjct  172  LY  173



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   129 bits (324),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 78/109 (72%), Gaps = 4/109 (4%)
 Frame = +3

Query  75   VRIDFSGLESTAPI----RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D S LE+   +     G+      E P VPS  +P   DFDGFQ     MVK  KGT
Sbjct  3    MKLDMSALETNFAVPCGDDGDGMYFSAEAPDVPSMVLPTCADFDGFQAATKDMVKNKKGT  62

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  63   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  111


 Score =   124 bits (311),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  112  DCQFWHRNLGNKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  171

Query  571  LY  576
            LY
Sbjct  172  LY  173



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   127 bits (320),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  111  DCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  170

Query  571  LY  576
            LY
Sbjct  171  LY  172


 Score =   125 bits (314),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = +3

Query  75   VRIDFSGLEST----APIRGESSELFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+     A  R +   LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGREDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  110



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   127 bits (319),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  150  PRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQS  329
            P VPS  +P   DFDGFQ D   MVK  KGTTTLAFIF +GV+VAADSRASMGGYISSQ+
Sbjct  32   PDVPSMVLPTCDDFDGFQADTKAMVKNKKGTTTLAFIFDKGVIVAADSRASMGGYISSQT  91

Query  330  VKKIIEINPYMLGTMAGGAA  389
            V+KIIEINPYMLGTMAGGAA
Sbjct  92   VRKIIEINPYMLGTMAGGAA  111


 Score =   125 bits (313),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  112  DCQFWHRNLGNKCRLHELSNKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  171

Query  571  LY  576
            LY
Sbjct  172  LY  173



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   127 bits (320),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  111  DCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  170

Query  571  LY  576
            LY
Sbjct  171  LY  172


 Score =   124 bits (311),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 81/110 (74%), Gaps = 5/110 (5%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+    +    E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAQAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  110



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   127 bits (320),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  111  DCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  170

Query  571  LY  576
            LY
Sbjct  171  LY  172


 Score =   124 bits (311),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 80/110 (73%), Gaps = 5/110 (5%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  110



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   127 bits (320),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  111  DCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  170

Query  571  LY  576
            LY
Sbjct  171  LY  172


 Score =   124 bits (311),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 80/110 (73%), Gaps = 5/110 (5%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  110



>gb|AAT44125.1| 20S proteasome beta subunit E [Saussurea medusa]
Length=150

 Score =   161 bits (407),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++DF GLES+AP+ G + + L D     PSF +P  +DFDGFQK +IQMVKPAKGTTTL
Sbjct  1    MKLDFGGLESSAPLYGGNDDVLSDGFSTAPSFDLPVTSDFDGFQKSSIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AFIFKEGVMVAA+SRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  61   AFIFKEGVMVAANSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  106


 Score = 87.4 bits (215),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSY  510
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSY
Sbjct  107  DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  146



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   124 bits (310),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG KCRLHELANKRRIS+AG+SK+LANILYSYRGMGLS+GTMIAG DE GPG
Sbjct  109  DCQFWHRNLGTKCRLHELANKRRISIAGSSKMLANILYSYRGMGLSIGTMIAGFDETGPG  168

Query  571  LY  576
            LY
Sbjct  169  LY  170


 Score =   120 bits (300),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 75/108 (69%), Gaps = 3/108 (3%)
 Frame = +3

Query  75   VRIDFSGLES---TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            +R+D S LE+    AP       +F       + + P   DFDGFQK    MV   KGTT
Sbjct  1    MRLDVSALENHHFAAPGNEFGGGVFAADTEELAMEFPTCNDFDGFQKATKDMVNNKKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  61   TLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  108



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   124 bits (312),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG DE GPG
Sbjct  111  DCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAGFDETGPG  170

Query  571  LY  576
            LY
Sbjct  171  LY  172


 Score =   119 bits (297),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCNDFDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAA  389
            IEINPYMLGTMAGGAA
Sbjct  95   IEINPYMLGTMAGGAA  110



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   125 bits (314),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  5    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  64

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAA
Sbjct  65   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAA  107


 Score =   116 bits (291),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG +CRLHELANKRRISVAGASKLLAN LYSYRGMGLS+GTMIAG DE GP 
Sbjct  108  DCQFWQRNLGTRCRLHELANKRRISVAGASKLLANTLYSYRGMGLSMGTMIAGWDETGPA  167

Query  571  LY  576
            L+
Sbjct  168  LF  169



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   125 bits (314),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  3    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  62

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAA
Sbjct  63   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAA  105


 Score =   116 bits (290),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG +CRLHELANKRRISVAGASKLLAN LYSYRGMGLS+GTMIAG DE GP 
Sbjct  106  DCQFWQRNLGTRCRLHELANKRRISVAGASKLLANTLYSYRGMGLSMGTMIAGWDETGPA  165

Query  571  LY  576
            L+
Sbjct  166  LF  167



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   124 bits (312),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG DE GPG
Sbjct  111  DCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAGFDETGPG  170

Query  571  LY  576
            LY
Sbjct  171  LY  172


 Score =   117 bits (292),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGFQK    MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCDDFDGFQKATKAMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAA  389
            IEINPYMLGTMAGGAA
Sbjct  95   IEINPYMLGTMAGGAA  110



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   124 bits (310),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391   DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
             DCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG DE GPG
Sbjct  1352  DCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAGFDETGPG  1411

Query  571   LY  576
             LY
Sbjct  1412  LY  1413


 Score =   115 bits (287),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  189   FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             FDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLG
Sbjct  1285  FDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLG  1344

Query  369   TMAGGAA  389
             TMAGGAA
Sbjct  1345  TMAGGAA  1351



>gb|AAT80906.1| 26S proteasome beta subunit [Lemna minor]
Length=116

 Score =   120 bits (302),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLS+GTMIAG DE GPG
Sbjct  57   DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSIGTMIAGWDETGPG  116


 Score =   110 bits (275),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            VKPAKGTTTLAFIFKEGV+V+ADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  1    VKPAKGTTTLAFIFKEGVIVSADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  56



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   127 bits (320),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS+GTMIAG DEKGPG
Sbjct  58   DCQFWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYRGMGLSIGTMIAGWDEKGPG  117

Query  571  LY  576
            LY
Sbjct  118  LY  119


 Score =   101 bits (251),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            M+K  KGTTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  1    MLKHKKGTTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  57



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   115 bits (288),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  189  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGFQK A+Q+VKPAKGTTTLAF+FK GV+VAADS ASMG  ISSQSVKKI+EINPY+LG
Sbjct  1    LDGFQKAAVQLVKPAKGTTTLAFVFKHGVIVAADSSASMGNSISSQSVKKILEINPYLLG  60

Query  369  TMAGGAA  389
            TMAGGAA
Sbjct  61   TMAGGAA  67


 Score =   113 bits (283),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG +CRLHELANKR ISV GASKLLAN LYSYRGMGL +GTMIAG DE GPG
Sbjct  68   DCQFWQRNLGTRCRLHELANKRHISVTGASKLLANTLYSYRGMGLFMGTMIAGWDETGPG  127

Query  571  LY  576
            LY
Sbjct  128  LY  129



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   124 bits (311),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS+GTMIAG DE GPG
Sbjct  58   DCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLSIGTMIAGFDETGPG  117

Query  571  LY  576
            LY
Sbjct  118  LY  119


 Score = 99.4 bits (246),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAA
Sbjct  1    MVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAA  57



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score =   115 bits (288),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 79/109 (72%), Gaps = 4/109 (4%)
 Frame = +3

Query  75   VRIDFSGLES-TAPIRGESSELFDEIP---RVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++DFS L++ T  I  E +E   EI       +F++P + ++D FQ++ +  VKP  GT
Sbjct  1    MKLDFSVLDAPTRKIDAEIAECAAEINSDVHAQNFKLPMVENYDSFQREVVDYVKPNHGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAA
Sbjct  61   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAA  109


 Score =   103 bits (258),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG++CRLHEL N +RISV+GASKLL+N LY YRG GLS+GTM+AG D  GPG
Sbjct  110  DCQFWQRNLGIQCRLHELENGKRISVSGASKLLSNTLYGYRGQGLSMGTMVAGWDLNGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   125 bits (315),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  72   DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  131

Query  571  LY  576
            LY
Sbjct  132  LY  133


 Score = 93.6 bits (231),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFPSLISHGNDVVGEFEAPPSFELPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSR  296
            FIFKEGVMVAAD +
Sbjct  61   FIFKEGVMVAADCQ  74



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   110 bits (276),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +3

Query  75   VRIDFSGLES----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D+S L++    T  I  + +          +F++P + ++D FQ++ +  VKP  GT
Sbjct  4    LKLDYSVLDAPQRATDRIEADCAREIHGDVHAQNFKLPMVENYDEFQREVVDYVKPNHGT  63

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAA
Sbjct  64   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAA  112


 Score =   107 bits (268),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG++CRLHEL N +RISVAGASKLLAN LY YRG GLS+GTM+AG D KGPG
Sbjct  113  DCQFWQRNLGIQCRLHELENGKRISVAGASKLLANTLYGYRGQGLSMGTMVAGWDLKGPG  172

Query  571  LY  576
            LY
Sbjct  173  LY  174



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score =   117 bits (293),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 10/111 (9%)
 Frame = +3

Query  81   IDFSGLESTAPIRG--------ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            +DFS L++TA  RG        ES +  D      +F+ P + DF+GFQ++ I  VKP  
Sbjct  6    LDFSFLDATA--RGSMASKHVDESLDAIDGNMHECNFKAPAVEDFEGFQREVINYVKPNH  63

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            GTTTLAFIF+ G++VA DSRAS G YISSQ+VKK+IEINP++LGTMAGGAA
Sbjct  64   GTTTLAFIFEHGIVVAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAA  114


 Score =   101 bits (251),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS+GTM+AG D  GPG
Sbjct  115  DCQFWQRNLGIQCRLHELENGKRITVRAASKLLANTLYSYKGKGLSMGTMVAGWDLNGPG  174

Query  571  LY  576
            LY
Sbjct  175  LY  176



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score =   116 bits (291),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 11/117 (9%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIP---------RVPSFQIPNITDFDGFQKDAIQ  218
            +T + +DFS L+   P+R E+ EL   +              F IP + DF  FQKD ++
Sbjct  1    MTSLNLDFSVLDR--PVRKEADELTSTLENDVLCGINTHDQYFTIPRVEDFSRFQKDVVE  58

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             VKP  GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAA
Sbjct  59   HVKPQHGTTTLGFIFEHGIIIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAA  115


 Score =   101 bits (251),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG++CRLHEL   +RI+V GASKLLAN LY YRG GLS+GTM+AG D  GPG
Sbjct  116  DCQFWQRNLGIQCRLHELETGKRITVTGASKLLANTLYGYRGRGLSMGTMVAGWDTTGPG  175

Query  571  LY  576
            L+
Sbjct  176  LF  177



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score =   116 bits (290),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKG  239
            M ++DFS L S  P+  +S    +++  + S    F +P + D D F+ + +  VKP  G
Sbjct  1    MDKLDFSALCSR-PLSEKSGACVEDVASITSAVQDFPLPQVQDVDRFENEVMSYVKPNHG  59

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTTL FIFK GV++A DSRASMG YISSQ+VKK+IEINPY+LGTMAGGAA
Sbjct  60   TTTLGFIFKYGVIIAVDSRASMGSYISSQTVKKVIEINPYLLGTMAGGAA  109


 Score = 98.6 bits (244),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG +CRL+EL N +RISV  ASKLLAN+++SY+G GLS+GTM+AG D  GPG
Sbjct  110  DCQFWQRNLGQQCRLYELNNGKRISVRAASKLLANVMFSYKGYGLSMGTMVAGYDPTGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score =   113 bits (282),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 72/111 (65%), Gaps = 6/111 (5%)
 Frame = +3

Query  75   VRIDFSGLEST------APIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            V +D S L  T         R E+ +         +F  P + DFD FQ++ I  VKPA 
Sbjct  3    VNLDLSFLHDTERGAASTKYRDEALQGVSNSVHASNFTAPAVEDFDAFQREVINYVKPAH  62

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAA
Sbjct  63   GTTTLGFIFEHGIVIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAA  113


 Score =   101 bits (252),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS+GTMIAG D  GPG
Sbjct  114  DCQFWQRNLGIQCRLHELENGKRITVRAASKLLANTLYSYKGRGLSMGTMIAGWDLNGPG  173

Query  571  LY  576
            LY
Sbjct  174  LY  175



>gb|ABD61730.2| 26S proteasome beta subunit [Lupinus albus]
Length=127

 Score =   118 bits (295),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYR MG SVGTMIAG DE GPG
Sbjct  50   DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRRMGYSVGTMIAGWDETGPG  109

Query  571  L  573
            L
Sbjct  110  L  110


 Score = 97.1 bits (240),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 47/49 (96%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            +TLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  1    STLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  49



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score =   109 bits (272),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIP-----RVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            M+++D S LE  A    E   L  E        V SF +P + D D F+++ ++ VKP  
Sbjct  1    MMKLDLSCLEPAAGAGREPCGL--EAAGVSGVAVDSFPLPAVADIDSFEREVVEYVKPNH  58

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            GTTTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAA
Sbjct  59   GTTTLGFIFQGGVIIAVDSRASQGSYISSQTVKKVIEINPHLLGTMAGGAA  109


 Score =   105 bits (262),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG +CRL+ELAN +RI+V GASKLLAN ++SYRGMGLS+GTM+AG DE GPG
Sbjct  110  DCQFWERNLGRQCRLYELANGKRITVRGASKLLANTMFSYRGMGLSMGTMVAGWDEAGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score =   109 bits (273),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            SF +P + D D F+++ ++MVKP  GTTTL FIF+ GV++A DSRA+MG YISSQ+VKK+
Sbjct  34   SFPLPAVQDVDKFEREVVEMVKPCHGTTTLGFIFQHGVIIAVDSRATMGAYISSQTVKKV  93

Query  342  IEINPYMLGTMAGGAA  389
            IEIN ++LGTMAGGAA
Sbjct  94   IEINKFLLGTMAGGAA  109


 Score =   100 bits (250),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG++CRL+EL N +RI+V  ASKLL+N+++SYRGMGLS+GTM+AG D  GPG
Sbjct  110  DCQFWQRNLGMQCRLYELNNGKRITVRAASKLLSNVMFSYRGMGLSMGTMVAGWDPTGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score =   108 bits (269),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 76/106 (72%), Gaps = 3/106 (3%)
 Frame = +3

Query  78   RIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++D   LE  A  +G     +L  ++P   SF +P + D D F+++ ++MVKP  GTTTL
Sbjct  4    KLDLGILEPNAGRKGPGLGPDLQLDVP-TASFPLPAVQDLDKFEREVVEMVKPCHGTTTL  62

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             FIF+ GV++A DSRA+MG +ISSQ+VKK+IEIN +++GTMAGGAA
Sbjct  63   GFIFQHGVIIAVDSRATMGSFISSQTVKKVIEINKHLIGTMAGGAA  108


 Score =   100 bits (250),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG++CRL+EL N +RI+V  ASKLLAN ++SYRGMGLS+GTM+AG D  GPG
Sbjct  109  DCQFWQRNLGMRCRLYELNNGKRITVCAASKLLANTMFSYRGMGLSMGTMVAGWDSTGPG  168

Query  571  LY  576
            LY
Sbjct  169  LY  170



>gb|ABQ50544.1| hypothetical protein [Brassica rapa]
Length=218

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  299
            G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTTLAFIFKEGVMVAADSRA
Sbjct  7    GSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTTLAFIFKEGVMVAADSRA  66

Query  300  SMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            SMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  67   SMGGYISSQSVKKIIEINPYMLGTMAGGAA  96



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   102 bits (254),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  189  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGF++  ++ VKP+ GTTTL FIF+ GV++A DSRAS G Y+SSQ+VKK+IEINPY+LG
Sbjct  9    LDGFERSVVEYVKPSHGTTTLGFIFQGGVIIAVDSRASQGSYLSSQTVKKVIEINPYLLG  68

Query  369  TMAGGAA  389
            TMAGGAA
Sbjct  69   TMAGGAA  75


 Score = 97.8 bits (242),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW RNLG +CRL+EL   RRI+V  ASKLLAN ++SYRGMGLS+GTMIAG D  GPG
Sbjct  76   DCQFWERNLGRQCRLYELKEGRRITVKAASKLLANTMFSYRGMGLSMGTMIAGWDIGGPG  135

Query  571  LY  576
            LY
Sbjct  136  LY  137



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   125 bits (313),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  35   DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  94

Query  571  LY  576
            LY
Sbjct  95   LY  96


 Score = 67.4 bits (163),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            +SRASMGGYISSQSV+KIIEINPYMLGTMAGGAA
Sbjct  1    NSRASMGGYISSQSVEKIIEINPYMLGTMAGGAA  34



>emb|CBY21147.1| unnamed protein product [Oikopleura dioica]
 emb|CBY40350.1| unnamed protein product [Oikopleura dioica]
Length=287

 Score = 98.6 bits (244),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW R L ++CRL+EL NK RISVA ASKLLAN++Y Y+GMGLS+GTM+ G D+KGPG
Sbjct  129  DCQFWERVLAMECRLYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKKGPG  188

Query  571  LY  576
            LY
Sbjct  189  LY  190


 Score = 93.2 bits (230),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P F  P +     F  D    +K   GTT LAF FK GVMVA DSRA+ GGYI+SQ VKK
Sbjct  52   PPFSNPQLHLDQNFGDDKPVKIKFNHGTTCLAFKFKHGVMVATDSRATAGGYIASQEVKK  111

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  112  VIEINPYLLGTMAGGAA  128



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score = 98.6 bits (244),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+GMGLS+GTM+ G D+ GP 
Sbjct  120  DCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYKGMGLSMGTMVTGWDKTGPN  179

Query  571  LY  576
            L+
Sbjct  180  LF  181


 Score = 92.8 bits (229),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            PSF +P I +   F ++          +K   GTTTLAF F+ GV+VA DSRA+MG YIS
Sbjct  37   PSFDVPAIHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIS  96

Query  321  SQSVKKIIEINPYMLGTMAGGAA*LPVLAQE  413
            SQ+VKK+IEINPY+LGTMAGGAA      +E
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERE  127



>emb|CEP17612.1| hypothetical protein [Parasitella parasitica]
Length=277

 Score = 95.5 bits (236),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 14/95 (15%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            P+F IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PAFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQHGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAA*LPVLAQE  413
             YI SQ+VKK+IEINPY+LGTMAGGAA      +E
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERE  127


 Score = 94.7 bits (234),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC +W R LG +CRLHEL NK RISVA ASKLLAN++Y+Y+GMGLS+GTM+ G D+ GP 
Sbjct  120  DCSYWERELGRRCRLHELRNKERISVAAASKLLANMVYAYKGMGLSMGTMVTGWDKSGPN  179

Query  571  LY  576
            L+
Sbjct  180  LF  181



>ref|XP_002889983.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66242.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score =   111 bits (277),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDE  558
            DCQFWHRNLG+KCRLH LANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAG DE
Sbjct  39   DCQFWHRNLGIKCRLHALANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDE  94


 Score = 79.0 bits (193),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 38/38 (100%), Positives = 38/38 (100%), Gaps = 0/38 (0%)
 Frame = +3

Query  276  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  1    MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  38



>dbj|GAN10935.1| 20S proteasome subunit [Mucor ambiguus]
Length=277

 Score = 95.1 bits (235),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 62/95 (65%), Gaps = 14/95 (15%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAA*LPVLAQE  413
             YI SQ+VKK+IEINPY+LGTMAGGAA      +E
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERE  127


 Score = 94.7 bits (234),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC +W R LG +CRLHEL NK RISVA ASKLLAN++Y+Y+GMGLS+GTM+ G D+ GP 
Sbjct  120  DCSYWERELGRRCRLHELRNKERISVAAASKLLANMVYAYKGMGLSMGTMVTGWDKSGPN  179

Query  571  LY  576
            L+
Sbjct  180  LF  181



>gb|EPB87271.1| proteasome component PRE2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=277

 Score = 95.1 bits (235),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 62/95 (65%), Gaps = 14/95 (15%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAA*LPVLAQE  413
             YI SQ+VKK+IEINPY+LGTMAGGAA      +E
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERE  127


 Score = 94.7 bits (234),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC +W R LG +CRLHEL NK RISVA ASKLLAN++Y+Y+GMGLS+GTM+ G D+ GP 
Sbjct  120  DCSYWERELGRRCRLHELRNKERISVAAASKLLANMVYAYKGMGLSMGTMVTGWDKSGPN  179

Query  571  LY  576
            L+
Sbjct  180  LF  181



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   125 bits (313),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  57   DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  116

Query  571  LY  576
            LY
Sbjct  117  LY  118


 Score = 64.3 bits (155),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 36/47 (77%), Gaps = 8/47 (17%)
 Frame = +3

Query  273  VMVAADSR--------ASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            VM AA  R        ASMGGYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  10   VMAAAGFRLADTFHTGASMGGYISSQSVKKIIEINPYMLGTMAGGAA  56



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score = 95.1 bits (235),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW R LG++CRL+EL NKRRISVA ASKLL+NI+Y Y+  GLS+GTMIAG D  GP 
Sbjct  135  DCQFWERYLGMQCRLYELRNKRRISVAAASKLLSNIVYQYKDHGLSMGTMIAGWDHTGPN  194

Query  571  LY  576
            L+
Sbjct  195  LF  196


 Score = 93.6 bits (231),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 60/77 (78%), Gaps = 3/77 (4%)
 Frame = +3

Query  165  FQIPNITDFDGF--QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            F +P   +  GF  QK+ ++    AKGTTTL F+F +G+++A DSRASMG YISSQ+VKK
Sbjct  59   FALPPSLNNSGFIHQKEKLEKTY-AKGTTTLGFVFNKGIVIAVDSRASMGNYISSQNVKK  117

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  118  VIEINPYLLGTMAGGAA  134



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score = 98.6 bits (244),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+GMGLS+GTM+ G D+ GP 
Sbjct  120  DCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYKGMGLSMGTMVTGWDKTGPN  179

Query  571  LY  576
            L+
Sbjct  180  LF  181


 Score = 89.0 bits (219),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F +P + +   F ++          +K   GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  321  SQSVKKIIEINPYMLGTMAGGAA*LPVLAQE  413
            SQ+VKK+IEINPY+LGT+AGGAA      +E
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERE  127



>emb|CEG76258.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=246

 Score = 98.6 bits (244),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+GMGLS+GTM+ G D+ GP 
Sbjct  120  DCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYKGMGLSMGTMVTGWDKTGPN  179

Query  571  LY  576
            L+
Sbjct  180  LF  181


 Score = 88.6 bits (218),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F +P + +   F ++          +K   GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  321  SQSVKKIIEINPYMLGTMAGGAA*LPVLAQE  413
            SQ+VKK+IEINPY+LGT+AGGAA      +E
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERE  127



>ref|XP_005537552.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81516.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
Length=299

 Score = 97.1 bits (240),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R LG++CRLHEL ++ RISVA ASKLLANI+Y Y+GMGLS+GTMIAG D+ GP 
Sbjct  121  DCSFWERYLGMRCRLHELQHRERISVAAASKLLANIVYEYKGMGLSMGTMIAGWDKTGPQ  180

Query  571  LY  576
            L+
Sbjct  181  LF  182


 Score = 90.1 bits (222),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
             +PR  S   P + D    ++++  +VK   GTTTLAF+F++G++VA DSRASMG YI S
Sbjct  41   RVPRGASIA-PRLRDVLRDEQNS-SLVKFLHGTTTLAFVFRDGIIVAVDSRASMGQYIGS  98

Query  324  QSVKKIIEINPYMLGTMAGGAA  389
             +VKKIIEINPY+LGTMAGGAA
Sbjct  99   GTVKKIIEINPYLLGTMAGGAA  120



>ref|XP_001730616.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
 gb|EDP43402.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
Length=295

 Score = 95.9 bits (237),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  112  DCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGMGLSMGTMICGWDKSGPA  171

Query  571  LY  576
            +Y
Sbjct  172  IY  173


 Score = 89.7 bits (221),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS  +   TD D  + DA   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PSRFLAQYTDVDSTRPDA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  95   VIEINPYLLGTMAGGAA  111



>emb|CEJ04297.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=206

 Score = 98.6 bits (244),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+GMGLS+GTM+ G D+ GP 
Sbjct  80   DCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYKGMGLSMGTMVTGWDKTGPN  139

Query  571  LY  576
            L+
Sbjct  140  LF  141


 Score = 87.0 bits (214),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 4/81 (5%)
 Frame = +3

Query  171  IPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEI  350
            + N+TD    ++     +K   GTTTLAF F+ GV+VA DSRA+MG YI+SQ+VKK+IEI
Sbjct  11   LRNVTD----EESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIASQTVKKVIEI  66

Query  351  NPYMLGTMAGGAA*LPVLAQE  413
            NPY+LGT+AGGAA      +E
Sbjct  67   NPYLLGTLAGGAADCQYWERE  87



>gb|KFH71396.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=278

 Score = 93.6 bits (231),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W R LG +CRL+EL NK RISVA ASK+L+N++Y Y+GMGLS+GTMI G D+ GP 
Sbjct  121  DCQYWERELGRRCRLYELRNKERISVAAASKILSNMVYDYKGMGLSMGTMITGWDKTGPA  180

Query  571  LY  576
            L+
Sbjct  181  LF  182


 Score = 91.7 bits (226),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = +3

Query  156  VPSFQIP---NITDFDGFQKDAI--QMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            +P+F IP   N TDF     DA     ++   GTTTLAF F+ G++VA DSRAS G YI+
Sbjct  38   LPAFDIPMVANPTDFLRAHTDASAENRIRIQHGTTTLAFKFQGGIIVAVDSRASGGSYIA  97

Query  321  SQSVKKIIEINPYMLGTMAGGAA*LPVLAQE  413
            SQ+VKK+IEINPY+LGTMAGGAA      +E
Sbjct  98   SQTVKKVIEINPYLLGTMAGGAADCQYWERE  128



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score = 96.7 bits (239),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W R +  +CR++EL NK RISVA ASKLLANI+Y+Y+GMGLS+GTMI G D+KGPG
Sbjct  122  DCQYWERVVARQCRIYELRNKERISVAAASKLLANIVYNYKGMGLSMGTMICGWDKKGPG  181

Query  571  LY  576
            LY
Sbjct  182  LY  183


 Score = 88.6 bits (218),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%), Gaps = 8/83 (10%)
 Frame = +3

Query  162  SFQIP-------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            +F+IP       ++  F     D I+ ++ A GTTTLAF FK GV+VA DSRA+ G +I+
Sbjct  40   TFEIPQNFNPGEDLKQFTEGNDDNIK-IRIAHGTTTLAFKFKHGVIVAVDSRATAGDWIA  98

Query  321  SQSVKKIIEINPYMLGTMAGGAA  389
            SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  99   SQTVKKVIEINPYLLGTMAGGAA  121



>emb|CDH56820.1| 20s proteasome subunit [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14360.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=277

 Score = 94.7 bits (234),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W R LG +CRL+EL NK RISVA ASKLL N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  120  DCQYWERELGRRCRLYELRNKERISVAAASKLLGNMVYSYKGMGLSMGTMITGWDKTGPN  179

Query  571  LY  576
            L+
Sbjct  180  LF  181


 Score = 90.1 bits (222),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 60/91 (66%), Gaps = 6/91 (7%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F IP++ +   F +           +K   GTTTLAF F+ GV+VA DSRA+MG YI 
Sbjct  37   PTFDIPDVHNPVDFLRSVTDEDSPDYKIKIQHGTTTLAFQFQGGVIVAVDSRATMGNYIG  96

Query  321  SQSVKKIIEINPYMLGTMAGGAA*LPVLAQE  413
            SQ+VKK+IEINPY+LGTMAGGAA      +E
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERE  127



>gb|EJU05281.1| proteasome-domain-containing protein [Dacryopinax sp. DJM-731 
SS1]
Length=315

 Score = 94.0 bits (232),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  134  DCQYWETYLGIECRLHELRNRERISVAAASKFLSNLVYSYKGMGLSMGTMICGWDKTGPA  193

Query  571  LY  576
            L+
Sbjct  194  LF  195


 Score = 90.9 bits (224),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 60/85 (71%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF++P++ D   F +       D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  49   IPSFKVPSLADPSAFLRMHTDDYADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            I+S +VKK+IEINPY+LGTMAGGAA
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAA  133



>ref|XP_009061521.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
 gb|ESO87922.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
Length=263

 Score = 97.4 bits (241),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R+L  +CRL+EL NK RISVA ASKLLAN +Y+Y+GMGLS+GTMI G D+KGPG
Sbjct  107  DCSFWERHLAKECRLYELRNKERISVAAASKLLANTVYNYKGMGLSMGTMIVGWDKKGPG  166

Query  571  LY  576
            LY
Sbjct  167  LY  168


 Score = 86.3 bits (212),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +3

Query  117  RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            +GE ++LF+         +     F   + D    +    GTTTLAF FK G +VA DSR
Sbjct  18   QGERNQLFNNCGGNYGRPLETRNSFTNEKSDV--KIHFDHGTTTLAFKFKHGCIVAVDSR  75

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  76   ATAGSYIASQTVKKVIEINPYLLGTMAGGAA  106



>ref|XP_006957104.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
 gb|EIM23071.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
Length=288

 Score = 93.2 bits (230),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 66/106 (62%), Gaps = 14/106 (13%)
 Frame = +3

Query  114  IRGESSELFD-------EIPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTL  251
            + G +S L D       E   +P+  +PN  D  GF       Q+D    +K   GTTTL
Sbjct  8    LNGATSSLDDMFEGNSIEKHGIPTLDLPNTADPTGFLRTYTDDQQDPSCRIKINHGTTTL  67

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            AF FK GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAA
Sbjct  68   AFKFKGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAA  113


 Score = 90.5 bits (223),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL NK RISVA ASK L+NI YSY+G GLS+GTMI G D+ GP 
Sbjct  114  DCQYWETYLGIQCRLHELRNKERISVAAASKYLSNITYSYKGKGLSMGTMICGWDKGGPA  173

Query  571  LY  576
            ++
Sbjct  174  IW  175



>ref|XP_003801967.1| PREDICTED: proteasome subunit beta type-5 [Otolemur garnettii]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 90.1 bits (222),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P+ PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPKSPSDGLSLVAPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_008036606.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
 gb|EIW60150.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
Length=310

 Score = 92.4 bits (228),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  133  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  192

Query  571  LY  576
            ++
Sbjct  193  IF  194


 Score = 90.9 bits (224),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF+IP + D   F         D    +K   GTTTLAF +K GV+VA DSRA+ G Y
Sbjct  48   VPSFKIPAVADPSSFLRMHTDDHADPSCRIKIKHGTTTLAFRYKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            ++S +VKK+IEINPY+LGTMAGGAA
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAA  132



>gb|KDQ60928.1| hypothetical protein JAAARDRAFT_125152 [Jaapia argillacea MUCL 
33604]
Length=318

 Score = 93.2 bits (230),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  131  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  190

Query  571  LY  576
            +Y
Sbjct  191  VY  192


 Score = 89.4 bits (220),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  46   IPSFSVPSVHDPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  105

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            I+S +VKK+IEINPY+LGTMAGGAA
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAA  130



>ref|XP_006682354.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF76856.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=267

 Score = 92.4 bits (228),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R LG + RL+EL NK RISVA ASKLL+N++Y Y+GMGLS+GTMI G D++GPG
Sbjct  57   DCSFWERELGRRARLYELRNKERISVAAASKLLSNMVYGYKGMGLSMGTMITGWDKQGPG  116

Query  571  LY  576
            L+
Sbjct  117  LF  118


 Score = 90.1 bits (222),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA*LPV  401
            +K  KGTTTLAF F +GV+VA DSRA+MG YI SQ+VKK+IEINPY+LGTMAGGAA    
Sbjct  1    IKLEKGTTTLAFKFAKGVVVAVDSRATMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSF  60

Query  402  LAQE  413
              +E
Sbjct  61   WERE  64



>ref|XP_009265754.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
 gb|EOR04743.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
Length=287

 Score = 93.6 bits (231),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 65/102 (64%), Gaps = 11/102 (11%)
 Frame = +3

Query  117  RGESSELFDEIPR----VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIF  263
            RG  + L D+       +P+ Q+PN  D  GF       Q D    +K   GTTTLAF +
Sbjct  12   RGIDAALHDDFEGGSGGMPTLQLPNTADPTGFLREYTDEQNDPSCRIKINHGTTTLAFKY  71

Query  264  KEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            K GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAA
Sbjct  72   KGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAA  113


 Score = 89.0 bits (219),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+NI YSY+G GLS+GTMI G D+ GP 
Sbjct  114  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNITYSYKGKGLSMGTMICGWDKGGPA  173

Query  571  LY  576
            ++
Sbjct  174  IW  175



>gb|ACP43316.1| 20S proteasome beta subunit 5 [Citrus maxima]
Length=194

 Score =   125 bits (313),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFWHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLSVGTMIAG DE GPG
Sbjct  28   DCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPG  87

Query  571  LY  576
            LY
Sbjct  88   LY  89


 Score = 57.4 bits (137),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +3

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAA  389
            GYISSQSVKKIIEINPYMLGTMAGGAA
Sbjct  1    GYISSQSVKKIIEINPYMLGTMAGGAA  27



>emb|CCO27714.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
 emb|CEL51643.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
Length=302

 Score = 95.1 bits (235),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMIAG D+ GP 
Sbjct  130  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLVYSYKGMGLSMGTMIAGWDKTGPA  189

Query  571  LY  576
            L+
Sbjct  190  LF  191


 Score = 87.0 bits (214),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 56/85 (66%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF IP + D   F         D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  45   VPSFTIPRVPDPTAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            I+S +VKK+IEIN Y+LGTMAGGAA
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAA  129



>ref|XP_003332961.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP88542.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=289

 Score = 95.5 bits (236),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL NK RISVA ASK L+N++YSY+GMGLS+GTMI G D  GPG
Sbjct  125  DCQYWETYLGIQCRLHELRNKSRISVAAASKYLSNLVYSYKGMGLSMGTMICGWDGAGPG  184

Query  571  LY  576
            LY
Sbjct  185  LY  186


 Score = 86.7 bits (213),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 57/84 (68%), Gaps = 6/84 (7%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            VP F +P + D   F       + A   +K   GTTTLAF F+ G++VA DSRA+ G YI
Sbjct  41   VPRFDLPGVKDPVSFLRTHTDDRSADAKIKIKHGTTTLAFRFQHGIIVAVDSRATAGSYI  100

Query  318  SSQSVKKIIEINPYMLGTMAGGAA  389
            +S +VKK+IEINP++LGTMAGGAA
Sbjct  101  ASGTVKKVIEINPFLLGTMAGGAA  124



>ref|XP_008564788.1| PREDICTED: proteasome subunit beta type-5 [Galeopterus variegatus]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 89.0 bits (219),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 66/104 (63%), Gaps = 18/104 (17%)
 Frame = +3

Query  78   RIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAF  257
            R D   L   +PI G S          PS+ +P        ++  I+M+    GTTTLAF
Sbjct  24   RTDLLDLGPGSPIDGLSLA-------APSWGVP--------EEPGIEMLH---GTTTLAF  65

Query  258  IFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  66   KFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_004474611.1| PREDICTED: proteasome subunit beta type-5 [Dasypus novemcinctus]
Length=262

 Score = 93.6 bits (231),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 88.6 bits (218),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 10/94 (11%)
 Frame = +3

Query  120  GESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            G  ++L D  P  PS       PN+   D  ++  I+M+    GTTTLAF F+ GV+VA 
Sbjct  22   GGRADLLDLGPGSPSDGMSLAAPNL---DVSEEPGIEMLH---GTTTLAFKFRHGVIVAV  75

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  76   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_007006996.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
 gb|EIW67092.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
Length=287

 Score = 92.8 bits (229),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 8/92 (9%)
 Frame = +3

Query  138  FDEIPRVPSFQIPNITD---FDGFQKDAIQ-----MVKPAKGTTTLAFIFKEGVMVAADS  293
             DE+ R+   QIP + D   F     D++       +K A GTTTLAF FK G++VA DS
Sbjct  28   LDEMGRIKGMQIPRVPDPTAFLNLYTDSMSSNPEAKIKLAHGTTTLAFRFKGGIIVAVDS  87

Query  294  RASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            RA+ G YI+S +VKK+IEINPY+LGTMAGGAA
Sbjct  88   RATAGSYIASGTVKKVIEINPYLLGTMAGGAA  119


 Score = 89.0 bits (219),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRL+EL NK RISVA ASK+L+NI+Y Y+G GLS+GTMI G D+ GP 
Sbjct  120  DCQYWETYLGMRCRLYELRNKERISVAAASKILSNIVYGYKGRGLSMGTMICGWDKTGPA  179

Query  571  LY  576
            L+
Sbjct  180  LF  181



>ref|XP_009021669.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
 gb|ESO00235.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
Length=245

 Score =   100 bits (250),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  KCRL+EL NK RISVA ASKLLANILY Y+GMGLSVGTMI G D++GPG
Sbjct  92   DCSFWQRFLAEKCRLYELRNKERISVAAASKLLANILYGYKGMGLSVGTMIVGWDKRGPG  151

Query  571  LY  576
            LY
Sbjct  152  LY  153


 Score = 80.9 bits (198),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 5/85 (6%)
 Frame = +3

Query  138  FDEIPRVPSFQIPNITDFDGFQKDAIQM-VKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            F+ +P+  SFQ P++  F+    D  ++ +    GTTTL+F +K GV+VA DSRA+ G +
Sbjct  11   FNLVPK--SFQ-PSL-HFNKESNDESKIKIHFDHGTTTLSFKYKNGVIVAVDSRATAGPW  66

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            I+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  67   IASQNVKKVIEINPYLLGTMAGGAA  91



>emb|CCF49354.1| probable PRE2-20S core proteasome subunit (beta5) [Ustilago hordei]
Length=325

 Score = 94.4 bits (233),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL NK RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  121  DCQYWETYLGIQCRLHELRNKERISVAAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  180

Query  571  LY  576
            L+
Sbjct  181  LF  182


 Score = 87.4 bits (215),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 64/102 (63%), Gaps = 12/102 (12%)
 Frame = +3

Query  114  IRGESSELFDEIPRVP-SFQIPNI---------TDFDGFQKDAIQMVKPAKGTTTLAFIF  263
            + G +   +D++   P  F +PN+         TD D    +    +K A GTTTLAF F
Sbjct  21   MHGSTGAAYDQLMGAPGQFDLPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRF  78

Query  264  KEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            K G++V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAA
Sbjct  79   KGGIIVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAA  120



>ref|XP_006144566.1| PREDICTED: proteasome subunit beta type-5 [Tupaia chinensis]
 gb|ELW69249.1| Proteasome subunit beta type-5 [Tupaia chinensis]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 88.2 bits (217),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWDVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_007395513.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55176.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
Length=300

 Score = 93.2 bits (230),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  128  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  187

Query  571  LY  576
            +Y
Sbjct  188  VY  189


 Score = 88.6 bits (218),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP F IP + D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  43   VPKFNIPAVPDPSAFLRLHTDDFADPSCRIKIKHGTTTLAFRFRGGVIVAVDSRATAGSY  102

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            I+S +VKK+IEINPY+LGTMAGGAA
Sbjct  103  IASGTVKKVIEINPYLLGTMAGGAA  127



>gb|EUC61688.1| proteasome subunit beta type-5 protein [Rhizoctonia solani AG-3 
Rhs1AP]
Length=302

 Score = 95.1 bits (235),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMIAG D+ GP 
Sbjct  130  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLVYSYKGMGLSMGTMIAGWDKTGPA  189

Query  571  LY  576
            L+
Sbjct  190  LF  191


 Score = 86.7 bits (213),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP + D  GF         D    +K   GTTTLAF FK G++V  DSRA+ G Y
Sbjct  45   VPAFNIPRVPDPIGFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGIIVCVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            I+S +VKK+IEIN Y+LGTMAGGAA
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAA  129



>gb|KEP54479.1| proteasome subunit beta type-5 protein [Rhizoctonia solani 123E]
Length=302

 Score = 94.7 bits (234),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMIAG D+ GP 
Sbjct  130  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLVYSYKGMGLSMGTMIAGWDKTGPA  189

Query  571  LY  576
            L+
Sbjct  190  LF  191


 Score = 86.7 bits (213),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP + D  GF         D    +K   GTTTLAF FK G++V  DSRA+ G Y
Sbjct  45   VPAFNIPRVPDPIGFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGIIVCVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            I+S +VKK+IEIN Y+LGTMAGGAA
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAA  129



>ref|XP_005933706.1| PREDICTED: proteasome subunit beta type-5-like [Haplochromis 
burtoni]
Length=281

 Score = 93.6 bits (231),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTM+ G D++GPG
Sbjct  129  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKRGPG  188

Query  571  LY  576
            LY
Sbjct  189  LY  190


 Score = 88.2 bits (217),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  333  KKIIEINPYMLGTMAGGAA  389
            KK+IEINPY+LGTMAGGAA
Sbjct  110  KKVIEINPYLLGTMAGGAA  128



>ref|XP_007100517.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Physeter 
catodon]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 88.2 bits (217),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  I    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLIAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_005740284.1| PREDICTED: proteasome subunit beta type-5-like [Pundamilia nyererei]
Length=281

 Score = 93.2 bits (230),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTM+ G D++GPG
Sbjct  129  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKRGPG  188

Query  571  LY  576
            LY
Sbjct  189  LY  190


 Score = 88.2 bits (217),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  333  KKIIEINPYMLGTMAGGAA  389
            KK+IEINPY+LGTMAGGAA
Sbjct  110  KKVIEINPYLLGTMAGGAA  128



>emb|CCU99044.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=268

 Score = 94.7 bits (234),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  112  DCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGMGLSMGTMICGWDKTGPA  171

Query  571  LY  576
            ++
Sbjct  172  IF  173


 Score = 86.7 bits (213),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P   +   TD D   ++A   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PGRFLAQFTDVDSTNQNA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  95   VIEINPYLLGTMAGGAA  111



>ref|XP_007863011.1| 20S proteasome subunit [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58001.1| 20S proteasome subunit [Gloeophyllum trabeum ATCC 11539]
Length=312

 Score = 92.4 bits (228),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  133  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  192

Query  571  LY  576
            ++
Sbjct  193  VF  194


 Score = 89.4 bits (220),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P + D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPSFSVPAVHDPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            I+S +VKK+IEINPY+LGTMAGGAA
Sbjct  108  IASGTVKKVIEINPYLLGTMAGGAA  132



>ref|XP_008065987.1| PREDICTED: proteasome subunit beta type-5 [Tarsius syrichta]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 88.2 bits (217),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +   T   G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGNPSDGLSLATPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>emb|CBN74512.1| conserved unknown protein [Ectocarpus siliculosus]
Length=286

 Score = 93.6 bits (231),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW RNLG++CR++EL NK RISVA ASKLL+N +  YRG GLS+GTM+AG D+ GP 
Sbjct  119  DCSFWERNLGIQCRMYELRNKERISVAAASKLLSNTMSQYRGYGLSMGTMVAGWDKTGPQ  178

Query  571  LY  576
            LY
Sbjct  179  LY  180


 Score = 88.2 bits (217),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 60/84 (71%), Gaps = 9/84 (11%)
 Frame = +3

Query  165  FQIPNITD---------FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            F +PN+ +           G+  D  Q +K AKGTTTLAF F+ G++V+ DSR++MG YI
Sbjct  35   FGLPNVANPAAFCSANLGCGYGTDHAQDIKFAKGTTTLAFKFQGGIIVSVDSRSTMGPYI  94

Query  318  SSQSVKKIIEINPYMLGTMAGGAA  389
            +S +VKK+IEINPY+LGTMAGGAA
Sbjct  95   ASGTVKKVIEINPYLLGTMAGGAA  118



>ref|XP_003457456.2| PREDICTED: proteasome subunit beta type-5-like [Oreochromis niloticus]
Length=281

 Score = 93.2 bits (230),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTM+ G D++GPG
Sbjct  129  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKRGPG  188

Query  571  LY  576
            LY
Sbjct  189  LY  190


 Score = 88.2 bits (217),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  333  KKIIEINPYMLGTMAGGAA  389
            KK+IEINPY+LGTMAGGAA
Sbjct  110  KKVIEINPYLLGTMAGGAA  128



>ref|XP_004010385.1| PREDICTED: proteasome subunit beta type-5 [Ovis aries]
 ref|XP_005685312.1| PREDICTED: proteasome subunit beta type-5 [Capra hircus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.8 bits (216),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>gb|KDE05583.1| proteasome component PRE2 [Microbotryum violaceum p1A1 Lamole]
Length=308

 Score = 93.6 bits (231),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  131  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  190

Query  571  LY  576
            L+
Sbjct  191  LF  192


 Score = 87.8 bits (216),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF +P + D   F +       D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  46   MPSFDLPTLQDPTAFLQLHTDDSSDPSCRIKINHGTTTLAFRFKGGIIVAVDSRATAGSY  105

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            I+S +VKK+IEINPY+LGTMAGGAA
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAA  130



>ref|XP_004694701.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Condylura 
cristata]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.8 bits (216),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P+        +  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVPD--------EPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_004565403.1| PREDICTED: proteasome subunit beta type-5-like [Maylandia zebra]
Length=271

 Score = 93.2 bits (230),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTM+ G D++GPG
Sbjct  119  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKRGPG  178

Query  571  LY  576
            LY
Sbjct  179  LY  180


 Score = 87.8 bits (216),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  44   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  99

Query  333  KKIIEINPYMLGTMAGGAA  389
            KK+IEINPY+LGTMAGGAA
Sbjct  100  KKVIEINPYLLGTMAGGAA  118



>ref|XP_005875924.1| PREDICTED: proteasome subunit beta type-5-like [Myotis brandtii]
 gb|EPQ13719.1| Proteasome subunit beta type-5 [Myotis brandtii]
Length=263

 Score = 94.4 bits (233),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLL N+LY Y+GMGLSVGTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLVNMLYQYKGMGLSVGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 66/112 (59%), Gaps = 23/112 (21%)
 Frame = +3

Query  96   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK------  236
            LES+ P+        G  ++L D  P  PS         DG    A     P +      
Sbjct  7    LESSVPVNRHGFFGLGGRADLLDLGPGSPS---------DGLSLAAPSWGVPEEPRIEIL  57

Query  237  -GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_005978060.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Pantholops 
hodgsonii]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.8 bits (216),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_004694702.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Condylura 
cristata]
Length=208

 Score = 94.0 bits (232),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  55   DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  114

Query  571  LY  576
            LY
Sbjct  115  LY  116


 Score = 87.4 bits (215),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  3    HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  54



>ref|XP_003924370.1| PREDICTED: proteasome subunit beta type-5 [Saimiri boliviensis 
boliviensis]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.8 bits (216),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 11/78 (14%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  335
            VP + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VK
Sbjct  43   VPGWGVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVK  91

Query  336  KIIEINPYMLGTMAGGAA  389
            K+IEINPY+LGTMAGGAA
Sbjct  92   KVIEINPYLLGTMAGGAA  109



>emb|CCM00020.1| predicted protein [Fibroporia radiculosa]
Length=302

 Score = 92.4 bits (228),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  131  DCQYWETFLGIECRLHELRNRERISVAAASKFLSNLVYSYKGMGLSMGTMICGWDKTGPT  190

Query  571  LY  576
            ++
Sbjct  191  IF  192


 Score = 88.6 bits (218),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 67/109 (61%), Gaps = 7/109 (6%)
 Frame = +3

Query  84   DFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQK-------DAIQMVKPAKGT  242
            + SG E  + +   S    +    +P+F IP++ D   F +       D    +K   GT
Sbjct  22   EISGDEDVSDVMWGSEGFGNLAKEIPTFAIPSVPDPAAFLRLHTDDHADPSCRIKIKHGT  81

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            TTLAF +K GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAA
Sbjct  82   TTLAFRYKGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAA  130



>ref|XP_006988553.1| PREDICTED: proteasome subunit beta type-5 [Peromyscus maniculatus 
bairdii]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.8 bits (216),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPKIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_005978061.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Pantholops 
hodgsonii]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.8 bits (216),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>dbj|BAA06097.1| proteasome subunit X [Homo sapiens]
 gb|AAP35423.1| proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|AIC59195.1| hypothetical protein, partial [synthetic construct]
Length=208

 Score = 94.0 bits (232),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  55   DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  114

Query  571  LY  576
            LY
Sbjct  115  LY  116


 Score = 87.4 bits (215),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  3    HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  54



>ref|XP_007449602.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Lipotes 
vexillifer]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.8 bits (216),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_004313401.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Tursiops 
truncatus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.8 bits (216),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>gb|AAP36588.1| Homo sapiens proteasome (prosome, macropain) subunit, beta type, 
5 [synthetic construct]
Length=209

 Score = 94.0 bits (232),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  55   DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  114

Query  571  LY  576
            LY
Sbjct  115  LY  116


 Score = 87.4 bits (215),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  3    HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  54



>ref|XP_004283228.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Orcinus 
orca]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.8 bits (216),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_004313402.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Tursiops 
truncatus]
Length=208

 Score = 93.6 bits (231),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  55   DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  114

Query  571  LY  576
            LY
Sbjct  115  LY  116


 Score = 87.4 bits (215),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  3    HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  54



>ref|XP_003506173.1| PREDICTED: proteasome subunit beta type-5 [Cricetulus griseus]
 ref|XP_007609296.1| PREDICTED: proteasome subunit beta type-5 [Cricetulus griseus]
 gb|EGV98712.1| Proteasome subunit beta type-5 [Cricetulus griseus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.4 bits (215),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_006776843.1| PREDICTED: proteasome subunit beta type-5 [Myotis davidii]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.4 bits (215),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF FK GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFKHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>gb|KIY65291.1| proteasome-domain-containing protein [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=308

 Score = 93.2 bits (230),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 7/85 (8%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F         D    +K A GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  47   VPTFTVPNLPDPSAFLRLHTDDHADPNCKIKIAHGTTTLAFRFKGGVIVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAA  389
            ++S +VKK+IEINPY+LGTMAGGAA
Sbjct  107  VASGTVKKVIEINPYLLGTMAGGAA  131


 Score = 87.8 bits (216),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N++Y Y+GMGLS+GTM+ G D+ GP 
Sbjct  132  DCQYWETYLGMHCRLHELRNRERISVSAASKFLSNLVYGYKGMGLSMGTMVCGWDKTGPA  191

Query  571  LY  576
            ++
Sbjct  192  IF  193



>gb|ELU16739.1| hypothetical protein CAPTEDRAFT_41193, partial [Capitella teleta]
Length=131

 Score = 96.7 bits (239),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W R +  +CR++EL NK RISVA ASKLLANI+Y+Y+GMGLS+GTMI G D+KGPG
Sbjct  53   DCQYWERVVARQCRIYELRNKERISVAAASKLLANIVYNYKGMGLSMGTMICGWDKKGPG  112

Query  571  LY  576
            LY
Sbjct  113  LY  114


 Score = 84.3 bits (207),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF FK GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  1    HGTTTLAFKFKHGVIVAVDSRATAGDWIASQTVKKVIEINPYLLGTMAGGAA  52



>ref|XP_004584741.1| PREDICTED: proteasome subunit beta type-5 [Ochotona princeps]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.4 bits (215),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P + +P        ++  I+MV    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PGWGVP--------EEPGIEMVH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_007418509.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
 gb|EGF98220.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
Length=296

 Score = 94.0 bits (232),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL NK RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  128  DCQYWETYLGMQCRLHELRNKSRISVAAASKHLSNLVYSYKGMGLSMGTMICGWDKSGPA  187

Query  571  LY  576
            LY
Sbjct  188  LY  189


 Score = 87.0 bits (214),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 57/84 (68%), Gaps = 6/84 (7%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            VP+F+ P + D   F +           +K   GTTTLAF FK G++VA DSRA+ G YI
Sbjct  44   VPTFEFPAVDDPAAFLRAHTDDRSPDSRIKIRHGTTTLAFRFKHGIVVAVDSRATAGSYI  103

Query  318  SSQSVKKIIEINPYMLGTMAGGAA  389
            +S +VKK+IEINP++LGTMAGGAA
Sbjct  104  ASGTVKKVIEINPFLLGTMAGGAA  127



>ref|XP_005338834.1| PREDICTED: proteasome subunit beta type-5 [Ictidomys tridecemlineatus]
Length=208

 Score = 94.0 bits (232),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  388  PDCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGP  567
             DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GP
Sbjct  54   ADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGP  113

Query  568  GLY  576
            GLY
Sbjct  114  GLY  116


 Score = 87.0 bits (214),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  3    HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  54



>ref|XP_010781265.1| PREDICTED: proteasome subunit beta type-5 [Notothenia coriiceps]
Length=271

 Score = 93.2 bits (230),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTM+ G D++GPG
Sbjct  119  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKRGPG  178

Query  571  LY  576
            LY
Sbjct  179  LY  180


 Score = 87.8 bits (216),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 8/94 (9%)
 Frame = +3

Query  120  GESSELFDEIP-RVPSFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            G+S   FD  P    SF + N     D DG ++     ++   GTTTLAF F+ GV+VA 
Sbjct  29   GQSGLGFDATPGDGLSFSVRNPLCAVDEDGVERK----IEFLHGTTTLAFKFQHGVIVAV  84

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  85   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  118



>ref|XP_009242876.1| PREDICTED: proteasome subunit beta type-5-like [Pongo abelii]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.4 bits (215),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            +K   GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  54   IKMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_005139397.1| PREDICTED: LOW QUALITY PROTEIN: proteasome (prosome, macropain) 
subunit, beta type, 5 [Mesocricetus auratus]
Length=262

 Score = 93.2 bits (230),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.4 bits (215),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_008527207.1| PREDICTED: proteasome subunit beta type-5 [Equus przewalskii]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.0 bits (214),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_001494538.2| PREDICTED: proteasome subunit beta type-5 isoform 1 [Equus caballus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.0 bits (214),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score = 91.3 bits (225),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASK+LAN++Y+Y+GMGLS+GTMI G D+ GPG
Sbjct  107  DCMFWERVLAKQCRIYELRNKERISVAAASKILANMVYNYKGMGLSMGTMICGWDKHGPG  166

Query  571  LY  576
            L+
Sbjct  167  LF  168


 Score = 89.4 bits (220),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 72/113 (64%), Gaps = 14/113 (12%)
 Frame = +3

Query  72   MVRIDFSGLESTAPI-----RGESSELFDEIPRV--PSFQIPNITDFDGFQKDAIQMVKP  230
            M  I+   L++ AP+     R +  E   +IP V  P+  +  +TD   + K     +K 
Sbjct  1    MAMIEECSLDAFAPLSLKAPRDDGVEF--QIPEVINPALHLRELTD-SKYGKG----IKF  53

Query  231  AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
              GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  54   NHGTTTLAFKFQHGVVVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAA  106



>ref|XP_002753673.3| PREDICTED: proteasome subunit beta type-5 [Callithrix jacchus]
Length=268

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  115  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  174

Query  571  LY  576
            LY
Sbjct  175  LY  176


 Score = 87.0 bits (214),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 11/78 (14%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  335
            +P + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VK
Sbjct  48   MPGWSVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVK  96

Query  336  KIIEINPYMLGTMAGGAA  389
            K+IEINPY+LGTMAGGAA
Sbjct  97   KVIEINPYLLGTMAGGAA  114



>ref|XP_004421295.1| PREDICTED: proteasome subunit beta type-5 [Ceratotherium simum 
simum]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.0 bits (214),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_004755394.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Mustela 
putorius furo]
 ref|XP_004801213.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Mustela 
putorius furo]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.0 bits (214),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 10/94 (11%)
 Frame = +3

Query  120  GESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            G  ++L D  P  PS       PN   +   ++  I+M+    GTTTLAF F+ GV+VAA
Sbjct  22   GGRADLLDLGPGSPSDGLTLAAPN---WGVAEEPRIEMLH---GTTTLAFKFQHGVIVAA  75

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  76   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_008708757.1| PREDICTED: proteasome subunit beta type-5 [Ursus maritimus]
Length=263

 Score = 94.0 bits (232),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_008156742.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Eptesicus 
fuscus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.0 bits (214),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 66/112 (59%), Gaps = 23/112 (21%)
 Frame = +3

Query  96   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK------  236
            LES+ P+        G  ++L D  P  PS         DG    A     P +      
Sbjct  7    LESSVPVNRHGFFGLGGRADLLDLGPGSPS---------DGLSLAAPSWGVPEEPKIEIL  57

Query  237  -GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_006802789.1| PREDICTED: proteasome subunit beta type-5-like [Neolamprologus 
brichardi]
Length=281

 Score = 92.8 bits (229),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTM+ G D++GPG
Sbjct  129  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKRGPG  188

Query  571  LY  576
            LY
Sbjct  189  LY  190


 Score = 87.4 bits (215),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 7/79 (9%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N   + D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  54   SFSVKNPLCVGDDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  109

Query  333  KKIIEINPYMLGTMAGGAA  389
            KK+IEINPY+LGTMAGGAA
Sbjct  110  KKVIEINPYLLGTMAGGAA  128



>ref|XP_006100131.1| PREDICTED: proteasome subunit beta type-5 [Myotis lucifugus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 66/112 (59%), Gaps = 23/112 (21%)
 Frame = +3

Query  96   LESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK------  236
            LES+ P+        G  ++L D  P  PS         DG    A     P +      
Sbjct  7    LESSVPVNRHGFFGLGGRADLLDLGPGSPS---------DGLSLAAPSWGVPEEPRIEIL  57

Query  237  -GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_003639276.1| PREDICTED: proteasome subunit beta type-5 [Canis lupus familiaris]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 87.0 bits (214),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 63/91 (69%), Gaps = 4/91 (4%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKD-AIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G   +L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRVDLLDLGPGSPSDGLSLVAPNWGVAEEPGIEMLH---GTTTLAFKFQHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|NP_001099197.2| proteasome subunit beta type-5 [Rattus norvegicus]
 gb|EDM14180.1| proteasome (prosome, macropain) subunit, beta type 5, isoform 
CRA_a [Rattus norvegicus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS+ +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PSWGVP--------EEPRIEMLH---GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>gb|ELR56586.1| Proteasome subunit beta type-5, partial [Bos mutus]
Length=266

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  113  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  172

Query  571  LY  576
            LY
Sbjct  173  LY  174


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  61   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  112



>ref|XP_004609529.1| PREDICTED: proteasome subunit beta type-5 [Sorex araneus]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 59/97 (61%), Gaps = 16/97 (16%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKP-------AKGTTTLAFIFKEGVM  278
            G  +EL D  P  PS         DG    A     P         GTTTLAF F+ GV+
Sbjct  22   GGRAELLDLGPGSPS---------DGLNLAAPSWGAPDEPKIEMLHGTTTLAFKFRHGVI  72

Query  279  VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  73   VAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_006066544.1| PREDICTED: proteasome subunit beta type-5 [Bubalus bubalis]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_005370537.1| PREDICTED: proteasome subunit beta type-5 [Microtus ochrogaster]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PGWGVP--------EESRIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_004661842.1| PREDICTED: proteasome subunit beta type-5 [Jaculus jaculus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|NP_001032701.1| proteasome subunit beta type-5 [Bos taurus]
 ref|XP_005895501.1| PREDICTED: proteasome subunit beta type-5 [Bos mutus]
 ref|XP_010829574.1| PREDICTED: proteasome subunit beta type-5 [Bison bison bison]
 sp|Q32KL2.1|PSB5_BOVIN RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Bos taurus]
 gb|AAI10040.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Bos taurus]
 tpg|DAA25764.1| TPA: proteasome subunit beta type-5 precursor [Bos taurus]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_007880004.1| hypothetical protein PFL1_04286 [Pseudozyma flocculosa PF-1]
 gb|EPQ27959.1| hypothetical protein PFL1_04286 [Pseudozyma flocculosa PF-1]
Length=331

 Score = 94.4 bits (233),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL NK RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  128  DCQYWETYLGIQCRLHELRNKERISVAAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  187

Query  571  LY  576
            L+
Sbjct  188  LF  189


 Score = 85.5 bits (210),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = +3

Query  144  EIPRV-PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            E+P V P+  +   TD D     A   +K + GTTTLAF F+ G++VA DSRA+ G YI+
Sbjct  47   ELPNVDPATFLSQYTDVDSSNPGA--KIKLSHGTTTLAFRFRGGIIVAVDSRATAGSYIA  104

Query  321  SQSVKKIIEINPYMLGTMAGGAA  389
            S +VKK+IEINPY+LGTMAGGAA
Sbjct  105  SGTVKKVIEINPYLLGTMAGGAA  127



>ref|XP_007326468.1| hypothetical protein AGABI1DRAFT_111072 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM82453.1| hypothetical protein AGABI1DRAFT_111072 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=311

 Score = 90.9 bits (224),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW   LG+ CRLHEL N+ RISV+ ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  134  DCQFWETYLGMHCRLHELRNRERISVSAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  193

Query  571  LY  576
            ++
Sbjct  194  VF  195


 Score = 89.4 bits (220),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 7/88 (8%)
 Frame = +3

Query  147  IPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            I  +P+F++P + D   F         D    +K   GTTTLAF FK GV+VA DSRA+ 
Sbjct  46   IKGIPAFKVPAVADPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATA  105

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAA  389
            G Y++S +VKK+IEINPY+LGTMAGGAA
Sbjct  106  GSYVASGTVKKVIEINPYLLGTMAGGAA  133



>ref|XP_001626004.1| predicted protein [Nematostella vectensis]
 gb|EDO33904.1| predicted protein [Nematostella vectensis]
Length=279

 Score = 94.0 bits (232),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASK+LAN++Y Y+GMGLS+GTMI G D+KGPG
Sbjct  125  DCSFWERLLAKQCRIYELRNKERISVAAASKILANMVYYYKGMGLSMGTMICGWDKKGPG  184

Query  571  LY  576
            LY
Sbjct  185  LY  186


 Score = 85.9 bits (211),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF FK GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  73   HGTTTLAFKFKHGVIVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAA  124



>ref|XP_002718121.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Oryctolagus 
cuniculus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 63/91 (69%), Gaps = 4/91 (4%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRTDLLDLGPGSPSDGLSLTAPGWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>gb|EST08741.1| 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 
[Pseudozyma brasiliensis GHG001]
Length=344

 Score = 94.7 bits (234),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL NK RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  140  DCQYWETYLGIQCRLHELRNKERISVAAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  199

Query  571  LY  576
            L+
Sbjct  200  LF  201


 Score = 85.5 bits (210),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 62/98 (63%), Gaps = 12/98 (12%)
 Frame = +3

Query  126  SSELFDEIPRVP-SFQIPNI---------TDFDGFQKDAIQMVKPAKGTTTLAFIFKEGV  275
            SS   D++   P  F +PN+         TD D    +    +K A GTTTLAF FK G+
Sbjct  44   SSSAHDQMMGAPGQFDLPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRFKGGI  101

Query  276  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            +V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAA
Sbjct  102  IVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAA  139



>ref|XP_002926051.1| PREDICTED: proteasome subunit beta type-5 [Ailuropoda melanoleuca]
 gb|EFB18962.1| hypothetical protein PANDA_015661 [Ailuropoda melanoleuca]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_006457891.1| 20S proteasome subunit [Agaricus bisporus var. bisporus H97]
 gb|EKV49845.1| 20S proteasome subunit [Agaricus bisporus var. bisporus H97]
Length=311

 Score = 90.9 bits (224),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQFW   LG+ CRLHEL N+ RISV+ ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  134  DCQFWETYLGMHCRLHELRNRERISVSAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  193

Query  571  LY  576
            ++
Sbjct  194  VF  195


 Score = 89.4 bits (220),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 7/88 (8%)
 Frame = +3

Query  147  IPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            I  +P+F++P + D   F         D    +K   GTTTLAF FK GV+VA DSRA+ 
Sbjct  46   IKGIPAFKVPAVADPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATA  105

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAA  389
            G Y++S +VKK+IEINPY+LGTMAGGAA
Sbjct  106  GSYVASGTVKKVIEINPYLLGTMAGGAA  133



>ref|XP_003474544.1| PREDICTED: proteasome subunit beta type-5 [Cavia porcellus]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_004402154.1| PREDICTED: proteasome subunit beta type-5 [Odobenus rosmarus 
divergens]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>emb|CAD97956.1| hypothetical protein [Homo sapiens]
Length=266

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  113  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  172

Query  571  LY  576
            LY
Sbjct  173  LY  174


 Score = 86.3 bits (212),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  47   PGWGVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  95

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  96   VIEINPYLLGTMAGGAA  112



>dbj|GAC98484.1| 20S proteasome subunit [Pseudozyma hubeiensis SY62]
Length=510

 Score = 94.4 bits (233),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL NK RISVA ASK L+N++YSY+GMGLS+GTMI G D+ GP 
Sbjct  220  DCQYWETYLGIQCRLHELRNKERISVAAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPA  279

Query  571  LY  576
            L+
Sbjct  280  LF  281


 Score = 85.5 bits (210),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 11/84 (13%)
 Frame = +3

Query  165  FQIPNI---------TDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            F +PN+         TD D     A   +K A GTTTLAF FK G++V  DSRA+ G YI
Sbjct  138  FDLPNMDPATFLSQYTDVDSSNPAA--KIKLAHGTTTLAFRFKGGIIVCVDSRATAGSYI  195

Query  318  SSQSVKKIIEINPYMLGTMAGGAA  389
            +S +VKK+IEINPY+LGTMAGGAA
Sbjct  196  ASGTVKKVIEINPYLLGTMAGGAA  219



>ref|XP_010636092.1| PREDICTED: proteasome subunit beta type-5 [Fukomys damarensis]
 gb|KFO27511.1| Proteasome subunit beta type-5 [Fukomys damarensis]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>gb|ESA00717.1| hypothetical protein GLOINDRAFT_338395 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64892.1| proteasome core particle subunit beta 5 [Rhizophagus irregularis 
DAOM 197198w]
Length=288

 Score = 94.7 bits (234),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R LG +CRL+EL NK RISVA ASKLLAN++Y+Y+GMGLS+GTM+AG D+ GP 
Sbjct  120  DCIFWQRELGRRCRLYELRNKERISVAAASKLLANMVYAYKGMGLSMGTMVAGWDKTGPS  179

Query  571  LY  576
            ++
Sbjct  180  IF  181


 Score = 85.1 bits (209),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 13/106 (12%)
 Frame = +3

Query  84   DFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKD----AIQMVKPAKGTTTL  251
            DF G ++    +G S   FD    VPS   PN T+F     D    A   +K   GTTTL
Sbjct  23   DFVGFDAA---KGFSLPTFD----VPS--CPNPTEFLKAHTDENSTAEYQIKLEHGTTTL  73

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            +F F+ G++VA DSRAS G +I++Q+VKK+IEINPY+LGTMAGGAA
Sbjct  74   SFKFQGGIIVAVDSRASAGSFIATQTVKKVIEINPYLLGTMAGGAA  119



>ref|XP_003987515.1| PREDICTED: proteasome subunit beta type-5 [Felis catus]
 ref|XP_007098030.1| PREDICTED: proteasome subunit beta type-5 [Panthera tigris altaica]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 4/88 (5%)
 Frame = +3

Query  129  SELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSRA+ 
Sbjct  25   ADLLDLGPGSPSDGLSLAAPHRGVPEEPRIEMLH---GTTTLAFKFQHGVIVAADSRATA  81

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAA  389
            G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  82   GAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_007385467.1| N-terminal nucleophile aminohydrolase [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN07174.1| N-terminal nucleophile aminohydrolase [Punctularia strigosozonata 
HHB-11173 SS5]
Length=317

 Score = 90.9 bits (224),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 65/105 (62%), Gaps = 8/105 (8%)
 Frame = +3

Query  99   ESTAPIRGESSELFDEIPR-VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLA  254
            E  + +   S   F  + R VP+F +PN+ D   F         D    +K   GTTTLA
Sbjct  28   EDCSDVMWGSEAGFGNLARGVPNFSVPNVPDPAAFLRLHTDDHADPSCRIKIKHGTTTLA  87

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
            F F+ GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAA
Sbjct  88   FRFQGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAA  132


 Score = 89.0 bits (219),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DCQ+W   LG++CRLHEL N+ RISVA ASK L+N++Y Y+GMGLS+GTMI G D+ GP 
Sbjct  133  DCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLVYGYKGMGLSMGTMICGWDKTGPA  192

Query  571  L  573
            +
Sbjct  193  V  193



>ref|XP_004054982.1| PREDICTED: proteasome subunit beta type-5 isoform 3 [Gorilla 
gorilla gorilla]
Length=268

 Score = 93.6 bits (231),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  115  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  174

Query  571  LY  576
            LY
Sbjct  175  LY  176


 Score = 86.3 bits (212),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  63   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  114



>ref|XP_004879937.1| PREDICTED: proteasome subunit beta type-5 [Heterocephalus glaber]
 ref|XP_004864242.1| PREDICTED: proteasome subunit beta type-5 [Heterocephalus glaber]
 gb|EHB00011.1| Proteasome subunit beta type-5 [Heterocephalus glaber]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_007180616.1| PREDICTED: proteasome subunit beta type-5 [Balaenoptera acutorostrata 
scammoni]
Length=263

 Score = 93.6 bits (231),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_010376681.1| PREDICTED: proteasome subunit beta type-5 [Rhinopithecus roxellana]
Length=271

 Score = 93.6 bits (231),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  118  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  177

Query  571  LY  576
            LY
Sbjct  178  LY  179


 Score = 86.3 bits (212),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  66   HGTTTLAFKFRHGVVVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  117



>ref|XP_004646709.1| PREDICTED: proteasome subunit beta type-5 [Octodon degus]
Length=262

 Score = 93.2 bits (230),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  109  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  168

Query  571  LY  576
            LY
Sbjct  169  LY  170


 Score = 86.3 bits (212),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  57   HGTTTLAFKFRHGVIVAADSRATAGNYIASQTVKKVIEINPYLLGTMAGGAA  108



>ref|XP_003260670.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Nomascus 
leucogenys]
 ref|XP_004091952.1| PREDICTED: proteasome subunit beta type-5 [Nomascus leucogenys]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PGWGVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_004347536.2| hypothetical protein CAOG_04785 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94093.1| hypothetical protein CAOG_004785 [Capsaspora owczarzaki ATCC 
30864]
Length=305

 Score = 90.9 bits (224),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+ MGLS+GTMI G D++GP 
Sbjct  151  DCSFWERELARRCRIYELRNKERISVAAASKLLANMVYGYKNMGLSMGTMITGWDKRGPE  210

Query  571  LY  576
            LY
Sbjct  211  LY  212


 Score = 89.0 bits (219),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 79/139 (57%), Gaps = 20/139 (14%)
 Frame = +3

Query  9    SPIVP*VESTPSFYS-RYLVVT-----MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQ  170
            +PI     STP+  S RY  ++     M   + SGL        E ++    + ++P F 
Sbjct  20   APITA-ARSTPASVSGRYAALSAEDDAMAESELSGLT-------ELNQQLGAMSQLPVFD  71

Query  171  IPNITD----FDGFQKDAIQMVKPA--KGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            +P + D       + +D    VK     GTTTLAF FK G++VA DSRA+ G YI+S +V
Sbjct  72   VPAVQDPAAFLHAYTEDPHSKVKIHIQHGTTTLAFKFKHGIIVAVDSRATGGSYIASGTV  131

Query  333  KKIIEINPYMLGTMAGGAA  389
            KK+IEINPY+LGTMAGGAA
Sbjct  132  KKVIEINPYLLGTMAGGAA  150



>ref|XP_010744420.1| PREDICTED: proteasome subunit beta type-5 [Larimichthys crocea]
Length=273

 Score = 92.8 bits (229),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTM+ G D++GPG
Sbjct  119  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMVCGWDKRGPG  178

Query  571  LY  576
            LY
Sbjct  179  LY  180


 Score = 86.7 bits (213),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 7/79 (9%)
 Frame = +3

Query  162  SFQIPN---ITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            SF + N     D DG ++     ++   GTTTLAF F+ GV+VA DSRA+ G YI+SQ+V
Sbjct  44   SFSVRNPLCAADDDGVERK----IEFLHGTTTLAFKFQHGVIVAVDSRATAGSYIASQTV  99

Query  333  KKIIEINPYMLGTMAGGAA  389
            KK+IEINPY+LGTMAGGAA
Sbjct  100  KKVIEINPYLLGTMAGGAA  118



>ref|NP_002788.1| proteasome subunit beta type-5 isoform 1 [Homo sapiens]
 ref|NP_001126063.1| proteasome subunit beta type-5 precursor [Pongo abelii]
 ref|XP_003808166.1| PREDICTED: proteasome subunit beta type-5 [Pan paniscus]
 sp|P28074.3|PSB5_HUMAN RecName: Full=Proteasome subunit beta type-5; AltName: Full=Macropain 
epsilon chain; AltName: Full=Multicatalytic endopeptidase 
complex epsilon chain; AltName: Full=Proteasome chain 
6; AltName: Full=Proteasome epsilon chain; AltName: Full=Proteasome 
subunit MB1; AltName: Full=Proteasome subunit X; Flags: 
Precursor [Homo sapiens]
 sp|Q5R8S2.3|PSB5_PONAB RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Pongo abelii]
 emb|CAA64838.1| proteasome [Homo sapiens]
 gb|AAH57840.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 emb|CAH91838.1| hypothetical protein [Pongo abelii]
 gb|AAI07721.1| Proteasome (prosome, macropain) subunit, beta type, 5 [Homo sapiens]
 gb|EAW66193.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 gb|EAW66195.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_a [Homo sapiens]
 dbj|BAG34836.1| unnamed protein product [Homo sapiens]
 dbj|BAI47149.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
 gb|ADQ33015.1| proteasome (prosome, macropain) subunit, beta type, 5 [synthetic 
construct]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PGWGVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



>ref|XP_008838115.1| PREDICTED: proteasome subunit beta type-5 [Nannospalax galili]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.7 bits (213),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAA  389
             GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAA
Sbjct  58   HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA  109



>ref|XP_004054980.1| PREDICTED: proteasome subunit beta type-5 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004054981.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004054983.1| PREDICTED: proteasome subunit beta type-5 isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004054984.1| PREDICTED: proteasome subunit beta type-5 isoform 5 [Gorilla 
gorilla gorilla]
Length=263

 Score = 93.2 bits (230),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  DCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLSVGTMIAGSDEKGPG  570
            DC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS+GTMI G D++GPG
Sbjct  110  DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPG  169

Query  571  LY  576
            LY
Sbjct  170  LY  171


 Score = 86.3 bits (212),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 11/77 (14%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PGWGVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAA  389
            +IEINPY+LGTMAGGAA
Sbjct  93   VIEINPYLLGTMAGGAA  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985