BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006K19

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     280   2e-91   Nicotiana sylvestris
ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     273   7e-89   Nicotiana tomentosiformis
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     268   5e-87   Nicotiana sylvestris
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     267   9e-87   Nicotiana tomentosiformis
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    266   2e-86   Solanum tuberosum [potatoes]
ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          266   3e-86   Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     265   9e-86   Solanum tuberosum [potatoes]
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          256   2e-82   Vitis vinifera
gb|KJB15718.1|  hypothetical protein B456_002G192400                    255   6e-82   Gossypium raimondii
gb|KHG25400.1|  Proteasome subunit beta type-5                          254   9e-82   Gossypium arboreum [tree cotton]
gb|KHG05622.1|  Proteasome subunit beta type-5                          254   1e-81   Gossypium arboreum [tree cotton]
gb|KJB78067.1|  hypothetical protein B456_012G175200                    254   2e-81   Gossypium raimondii
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          253   3e-81   
gb|KDP26783.1|  hypothetical protein JCGZ_17941                         253   3e-81   Jatropha curcas
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          253   5e-81   Pyrus x bretschneideri [bai li]
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     253   6e-81   Sesamum indicum [beniseed]
ref|XP_007045045.1|  N-terminal nucleophile aminohydrolases (Ntn ...    250   6e-81   
emb|CDP13326.1|  unnamed protein product                                254   7e-81   Coffea canephora [robusta coffee]
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5-like     252   8e-81   Cucumis sativus [cucumbers]
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          251   3e-80   Prunus mume [ume]
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          250   4e-80   Cucumis melo [Oriental melon]
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    250   4e-80   
gb|EPS61043.1|  hypothetical protein M569_13757                         250   5e-80   Genlisea aurea
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             249   9e-80   Prunus persica
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          249   1e-79   Beta vulgaris subsp. vulgaris [field beet]
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    249   1e-79   Spinacia oleracea
gb|KCW61971.1|  hypothetical protein EUGRSUZ_H04655                     245   4e-79   Eucalyptus grandis [rose gum]
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             248   5e-79   Eutrema salsugineum [saltwater cress]
ref|XP_010105786.1|  Proteasome subunit beta type-5                     247   1e-78   Morus notabilis
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     246   2e-78   
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        246   3e-78   Eucalyptus grandis [rose gum]
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     245   5e-78   Pyrus x bretschneideri [bai li]
gb|AAT44125.1|  20S proteasome beta subunit E                           240   6e-78   Saussurea medusa
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             245   7e-78   Capsella rubella
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        244   9e-78   Camelina sativa [gold-of-pleasure]
ref|NP_189265.1|  proteasome subunit beta type-5-B                      244   9e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    244   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_002312631.2|  20S proteasome beta subunit family protein         244   1e-77   
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    244   2e-77   Populus euphratica
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                243   2e-77   Erythranthe guttata [common monkey flower]
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    243   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          243   3e-77   Nelumbo nucifera [Indian lotus]
emb|CDY26610.1|  BnaA09g46670D                                          243   4e-77   Brassica napus [oilseed rape]
emb|CDY16054.1|  BnaC08g40690D                                          243   5e-77   Brassica napus [oilseed rape]
emb|CDY21081.1|  BnaA08g24440D                                          243   5e-77   Brassica napus [oilseed rape]
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    243   5e-77   Brassica rapa
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        243   5e-77   Brassica rapa
emb|CDY34594.1|  BnaC03g56940D                                          243   6e-77   Brassica napus [oilseed rape]
emb|CDX98014.1|  BnaA06g07650D                                          242   6e-77   
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        242   8e-77   Tarenaya hassleriana [spider flower]
emb|CDY19402.1|  BnaC05g09110D                                          241   1e-76   Brassica napus [oilseed rape]
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             241   2e-76   Eutrema salsugineum [saltwater cress]
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    241   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     240   4e-76   Glycine max [soybeans]
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     239   8e-76   Phoenix dactylifera
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             239   1e-75   
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             239   1e-75   Phaseolus vulgaris [French bean]
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     238   2e-75   Nelumbo nucifera [Indian lotus]
gb|KHN31904.1|  Proteasome subunit beta type-5                          238   2e-75   Glycine soja [wild soybean]
gb|ACU23791.1|  unknown                                                 238   2e-75   Glycine max [soybeans]
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     238   4e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006842100.1|  hypothetical protein AMTR_s00078p00083100          238   4e-75   
gb|AFK46055.1|  unknown                                                 236   1e-74   Lotus japonicus
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     236   1e-74   Elaeis guineensis
gb|KDO81953.1|  hypothetical protein CISIN_1g022125mg                   234   2e-74   Citrus sinensis [apfelsine]
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    236   2e-74   Glycine max [soybeans]
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     235   3e-74   Elaeis guineensis
gb|ABK25888.1|  unknown                                                 235   4e-74   Picea sitchensis
gb|ACJ85344.1|  unknown                                                 234   5e-74   Medicago truncatula
gb|AFK38197.1|  unknown                                                 234   6e-74   Medicago truncatula
gb|KDO81951.1|  hypothetical protein CISIN_1g022125mg                   236   6e-74   Citrus sinensis [apfelsine]
ref|XP_003602092.1|  Proteasome subunit beta type                       234   7e-74   Medicago truncatula
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    234   7e-74   Brassica rapa
gb|ACP43315.1|  20S proteasome beta subunit 5                           234   8e-74   Citrus maxima [buntan]
ref|XP_002315619.1|  20S proteasome beta subunit family protein         234   8e-74   Populus trichocarpa [western balsam poplar]
ref|XP_006484069.1|  PREDICTED: proteasome subunit beta type-5-B-...    235   1e-73   Citrus sinensis [apfelsine]
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    234   1e-73   Citrus sinensis [apfelsine]
gb|ABK25785.1|  unknown                                                 234   1e-73   Picea sitchensis
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    234   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    234   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     233   2e-73   Cucumis sativus [cucumbers]
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        233   2e-73   Camelina sativa [gold-of-pleasure]
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       234   2e-73   Cucumis sativus [cucumbers]
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    233   2e-73   Populus euphratica
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg             233   2e-73   
ref|XP_006438070.1|  hypothetical protein CICLE_v10032238mg             234   2e-73   
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     233   2e-73   Phoenix dactylifera
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             233   3e-73   Citrus clementina [clementine]
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             233   3e-73   Capsella rubella
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     233   4e-73   Fragaria vesca subsp. vesca
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             233   4e-73   
gb|AFK34329.1|  unknown                                                 233   4e-73   Medicago truncatula
ref|NP_172765.1|  20S proteasome beta subunit E1                        231   9e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAK92808.1|  putative proteasome epsilon chain precursor             231   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative         229   4e-72   
ref|XP_010440898.1|  PREDICTED: proteasome subunit beta type-5-B-...    225   7e-72   
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     218   3e-67   Elaeis guineensis
ref|NP_001184978.1|  20S proteasome beta subunit E1                     218   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     216   2e-66   Phoenix dactylifera
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    212   5e-65   Oryza brachyantha
gb|ACU51028.1|  20S proteasome beta5 subunit                            211   1e-64   Conocephalum conicum
gb|AFW85805.1|  hypothetical protein ZEAMMB73_646691                    207   4e-64   
ref|XP_001759925.1|  predicted protein                                  209   6e-64   
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    207   2e-63   
ref|NP_001132821.1|  uncharacterized protein LOC100194311               207   5e-63   Zea mays [maize]
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    206   9e-63   Setaria italica
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       205   2e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          205   3e-62   Sorghum bicolor [broomcorn]
gb|EEE65108.1|  hypothetical protein OsJ_20167                          204   4e-62   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056842.1|  Os06g0153800                                       204   5e-62   
gb|EEC80034.1|  hypothetical protein OsI_21721                          204   6e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             199   3e-60   Selaginella moellendorffii
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             199   4e-60   Selaginella moellendorffii
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    198   1e-59   Brachypodium distachyon [annual false brome]
gb|AAT80906.1|  26S proteasome beta subunit                             192   3e-59   Lemna minor
gb|AAU82107.1|  20S proteasome beta 5 subunit                           196   8e-59   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ97061.1|  predicted protein                                      194   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001751936.1|  predicted protein                                  187   6e-56   
gb|ABQ50544.1|  hypothetical protein                                    183   1e-54   Brassica rapa
dbj|BAG92607.1|  unnamed protein product                                183   2e-54   Oryza sativa Japonica Group [Japonica rice]
gb|ABD61730.2|  26S proteasome beta subunit                             178   1e-53   Lupinus albus
gb|EMS57921.1|  Proteasome subunit beta type-5                          179   6e-53   Triticum urartu
ref|XP_003061052.1|  predicted protein                                  179   3e-52   Micromonas pusilla CCMP1545
ref|XP_001421201.1|  predicted protein                                  179   3e-52   Ostreococcus lucimarinus CCE9901
ref|XP_007514496.1|  predicted protein                                  179   6e-52   Bathycoccus prasinos
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        189   8e-52   
ref|XP_002506817.1|  predicted protein                                  177   3e-51   Micromonas commoda
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...    176   7e-51   Ostreococcus tauri
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5         176   7e-51   Coccomyxa subellipsoidea C-169
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983              171   4e-49   Chlorella variabilis
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437              168   5e-48   Volvox carteri f. nagariensis
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5         168   5e-48   Chlamydomonas reinhardtii
ref|XP_011396916.1|  Proteasome subunit beta type-5-B                   166   2e-47   Auxenochlorella protothecoides
ref|XP_002889983.1|  hypothetical protein ARALYDRAFT_888660             157   2e-45   
gb|KDD75121.1|  proteasome subunit protein                              159   7e-45   Helicosporidium sp. ATCC 50920
ref|NP_001265983.1|  proteasome subunit beta type-5-like                156   6e-44   Cicer arietinum [garbanzo]
gb|EIE77859.1|  proteasome component PRE2                               157   8e-44   Rhizopus delemar RA 99-880
ref|XP_002678668.1|  predicted protein                                  157   1e-43   Naegleria gruberi strain NEG-M
emb|CEG76258.1|  Putative Proteasome subunit beta type                  153   1e-42   Rhizopus microsporus
dbj|GAN10935.1|  20S proteasome subunit                                 154   1e-42   Mucor ambiguus
gb|EPB87271.1|  proteasome component PRE2                               154   2e-42   Mucor circinelloides f. circinelloides 1006PhL
emb|CEP17612.1|  hypothetical protein                                   154   2e-42   Parasitella parasitica
emb|CEG76257.1|  Putative Proteasome subunit beta type                  153   2e-42   Rhizopus microsporus
emb|CEJ04297.1|  Putative Proteasome subunit beta type                  150   5e-42   Rhizopus microsporus
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        149   2e-41   Prunus persica
emb|CDH56820.1|  20s proteasome subunit                                 151   2e-41   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_009038619.1|  hypothetical protein AURANDRAFT_28593              151   2e-41   Aureococcus anophagefferens
emb|CBY21147.1|  unnamed protein product                                151   3e-41   Oikopleura dioica
ref|XP_002290272.1|  proteasome subunit beta type 5 precursor           150   3e-41   Thalassiosira pseudonana CCMP1335
ref|XP_006957104.1|  20S proteasome subunit                             150   4e-41   Wallemia mellicola CBS 633.66
ref|XP_009265754.1|  Proteasome component PRE2                          150   6e-41   Wallemia ichthyophaga EXF-994
ref|XP_007006996.1|  hypothetical protein TREMEDRAFT_34309              150   9e-41   Tremella mesenterica DSM 1558
ref|XP_005537552.1|  20S core proteasome subunit beta 5                 150   1e-40   Cyanidioschyzon merolae strain 10D
gb|EJU05281.1|  proteasome-domain-containing protein                    150   1e-40   Dacryopinax primogenitus
gb|KFH71396.1|  20S proteasome subunit beta 5                           148   2e-40   Mortierella verticillata NRRL 6337
emb|CAC43326.1|  putative beta5 proteasome subunit                      145   2e-40   Nicotiana tabacum [American tobacco]
ref|XP_008036606.1|  proteasome component pts1                          149   2e-40   Trametes versicolor FP-101664 SS1
ref|XP_001730616.1|  hypothetical protein MGL_2412                      148   3e-40   Malassezia globosa CBS 7966
gb|ABE68720.1|  20S proteasome beta subunit                             146   4e-40   Arachis hypogaea [goober]
emb|CCM00020.1|  predicted protein                                      147   7e-40   Fibroporia radiculosa
gb|KIY65291.1|  proteasome-domain-containing protein                    148   7e-40   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_007863011.1|  20S proteasome subunit                             148   8e-40   Gloeophyllum trabeum ATCC 11539
ref|XP_007395513.1|  hypothetical protein PHACADRAFT_255622             147   8e-40   Phanerochaete carnosa HHB-10118-sp
ref|XP_002111558.1|  hypothetical protein TRIADDRAFT_55706              147   8e-40   Trichoplax adhaerens
gb|KDQ60928.1|  hypothetical protein JAAARDRAFT_125152                  147   1e-39   Jaapia argillacea MUCL 33604
gb|EJK48257.1|  hypothetical protein THAOC_32963                        146   1e-39   Thalassiosira oceanica
emb|CCU99044.1|  unnamed protein product                                146   1e-39   Malassezia sympodialis ATCC 42132
gb|KDE05583.1|  proteasome component PRE2                               147   1e-39   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_002162379.2|  PREDICTED: proteasome subunit beta type-5-like     146   1e-39   Hydra vulgaris
ref|XP_007385467.1|  N-terminal nucleophile aminohydrolase              147   1e-39   Punctularia strigosozonata HHB-11173 SS5
gb|AAM18885.1|AF391293_2  unknown                                       146   1e-39   Branchiostoma floridae
ref|XP_005713380.1|  20S core proteasome subunit beta 5                 146   2e-39   Chondrus crispus [carageen]
ref|XP_002179855.1|  predicted protein                                  146   2e-39   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007326468.1|  hypothetical protein AGABI1DRAFT_111072            146   3e-39   Agaricus bisporus var. burnettii JB137-S8
emb|CCF49354.1|  probable PRE2-20S core proteasome subunit (beta5)      147   3e-39   Ustilago hordei
ref|XP_006457891.1|  20S proteasome subunit                             146   3e-39   Agaricus bisporus var. bisporus H97
gb|EIF47547.1|  proteasome component pre2 precursor                     145   3e-39   Brettanomyces bruxellensis AWRI1499
emb|CCO27714.1|  20S proteasome subunit beta 5                          146   3e-39   Rhizoctonia solani AG-1 IB
gb|KDQ33416.1|  hypothetical protein PLEOSDRAFT_1110569                 146   3e-39   Pleurotus ostreatus PC15
gb|EJT45706.1|  proteasome component                                    145   4e-39   Trichosporon asahii var. asahii CBS 2479
gb|EKD04801.1|  proteasome component                                    145   4e-39   Trichosporon asahii var. asahii CBS 8904
gb|KII89158.1|  hypothetical protein PLICRDRAFT_109139                  146   4e-39   Plicaturopsis crispa FD-325 SS-3
emb|CBN74512.1|  conserved unknown protein                              145   4e-39   Ectocarpus siliculosus
gb|KDR73611.1|  hypothetical protein GALMADRAFT_124865                  146   4e-39   Galerina marginata CBS 339.88
gb|KIK59625.1|  hypothetical protein GYMLUDRAFT_201809                  145   5e-39   Gymnopus luxurians FD-317 M1
ref|XP_007361365.1|  N-terminal nucleophile aminohydrolase              145   5e-39   Dichomitus squalens LYAD-421 SS1
ref|XP_003332961.2|  20S proteasome subunit beta 5                      145   5e-39   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|KFY06285.1|  hypothetical protein V491_08732                         141   5e-39   Pseudogymnoascus sp. VKM F-3775
gb|KIK08153.1|  hypothetical protein K443DRAFT_672633                   145   6e-39   Laccaria amethystina LaAM-08-1
gb|KIM65350.1|  hypothetical protein SCLCIDRAFT_542814                  145   6e-39   Scleroderma citrinum Foug A
gb|KIJ17479.1|  hypothetical protein PAXINDRAFT_168130                  145   6e-39   Paxillus involutus ATCC 200175
ref|XP_007100520.1|  PREDICTED: proteasome subunit beta type-5 is...    142   6e-39   
ref|XP_007418509.1|  20S proteasome subunit                             145   7e-39   Melampsora larici-populina 98AG31
ref|XP_007764597.1|  20S proteasome subunit                             145   7e-39   Coniophora puteana RWD-64-598 SS2
ref|XP_001875479.1|  20S proteasome subunit                             145   8e-39   Laccaria bicolor S238N-H82
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5          144   8e-39   Otolemur garnettii
gb|AAS01050.1|  putative proteasome 20S beta5 subunit                   140   8e-39   Brassica napus [oilseed rape]
ref|XP_007850837.1|  proteasome component pre2 precursor                145   8e-39   
gb|EUC61688.1|  proteasome subunit beta type-5 protein                  145   9e-39   Rhizoctonia solani AG-3 Rhs1AP
gb|KEP54479.1|  proteasome subunit beta type-5 protein                  145   9e-39   Rhizoctonia solani 123E
gb|EMS25821.1|  20S proteasome subunit beta 5                           144   1e-38   Rhodotorula toruloides NP11
ref|XP_004347536.2|  hypothetical protein CAOG_04785                    145   1e-38   Capsaspora owczarzaki ATCC 30864
gb|KIL00906.1|  hypothetical protein PAXRUDRAFT_821100                  145   1e-38   Paxillus rubicundulus Ve08.2h10
ref|XP_007723577.1|  proteasome component PRE2                          144   1e-38   Capronia coronata CBS 617.96
gb|KIW62885.1|  proteasome subunit beta type-5                          144   1e-38   Phialophora americana
gb|KJA27011.1|  hypothetical protein HYPSUDRAFT_35526                   145   1e-38   Hypholoma sublateritium FD-334 SS-4
emb|CDO73558.1|  hypothetical protein BN946_scf185014.g28               145   1e-38   Trametes cinnabarina
ref|XP_002911819.1|  proteasome component pts1                          145   1e-38   Coprinopsis cinerea okayama7#130
ref|XP_007449603.1|  PREDICTED: proteasome subunit beta type-5 is...    142   1e-38   Lipotes vexillifer [baiji]
ref|XP_004283229.1|  PREDICTED: proteasome subunit beta type-5 is...    142   1e-38   
gb|EWM22648.1|  proteasome subunit beta type 5                          144   1e-38   Nannochloropsis gaditana
gb|KIJ69319.1|  hypothetical protein HYDPIDRAFT_79749                   144   1e-38   Hydnomerulius pinastri MD-312
ref|XP_006746559.1|  PREDICTED: proteasome subunit beta type-5          140   1e-38   Leptonychotes weddellii
ref|XP_002730946.1|  PREDICTED: proteasome subunit beta type-5-like     144   1e-38   Saccoglossus kowalevskii
ref|XP_007880004.1|  hypothetical protein PFL1_04286                    145   1e-38   Anthracocystis flocculosa PF-1
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                  144   2e-38   
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative         143   2e-38   Acanthamoeba castellanii str. Neff
gb|EWC46740.1|  proteasome component PRE2                               143   2e-38   Drechslerella stenobrocha 248
gb|EST08741.1|  20S proteasome, regulatory subunit beta type PSMB...    145   2e-38   Kalmanozyma brasiliensis GHG001
gb|KFH47961.1|  Proteasome subunit beta type-like protein               143   2e-38   Acremonium chrysogenum ATCC 11550
gb|KIW59603.1|  proteasome subunit beta type-5                          143   2e-38   Exophiala xenobiotica
ref|XP_628966.1|  proteasome subunit beta type 5                        143   2e-38   Dictyostelium discoideum AX4
ref|XP_008731643.1|  proteasome component PRE2                          143   2e-38   Cladophialophora carrionii CBS 160.54
gb|EAW66194.1|  proteasome (prosome, macropain) subunit, beta typ...    139   2e-38   Homo sapiens [man]
ref|XP_008156743.1|  PREDICTED: proteasome subunit beta type-5 is...    141   3e-38   
gb|ELU16739.1|  hypothetical protein CAPTEDRAFT_41193                   139   3e-38   Capitella teleta
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                  143   3e-38   Capitella teleta
ref|XP_007761346.1|  proteasome component PRE2                          143   3e-38   Cladophialophora yegresii CBS 114405
ref|XP_007321997.1|  hypothetical protein SERLADRAFT_475676             144   3e-38   Serpula lacrymans var. lacrymans S7.9
ref|XP_007739562.1|  proteasome component PRE2                          143   3e-38   Cladophialophora psammophila CBS 110553
gb|KIX98319.1|  proteasome subunit beta type-5                          143   3e-38   Fonsecaea multimorphosa CBS 102226
gb|KIW29970.1|  proteasome subunit beta type-5                          143   3e-38   Cladophialophora immunda
gb|KDQ18004.1|  hypothetical protein BOTBODRAFT_104582                  144   3e-38   Botryobasidium botryosum FD-172 SS1
ref|XP_006696296.1|  hypothetical protein CTHT_0059780                  143   3e-38   Chaetomium thermophilum var. thermophilum DSM 1495
gb|KIW80298.1|  hypothetical protein Z517_06913                         143   3e-38   Fonsecaea pedrosoi CBS 271.37
ref|XP_007730075.1|  proteasome component PRE2                          143   3e-38   Capronia epimyces CBS 606.96
emb|CDI55907.1|  probable PRE2-20S core proteasome subunit (beta5...    144   3e-38   Melanopsichium pennsylvanicum 4
gb|KIO13433.1|  hypothetical protein M404DRAFT_122218                   143   3e-38   Pisolithus tinctorius Marx 270
gb|KIW10869.1|  proteasome subunit beta type-5                          143   3e-38   Exophiala spinifera
gb|KIP12266.1|  hypothetical protein PHLGIDRAFT_17679                   143   4e-38   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_009541838.1|  subunit beta type peptidase T1A, 20S proteasome    143   4e-38   Heterobasidion irregulare TC 32-1
ref|XP_007319616.1|  hypothetical protein SERLADRAFT_470232             144   4e-38   Serpula lacrymans var. lacrymans S7.9
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510              142   4e-38   Batrachochytrium dendrobatidis JAM81
ref|XP_009160370.1|  proteasome component PRE2                          142   4e-38   Exophiala dermatitidis NIH/UT8656
gb|KIW41006.1|  proteasome subunit beta type-5                          142   4e-38   Exophiala oligosperma
ref|XP_007821942.1|  hypothetical protein MAA_05753                     142   4e-38   Metarhizium robertsii ARSEF 23
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...    142   4e-38   Physeter catodon
ref|XP_007989006.1|  PREDICTED: proteasome subunit beta type-5 is...    140   4e-38   Chlorocebus sabaeus
emb|CAA66313.1|  LMP7-like protein                                      142   5e-38   Botryllus schlosseri
gb|EPS96804.1|  hypothetical protein FOMPIDRAFT_1025230                 143   5e-38   Fomitopsis pinicola FP-58527 SS1
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5          142   5e-38   Carlito syrichta
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...    140   5e-38   
gb|KIV81807.1|  proteasome subunit beta type-5                          142   5e-38   Exophiala sideris
ref|XP_009209435.1|  PREDICTED: proteasome subunit beta type-5 is...    140   5e-38   Papio anubis [baboon]
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5          142   5e-38   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005267928.1|  PREDICTED: proteasome subunit beta type-5 is...    139   6e-38   
ref|NP_593825.1|  20S proteasome component beta 5                       142   6e-38   Schizosaccharomyces pombe
dbj|GAM85683.1|  hypothetical protein ANO11243_036910                   142   6e-38   fungal sp. No.11243
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5          141   6e-38   Dasypus novemcinctus
ref|XP_011276949.1|  Proteasome subunit beta type-5                     142   6e-38   Wickerhamomyces ciferrii
ref|XP_011123539.1|  hypothetical protein AOL_s00083g57                 142   6e-38   Arthrobotrys oligospora ATCC 24927
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...    141   6e-38   Lipotes vexillifer [baiji]
dbj|BAA06097.1|  proteasome subunit X                                   140   6e-38   Homo sapiens [man]
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...    141   7e-38   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...    140   7e-38   
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...    141   7e-38   Orcinus orca [Orca]
ref|XP_004755395.1|  PREDICTED: proteasome subunit beta type-5 is...    140   7e-38   
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...    140   7e-38   synthetic construct
ref|XP_005560889.1|  PREDICTED: proteasome subunit beta type-5 is...    140   7e-38   
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5          141   7e-38   Myotis davidii
ref|XP_003363600.1|  PREDICTED: proteasome subunit beta type-5 is...    140   7e-38   
gb|KIY43500.1|  N-terminal nucleophile aminohydrolase                   142   8e-38   Fistulina hepatica ATCC 64428
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5          141   8e-38   Myotis lucifugus
gb|KIM79653.1|  hypothetical protein PILCRDRAFT_823192                  142   9e-38   Piloderma croceum F 1598
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5          140   9e-38   
gb|KIK46362.1|  hypothetical protein CY34DRAFT_420304                   142   9e-38   Suillus luteus UH-Slu-Lm8-n1
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...    141   9e-38   Eptesicus fuscus
ref|XP_003036093.1|  hypothetical protein SCHCODRAFT_81440              142   1e-37   Schizophyllum commune H4-8
gb|KFH65162.1|  20S proteasome subunit beta 5                           141   1e-37   Mortierella verticillata NRRL 6337
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...    141   1e-37   
ref|XP_011391773.1|  putative proteasome core particle subunit be...    141   1e-37   
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...    141   1e-37   
gb|ACP43316.1|  20S proteasome beta subunit 5                           139   1e-37   
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5          141   1e-37   
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like     141   1e-37   
emb|CBK22690.2|  unnamed protein product                                141   1e-37   
gb|KHN95162.1|  proteasome component PRE2 precursor                     141   1e-37   
gb|EMD38457.1|  20S proteasome subunit                                  142   1e-37   
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5          140   1e-37   
gb|KEF54386.1|  proteasome component PRE2                               141   1e-37   
ref|XP_006040730.1|  PREDICTED: proteasome subunit beta type-5-like     139   1e-37   
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5          140   1e-37   
emb|CDK27355.1|  unnamed protein product                                141   1e-37   
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5          140   2e-37   
ref|XP_003260674.1|  PREDICTED: proteasome subunit beta type-5 is...    139   2e-37   
ref|XP_008718323.1|  hypothetical protein HMPREF1541_05764              141   2e-37   
ref|NP_001138404.1|  proteasome subunit beta type-5 isoform 3           139   2e-37   
ref|XP_004609529.1|  PREDICTED: proteasome subunit beta type-5          140   2e-37   
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5          140   2e-37   
emb|CAD62626.1|  unnamed protein product                                139   2e-37   
gb|KIL61310.1|  hypothetical protein M378DRAFT_861259                   141   2e-37   
ref|XP_003954551.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    139   2e-37   
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5          140   2e-37   
emb|CDR40695.1|  CYFA0S05e03378g1_1                                     141   2e-37   
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5          140   2e-37   
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...    140   2e-37   
ref|XP_003287743.1|  proteasome subunit beta type 5                     140   2e-37   
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...    140   2e-37   
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5          140   2e-37   
ref|XP_009242876.1|  PREDICTED: proteasome subunit beta type-5-like     140   2e-37   
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...    140   2e-37   
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5          140   2e-37   
ref|XP_010887405.1|  PREDICTED: proteasome subunit beta type-5 is...    138   2e-37   
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...    140   2e-37   
gb|KFY29536.1|  hypothetical protein V493_02281                         142   2e-37   
ref|NP_001247774.1|  proteasome subunit beta type-5                     140   3e-37   
ref|XP_790345.2|  PREDICTED: proteasome subunit beta type-5-like        139   3e-37   
dbj|BAA08204.1|  proteasome subunit RCX                                 138   3e-37   
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                  138   3e-37   
gb|KEQ89998.1|  proteasome-domain-containing protein                    140   3e-37   
emb|CCE27886.1|  probable 20S core proteasome subunit PRE2              140   3e-37   
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5          140   3e-37   
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223             140   3e-37   
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit               141   3e-37   
gb|KEQ99430.1|  hypothetical protein AUEXF2481DRAFT_76056               140   3e-37   
gb|KIV93101.1|  proteasome subunit beta type-5                          140   3e-37   
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5          140   3e-37   
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5          140   3e-37   
emb|CCX09778.1|  Similar to Proteasome component PRE2; acc. no. P...    140   3e-37   
gb|KEQ71620.1|  proteasome-domain-containing protein                    140   3e-37   
ref|XP_005825075.1|  20S proteasome subunit beta type 5                 140   3e-37   
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5          140   3e-37   
ref|XP_002835466.1|  hypothetical protein                               140   3e-37   
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like     140   3e-37   
emb|CDQ73519.1|  unnamed protein product                                139   3e-37   
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...    138   3e-37   
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5          140   3e-37   
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...    140   3e-37   
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5          140   3e-37   
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5          139   3e-37   
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5          140   4e-37   
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like     140   4e-37   
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371              139   4e-37   
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5          139   4e-37   
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5          139   4e-37   
ref|XP_005139397.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    139   4e-37   
ref|NP_001032701.1|  proteasome subunit beta type-5                     139   4e-37   
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like     140   4e-37   
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5          139   4e-37   
ref|XP_007772248.1|  proteasome component pts1                          140   4e-37   
gb|ELR56586.1|  Proteasome subunit beta type-5                          139   4e-37   
gb|AAB33092.1|  proteasome subunit MB1                                  138   4e-37   
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like     140   4e-37   
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1              139   4e-37   
ref|NP_001099197.2|  proteasome subunit beta type-5                     139   4e-37   
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5          139   4e-37   
gb|KEQ58949.1|  proteasome-domain-containing protein                    140   4e-37   
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5          139   4e-37   
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5          139   4e-37   
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5          139   4e-37   
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...    139   4e-37   
emb|CAD97956.1|  hypothetical protein                                   139   5e-37   
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...    139   5e-37   
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...    139   5e-37   
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5          139   5e-37   
dbj|GAA98585.1|  hypothetical protein E5Q_05272                         140   5e-37   
gb|AAB87680.1|  proteasome subunit X                                    138   5e-37   
ref|XP_455453.1|  hypothetical protein                                  140   5e-37   
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5          139   5e-37   
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5          139   5e-37   
dbj|GAC98484.1|  20S proteasome subunit                                 143   5e-37   
ref|XP_007300583.1|  N-terminal nucleophile aminohydrolase              140   6e-37   
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5          139   6e-37   
ref|XP_005707411.1|  20S proteasome subunit beta 5                      139   6e-37   
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5          139   6e-37   
gb|KIX03620.1|  hypothetical protein Z518_07173                         139   6e-37   
gb|AAD53518.1|AF155578_1  proteasome subunit beta 5                     139   7e-37   
gb|ELR08191.1|  20S proteasome subunit beta 5                           139   7e-37   
ref|XP_004181237.1|  hypothetical protein TBLA_0F01760                  139   7e-37   
emb|CCA68455.1|  probable PRE2-20S core proteasome subunit (beta5...    139   7e-37   
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like     139   8e-37   
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor                137   8e-37   
emb|CAQ14651.1|  proteasome (prosome, macropain) subunit, beta ty...    139   8e-37   
gb|AAI53590.1|  Psmb5 protein                                           139   8e-37   
emb|CBQ69839.1|  probable PRE2-20S core proteasome subunit (beta5)      140   8e-37   
ref|NP_571226.1|  proteasome subunit beta type-5                        139   9e-37   
gb|KIJ35744.1|  hypothetical protein M422DRAFT_180410                   136   9e-37   
ref|XP_010887395.1|  PREDICTED: proteasome subunit beta type-5 is...    137   9e-37   
gb|KEZ44601.1|  Proteasome subunit beta type-5                          139   9e-37   
gb|AAI55951.1|  LOC100127332 protein                                    138   9e-37   
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5          138   1e-36   
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...    138   1e-36   
dbj|BAE93066.1|  low molecular mass polypeptide                         137   1e-36   
gb|EPQ17641.1|  Proteasome subunit beta type-5                          140   1e-36   
emb|CEJ94974.1|  Putative Proteasome subunit beta type                  139   1e-36   
gb|EPX73009.1|  20S proteasome component beta 5                         138   1e-36   
ref|XP_003667884.1|  hypothetical protein NDAI_0A04860                  139   1e-36   
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5          138   1e-36   
ref|XP_005809292.1|  PREDICTED: proteasome subunit beta type-5-like     138   1e-36   
ref|XP_009226325.1|  proteasome component PRE2                          139   1e-36   
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5          138   1e-36   
emb|CDF89695.1|  ZYBA0S04-10418g1_1                                     139   1e-36   
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5          138   1e-36   
gb|EPY52403.1|  20S proteasome component beta 5                         138   1e-36   
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5          138   1e-36   
emb|CDH13818.1|  Proteasome component PRE2                              139   1e-36   
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5          138   1e-36   
dbj|BAO38798.1|  proteasome component PRE2                              138   2e-36   
ref|XP_001509497.1|  PREDICTED: proteasome subunit beta type-5          138   2e-36   
emb|CDH08668.1|  Proteasome component PRE2                              138   2e-36   
gb|AAY98499.1|  LMP X                                                   138   2e-36   
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5          138   2e-36   
ref|XP_002494106.1|  Beta 5 subunit of the 20S proteasome, respon...    138   2e-36   
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...    136   2e-36   
gb|EDZ68701.1|  YPR103Wp-like protein                                   138   2e-36   
gb|AGO10225.1|  AaceriAEL326Cp                                          138   2e-36   
gb|ADO27969.1|  proteasome subunit beta type-5                          138   2e-36   
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5    138   2e-36   
ref|XP_002139075.1|  proteasome subunit beta type 5 precursor           138   2e-36   
gb|EMF13044.1|  proteasome subunit beta type-5 precursor                138   2e-36   
ref|XP_003674083.1|  hypothetical protein NCAS_0A11440                  138   2e-36   
ref|NP_035316.1|  proteasome subunit beta type-5                        138   2e-36   
ref|XP_003851747.1|  proteasome core particle subunit beta 5            138   2e-36   
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5          138   2e-36   
gb|KJE01830.1|  proteasome subunit beta type-5                          139   2e-36   
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...    138   2e-36   
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...    137   2e-36   
emb|CCE40402.1|  hypothetical protein CPAR2_104380                      138   2e-36   
gb|EGA56393.1|  Pre2p                                                   138   2e-36   
ref|XP_010870425.1|  PREDICTED: proteasome subunit beta type-5-like     138   2e-36   
ref|XP_002132107.1|  PREDICTED: proteasome subunit beta type-5          138   2e-36   
emb|CDQ73245.1|  unnamed protein product                                138   2e-36   
emb|CEP63642.1|  LALA0S08e07294g1_1                                     138   2e-36   
gb|KIR99960.1|  proteasome subunit beta type-5                          139   2e-36   
ref|XP_714824.1|  hypothetical protein CaO19.2233                       138   2e-36   
gb|ACH85299.1|  proteasome (prosome, macropain) subunit beta type 5     138   2e-36   
gb|KGQ95684.1|  proteasome component PRE2                               138   2e-36   
gb|KGR00284.1|  proteasome component PRE2                               138   2e-36   
ref|XP_003194765.1|  proteasome component                               139   2e-36   
ref|XP_007928014.1|  hypothetical protein MYCFIDRAFT_55997              138   2e-36   
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5          137   2e-36   
ref|XP_571562.1|  proteasome component pts1                             138   2e-36   
emb|CDO95704.1|  unnamed protein product                                138   2e-36   
ref|XP_007676937.1|  hypothetical protein BAUCODRAFT_70978              138   2e-36   
ref|XP_006963913.1|  proteasome catalytic subunit 3                     138   2e-36   
gb|ACM08758.1|  Proteasome subunit beta type-5 precursor                137   2e-36   
gb|ACM08263.1|  Proteasome subunit beta type-5 precursor                137   2e-36   
gb|ACI67172.1|  Proteasome subunit beta type-5 precursor                137   2e-36   
gb|KGK36555.1|  hypothetical protein JL09_g4296                         138   2e-36   
ref|XP_003680654.1|  hypothetical protein TDEL_0C05540                  138   2e-36   
ref|XP_008027551.1|  hypothetical protein SETTUDRAFT_163798             138   2e-36   
ref|XP_007683699.1|  hypothetical protein COCMIDRAFT_83732              138   2e-36   
ref|XP_002176036.2|  20S proteasome component beta 5                    137   2e-36   
gb|AAA34906.1|  proteosome-related protein                              138   2e-36   
gb|EEH19404.1|  proteasome component PRE2                               138   2e-36   
ref|XP_008431210.1|  PREDICTED: proteasome subunit beta type-5          137   2e-36   
ref|XP_001626004.1|  predicted protein                                  138   3e-36   
ref|XP_007806219.1|  Proteasome component PRE2                          138   3e-36   
ref|XP_002552859.1|  KLTH0D03058p                                       138   3e-36   
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5          137   3e-36   
emb|CCK68405.1|  hypothetical protein KNAG_0A07520                      138   3e-36   
ref|XP_003303688.1|  hypothetical protein PTT_16006                     138   3e-36   
gb|AFR96090.1|  proteasome component PRE2                               139   3e-36   
gb|EDL31171.1|  mCG118255                                               136   3e-36   
ref|XP_003845348.1|  similar to proteasome subunit beta type-5          137   3e-36   
ref|XP_002496406.1|  ZYRO0C17688p                                       138   3e-36   
ref|XP_007584467.1|  putative proteasome component pre2 protein         137   3e-36   
ref|NP_015428.1|  proteasome core particle subunit beta 5               137   3e-36   
emb|CAY87056.1|  Pre2p                                                  137   3e-36   
ref|XP_003652191.1|  hypothetical protein THITE_2065666                 137   3e-36   
emb|CAF97719.1|  unnamed protein product                                137   3e-36   
ref|XP_007552653.1|  PREDICTED: proteasome subunit beta type-5          137   3e-36   
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5-like     137   4e-36   
ref|XP_001932350.1|  proteasome subunit beta type-5 precursor           137   4e-36   
ref|XP_007264066.1|  N-terminal nucleophile aminohydrolase              138   4e-36   
emb|CDQ86611.1|  unnamed protein product                                137   4e-36   
ref|XP_011105932.1|  pre2p                                              137   4e-36   
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5          137   4e-36   
gb|EKG17638.1|  Peptidase T1A proteasome beta-subunit                   137   4e-36   
emb|CAA58746.1|  D13094                                                 134   4e-36   
ref|XP_005778345.1|  hypothetical protein EMIHUDRAFT_443537             137   4e-36   
ref|XP_001220016.1|  conserved hypothetical protein                     137   4e-36   
gb|KIN04587.1|  hypothetical protein OIDMADRAFT_156702                  137   5e-36   
ref|XP_002418590.1|  macropain subunit, putative; multicatalytic ...    137   5e-36   
ref|XP_005290231.1|  PREDICTED: proteasome subunit beta type-5          137   5e-36   
ref|XP_009263168.1|  hypothetical protein FPSE_11776                    137   5e-36   
gb|EHK15431.1|  hypothetical protein TRIVIDRAFT_87262                   137   5e-36   
gb|KDB13437.1|  proteasome component PRE2 precursor                     137   5e-36   
gb|EMT65514.1|  Proteasome component PRE2                               137   5e-36   
ref|XP_003051739.1|  predicted protein                                  137   5e-36   
ref|XP_003718955.1|  proteasome component PRE2                          137   5e-36   
ref|NP_984534.2|  AEL326Cp                                              137   5e-36   
gb|KIJ26450.1|  hypothetical protein M422DRAFT_236567                   137   5e-36   
ref|XP_001647464.1|  hypothetical protein Kpol_1018p144                 137   5e-36   
ref|XP_006667564.1|  proteasome component PRE2 precursor                137   5e-36   
ref|XP_001384894.1|  hypothetical protein PICST_36375                   137   6e-36   
ref|XP_007289258.1|  proteasome A-type and B-type                       137   6e-36   
ref|XP_003645144.1|  hypothetical protein Ecym_2614                     137   6e-36   
gb|EGA80611.1|  Pre2p                                                   137   6e-36   
ref|XP_003005184.1|  proteasome component PRE2                          137   6e-36   



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP+RGESSELFD+IP  PSFQIPN T+FDGF K+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLRGESSELFDDIPSSPSFQIPNTTNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   273 bits (697),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD IP  PSFQIP+  +FDGF K+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGIPSSPSFQIPDTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   268 bits (685),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAPI+GESSEL D I   PSFQIPN T+FDGF K+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPIKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISVAGASKLLANILYSY
Sbjct  121  LHELANKRRISVAGASKLLANILYSY  146



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   267 bits (683),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP++GESSEL D I   PSFQIPN T+FDGF K+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISVAGASKLLANILYSY
Sbjct  121  LHELANKRRISVAGASKLLANILYSY  146



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGF K+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   266 bits (680),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGF K+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   265 bits (677),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++IDFSGLE  AP+RGESSELFD I   PSF +PN  +FDGF K+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPRAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G +SEL       PSF++PN TDFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTVPLFGANSELLGGFSAAPSFELPNTTDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   255 bits (651),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G  SEL D     PSF +PN TDFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPVWGAPSELVDGFSAGPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   254 bits (650),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLE  AP+ G  SEL D     PSF +PN TDFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLEPAAPVSGAPSELVDGFSAAPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESXAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G + ELF+     PSF++P  TDFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLFGATGELFNGFSTAPSFELPVTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESHAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   253 bits (646),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++IDF GL+ +AP++G + +L +EI   PSF++P   DFDGF K A+QMVKPAKGTTTL
Sbjct  1    MMKIDFGGLDPSAPLKGNTDDLHNEILAAPSFKLPITADFDGFQKAAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISVAGASKLLANILYSY
Sbjct  121  LHELANKRRISVAGASKLLANILYSY  146



>ref|XP_007045045.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY00877.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=213

 Score =   250 bits (639),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   254 bits (650),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTT  245
            VTM++IDFSGLE  + +RG  +EL   +   P FQIPN  DFDGF K+++QMVKPAKGTT
Sbjct  66   VTMMKIDFSGLEPNSLLRGNPNELLSGLSTAPEFQIPNTNDFDGFQKESVQMVKPAKGTT  125

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  126  TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  185

Query  426  CRLHELANKRXISVAGASKLLANILYSY  509
            CRLHELANKR ISV GASKLLANILYSY
Sbjct  186  CRLHELANKRRISVTGASKLLANILYSY  213



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004171974.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G + E  +     PSF+IPN +DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPLFGPTMEAMEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            H+LANKR ISVAGASKLLANILYSY
Sbjct  121  HKLANKRRISVAGASKLLANILYSY  145



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G   E  +     PSF+IPN +DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPMFGPRMEALEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR 
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRR  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISVAGASKLLANILYSY
Sbjct  121  HELANKRRISVAGASKLLANILYSY  145



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++ID SGL+  AP++G S +L DEI   PSF++P   DFDGF K A+QMVKPAKGTTTL
Sbjct  2    MMKIDLSGLDPLAPVKGNSDDLDDEIMAAPSFKLPTTVDFDGFQKAAVQMVKPAKGTTTL  61

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIF +GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  62   AFIFDKGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  121

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISVAGASKLL NILYSY
Sbjct  122  LHELANKRRISVAGASKLLGNILYSY  147



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   249 bits (637),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAP+   S+ +FD +   PSF++PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPLFRSSNVIFDGLQMTPSFELPNALDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILY+Y
Sbjct  121  HELANKRRISVTGASKLLANILYNY  145



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAPI   S  +FD +   PSF +PN TDFDGF K+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPIFRRSDFVFDGLQMTPSFDLPNPTDFDGFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILY+Y
Sbjct  121  HELANKRRISVTGASKLLANILYNY  145



>gb|KCW61971.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=201

 Score =   245 bits (626),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD F K+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPMIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLESTA + G S+E  D +   PSF +P+  D DGF K+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTASLFGASNEFHDGLSTAPSFDLPSNVDLDGFLKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   PSF++P   DFDGF K+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD F K+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   245 bits (625),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   P+F++P   DFDGF K+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPAFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>gb|AAT44125.1| 20S proteasome beta subunit E [Saussurea medusa]
Length=150

 Score =   240 bits (613),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            +++DF GLES+AP+ G + + L D     PSF +P  +DFDGF K +IQMVKPAKGTTTL
Sbjct  1    MKLDFGGLESSAPLYGGNDDVLSDGFSTAPSFDLPVTSDFDGFQKSSIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAA+SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAANSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   245 bits (625),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGF K +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   244 bits (624),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G +SE+ D +  VPSF +P  TDFDGF K +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   244 bits (624),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D     PSF +P  TDFDGF K A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSAPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   244 bits (623),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SGLES  P+ G +  SE+ D +  VPSF +P   DFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGLESNVPMFGRNCESEMLDGLSDVPSFDLPLANDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGF K+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGF K+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            M++ID SGL+ +AP++  + +L +EI   PSF +P   DFDGF K +IQMVKPA+GTTTL
Sbjct  1    MMKIDLSGLDPSAPMKRNTDDLDNEILATPSFALPTTVDFDGFQKASIQMVKPARGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR IS+AGASK+LANILYSY
Sbjct  121  LHELANKRRISIAGASKMLANILYSY  146



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   243 bits (620),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGF K +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   243 bits (620),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            ++ID SGLES  P+ G  +EL D     PSF++P  TDFDGF K+A Q +KPAKGTTTLA
Sbjct  1    MKIDLSGLESAFPLFGGGNELSDGFSAAPSFELPCSTDFDGFQKEAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   243 bits (619),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   243 bits (619),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   243 bits (619),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   243 bits (619),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   243 bits (619),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFTTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   243 bits (619),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFESSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   242 bits (618),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTVGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   242 bits (617),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG EST P+ G    +E+ D +  VPSF +P   DFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFESTLPMFGGNTETEMLDGLSSVPSFDLPFTKDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVPGASKLLANMLYSY  147



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGF K+A+QMVKPA+GTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPARGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPLIGFGSSNDMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGF K +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG+MAGG+ADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGSMAGGSADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   239 bits (611),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+     +L  ++   P+F +P   DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISVAGASKLLANILYSY
Sbjct  121  HELANKRRISVAGASKLLANILYSY  145



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D    VPSF +P  TDFDGF K A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSVPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS-SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            LAFIFKEGVMVAADSRASMGGYI  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   LAFIFKEGVMVAADSRASMGGYICMSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  426  CRLHELANKRXISVAGASKLLANILYSY  509
            CRLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  CRLHELANKRRISVSGASKLLANMLYSY  148



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    S++   +   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPSLLAPQSDVVGALSAAPSFDLPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLES +P+    +E  +     PSF++P  TDFDGF KDA Q +KPAKGTTTLA
Sbjct  1    MKLDLSGLESASPLFAVGNEFSNGFSAAPSFELPCTTDFDGFQKDAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLL NILYSY
Sbjct  121  HELANKRRISVTGASKLLTNILYSY  145



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   PSF +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPSFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGT+AGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTVAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   238 bits (606),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            +++D SGL+S   I G + + L +++   PSFQ+P  +DFDGF KDAIQMVKPAKGTTTL
Sbjct  1    MKLDLSGLQSFTSIPGGAVDGLGEDLFAAPSFQLPACSDFDGFQKDAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHELANKR ISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_006842100.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
 gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   238 bits (606),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +R+D SGL S AP    + EL +    +PSFQ+PN  DFD F K A+QMVKPAKGTTTLA
Sbjct  6    MRLDTSGLNSLAPAHVVNDELCEGFMSLPSFQLPNSADFDTFQKKAVQMVKPAKGTTTLA  65

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPY++GT+AGGAADCQFWHRNLG+KCRL
Sbjct  66   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYLIGTLAGGAADCQFWHRNLGIKCRL  125

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  126  HELANKRRISVTGASKLLANILYSY  150



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPKLVAPGNDVVGEFTAPPSFELPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASK+LANILYSY
Sbjct  121  HELANKRRISVTGASKMLANILYSY  145



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGL+S  P+     +L  ++   P+F +P   DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQSFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISVAGASKLLANILYSY
Sbjct  121  HELANKRRISVAGASKLLANILYSY  145



>gb|KDO81953.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=212

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD F KD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   P F +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPFFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP+ G   ++  ++     F +PN +DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPLSGSIDDVCSDLSAHQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FVFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISVAGASKLLANILYSY
Sbjct  121  HELANKRRISVAGASKLLANILYSY  145



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   235 bits (600),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +  +  L D     PSF+IPN  DFDGF K A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQLSNDNLCDVFSPTPSFEIPNDADFDGFQKAAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINPY+LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRXISVAGASKLLANILYSY  509
            LANKR ISV GASKLLANILYSY
Sbjct  122  LANKRRISVTGASKLLANILYSY  144



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRXISVAGASKLLANILYSY  509
            LANKR ISV GASKLLANILYSY
Sbjct  122  LANKRRISVTGASKLLANILYSY  144



>gb|KDO81951.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=302

 Score =   236 bits (601),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD F KD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   234 bits (598),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRXISVAGASKLLANILYSY  509
            LANKR ISV GASKLLANILYSY
Sbjct  122  LANKRRISVTGASKLLANILYSY  144



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   234 bits (598),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIF EG MVAA SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFIEGAMVAAASRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD F KD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 3/148 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESS-ELFD--EIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTT  245
            ++ D SGLEST+ + G +  EL D       P+F++P   DFDGF K+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTSSVFGTAGRELVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  426  CRLHELANKRXISVAGASKLLANILYSY  509
            CRLHELANKR ISV GASKLLANIL+SY
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSY  148



>ref|XP_006484069.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X1 [Citrus 
sinensis]
Length=302

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD F KD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD F KD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +     L D     PSF+IPN TDFDGF K A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQRSDDNLCDVFSPSPSFKIPNDTDFDGFQKAALQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINP++LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPHLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGF K A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGF K A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004159677.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGF K+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRXISVAGASKLLANILYSY  509
             HEL NKR ISV GASKLLANILYSY
Sbjct  121  RHELENKRRISVTGASKLLANILYSY  146



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGF K A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGF K+AIQMVKPAKGTTTL
Sbjct  17   MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  76

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  77   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCR  136

Query  432  LHELANKRXISVAGASKLLANILYSY  509
             HEL NKR ISV GASKLLANILYSY
Sbjct  137  RHELENKRRISVTGASKLLANILYSY  162



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 125/148 (84%), Gaps = 3/148 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDE---IPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTT  245
            ++ D SGLESTA + G +   F +       P+F++P   DFDGF K+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTASVFGTAGREFVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGG ADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGGADCQFWHRNLGIK  120

Query  426  CRLHELANKRXISVAGASKLLANILYSY  509
            CRLHELANKR ISV GASKLLANIL+SY
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSY  148



>ref|XP_006438071.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51311.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=271

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD F KD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_006438070.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51310.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=302

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD F KD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP  G   ++  ++     F +PN +DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPRSGLIDDVCSDLSAQQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISVAGASKLLANILYSY
Sbjct  121  HELANKRRISVAGASKLLANILYSY  145



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD F KD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  121  HELANKRRISVTGASKLLANILYSY  145



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGF K+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKEASNMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 125/150 (83%), Gaps = 4/150 (3%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIP----RVPSFQIPNITDFDGFXKDAIQMVKPAKG  239
            M ++DFS L++TAP+ G+SS      P      PSF++P   DFDGF K+A  MVK  KG
Sbjct  1    MRQLDFSSLQTTAPLLGDSSGFSGGFPGDFSAAPSFEVPVTDDFDGFQKEARDMVKSKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
            +KCRLHELANKR ISV GASKLLANILYSY
Sbjct  121  IKCRLHELANKRRISVTGASKLLANILYSY  150



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGF K+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKEAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISS SVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSHSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRXISVAGASKLLANILYSY  509
            LANKR ISV GASKLLANILYSY
Sbjct  122  LANKRRISVTGASKLLANILYSY  144



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   231 bits (590),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGF K A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGF K A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDVLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSY  147



>ref|XP_002514943.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
 gb|EEF47497.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
Length=249

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG ESTAP+ G   SSE+ +      SF++P  +DFDGF  +A Q +K AKGTTT
Sbjct  1    MKLDTSGFESTAPLFGASSSSEMVNGFSAPASFELPVTSDFDGFQSEAKQTLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV GASKLLANILY+Y
Sbjct  121  RLHELANKRRISVTGASKLLANILYNY  147



>ref|XP_010440898.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=160

 Score =   225 bits (574),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 118/130 (91%), Gaps = 1/130 (1%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  299
            G ++E+FD +  VPSF +P  TDFDGF K +++MVKPAKGTTTLAFIFKEGVMVAADSRA
Sbjct  7    GSNNEMFDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTTLAFIFKEGVMVAADSRA  66

Query  300  SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGAS  479
            SMGGYISS S+K IIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKR ISV+GAS
Sbjct  67   SMGGYISSPSMK-IIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGAS  125

Query  480  KLLANILYSY  509
            KLLAN+LYSY
Sbjct  126  KLLANMLYSY  135



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D +GLES AP+ G   +L  E+   PSF +P   DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFAPLHGGMDDLHGELWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINP+M+ T+AGGAADC FWHRNLGVKCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPHMIATVAGGAADCIFWHRNLGVKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            +EL NKR ISVAGASKLL N+LYSY
Sbjct  121  YELENKRRISVAGASKLLTNMLYSY  145



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 126/171 (74%), Gaps = 26/171 (15%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGF K A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS------------------------SQSVKKIIEINP  356
            LAFIFK GVMVAADSRASMGGYIS                        SQSVKKIIEINP
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISVSSLKNSSKNMHPFDIVDFGRNTTSQSVKKIIEINP  120

Query  357  YMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            YMLGTMAGGAADCQFWHRNLG+KCRLHELANKR ISV+GASKLLAN+LYSY
Sbjct  121  YMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY  171



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D +GLES A   GE  +L  E    PSF +P   DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFASFHGEMDDLHGEFWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINPYM+ T+AGGAADC FWHRNLG+KCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPYMIATVAGGAADCIFWHRNLGMKCRL  120

Query  435  HELANKRXISVAGASKLLANILYSY  509
            +EL NKR ISVAGASKLL N+LYSY
Sbjct  121  YELENKRRISVAGASKLLTNMLYSY  145



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 123/149 (83%), Gaps = 4/149 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIR--GESSE--LFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGT  242
            +++D S +E+   +R  GE  +  +F     +P+ ++P   DFDGF K+A +++K  KGT
Sbjct  1    MKLDVSAMENNFAVRCGGEDDDGGIFGAGADLPAMELPTCADFDGFQKEAKELMKNKKGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+
Sbjct  61   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGI  120

Query  423  KCRLHELANKRXISVAGASKLLANILYSY  509
            KCRLHELANKR ISVAGASKLLANILYSY
Sbjct  121  KCRLHELANKRRISVAGASKLLANILYSY  149



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 115/150 (77%), Gaps = 5/150 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-----LFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKG  239
            +R+DF+GL+     R  S +      +D I   PSF +P + D DGF K A+ MVKP  G
Sbjct  1    MRLDFAGLDPVTLRRPSSGDGGFDVAYDSIGSAPSFNLPAVADLDGFEKAAVDMVKPLHG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAF+FKEGV+VAADSRASMG YISSQ VKKI+EINPY+LGTMAGGAADCQFW RNLG
Sbjct  61   TTTLAFVFKEGVIVAADSRASMGNYISSQDVKKILEINPYLLGTMAGGAADCQFWQRNLG  120

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
             +CRLHEL NKR ISV GASKLLAN LYSY
Sbjct  121  TRCRLHELGNKRRISVTGASKLLANTLYSY  150



>gb|AFW85805.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=203

 Score =   207 bits (527),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGF      MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
             KCRLHEL+NKR IS+AGASKLLANILYSY
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSY  151



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PSF++P + D DGF K A+QMVKPAKGTTTLAF+FK GV+VAADSRASMG YISSQSVKK
Sbjct  27   PSFELPAVADLDGFQKAAVQMVKPAKGTTTLAFVFKHGVIVAADSRASMGNYISSQSVKK  86

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            I+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKR ISV GASKLLAN LYSY
Sbjct  87   ILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVTGASKLLANTLYSY  143



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGF      MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
             KCRLHEL+NKR IS+AGASKLLANILYSY
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSY  151



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGF      MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
             KCRLHEL+NKR IS+AGASKLLANILYSY
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSY  151



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPI----RGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGT  242
            +++D S LE+   +     G+      E P VPS  +P   DFDGF      MVK  KGT
Sbjct  3    MKLDMSALETNFAVPCGDDGDGMYFSAEAPDVPSMVLPTCADFDGFQAATKDMVKNKKGT  62

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG 
Sbjct  63   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGN  122

Query  423  KCRLHELANKRXISVAGASKLLANILYSY  509
            KCRLHEL+NKR IS+AGASKLLANILYSY
Sbjct  123  KCRLHELSNKRRISIAGASKLLANILYSY  151



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = +3

Query  75   VRIDFSGLEST----APIRGESSELFDEIPRVPSFQIPNI-TDFDGFXKDAIQMVKPAKG  239
            +++D S +E+     A  R +   LF     +P+ ++P    DFDGF K+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGREDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
            +KCRLHELANKR IS+AGASKLLANILYSY
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSY  150



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 116/150 (77%), Gaps = 6/150 (4%)
 Frame = +3

Query  75   VRIDFSGLES-----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKG  239
            +++D S LE+     T P   + +      P VPS  +P   DFDGF  D   MVK  KG
Sbjct  3    MKVDMSALETNFANMTFPAS-DDTYFSAGAPDVPSMVLPTCDDFDGFQADTKAMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
             KCRLHEL+NKR IS+AGASKLLANILYSY
Sbjct  122  NKCRLHELSNKRRISIAGASKLLANILYSY  151



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 119/150 (79%), Gaps = 5/150 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFXKDAIQMVKPAKG  239
            +++D S +E+    +    E    LF     +P+ ++P    DFDGF K+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAQAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
            +KCRLHELANKR IS+AGASKLLANILYSY
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSY  150



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 118/150 (79%), Gaps = 5/150 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFXKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGF K+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
            +KCRLHELANKR IS+AGASKLLANILYSY
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSY  150



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 118/150 (79%), Gaps = 5/150 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFXKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGF K+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
            +KCRLHELANKR IS+AGASKLLANILYSY
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSY  150



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGF K A+ ++KPA GTTTLAF 
Sbjct  3    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  62

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  63   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  122

Query  441  LANKRXISVAGASKLLANILYSY  509
            LANKR ISVAGASKLLAN LYSY
Sbjct  123  LANKRRISVAGASKLLANTLYSY  145



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGF K A+ ++KPA GTTTLAF 
Sbjct  5    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  64

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  65   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  124

Query  441  LANKRXISVAGASKLLANILYSY  509
            LANKR ISVAGASKLLAN LYSY
Sbjct  125  LANKRRISVAGASKLLANTLYSY  147



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 112/148 (76%), Gaps = 3/148 (2%)
 Frame = +3

Query  75   VRIDFSGLES---TAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTT  245
            +R+D S LE+    AP       +F       + + P   DFDGF K    MV   KGTT
Sbjct  1    MRLDVSALENHHFAAPGNEFGGGVFAADTEELAMEFPTCNDFDGFQKATKDMVNNKKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG K
Sbjct  61   TLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGTK  120

Query  426  CRLHELANKRXISVAGASKLLANILYSY  509
            CRLHELANKR IS+AG+SK+LANILYSY
Sbjct  121  CRLHELANKRRISIAGSSKMLANILYSY  148



>gb|AAT80906.1| 26S proteasome beta subunit [Lemna minor]
Length=116

 Score =   192 bits (487),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            VKPAKGTTTLAFIFKEGV+V+ADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF
Sbjct  1    VKPAKGTTTLAFIFKEGVIVSADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  60

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            WHRNLG+KCRLHELANKR ISV GASKLLANILYSY
Sbjct  61   WHRNLGIKCRLHELANKRRISVTGASKLLANILYSY  96



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   196 bits (498),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGF K   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCNDFDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR IS+AG+SK LANILYSY
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSY  150



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGF K    MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCDDFDGFQKATKAMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR IS+AG+SK LANILYSY
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSY  150



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   187 bits (476),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  189  FDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGF K A+Q+VKPAKGTTTLAF+FK GV+VAADS ASMG  ISSQSVKKI+EINPY+LG
Sbjct  1    LDGFQKAAVQLVKPAKGTTTLAFVFKHGVIVAADSSASMGNSISSQSVKKILEINPYLLG  60

Query  369  TMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            TMAGGAADCQFW RNLG +CRLHELANKR ISV GASKLLAN LYSY
Sbjct  61   TMAGGAADCQFWQRNLGTRCRLHELANKRHISVTGASKLLANTLYSY  107



>gb|ABQ50544.1| hypothetical protein [Brassica rapa]
Length=218

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  299
            G S+++ D    VPSF +P  TDFDGF K+A+QMVKPAKGTTTLAFIFKEGVMVAADSRA
Sbjct  7    GSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTTLAFIFKEGVMVAADSRA  66

Query  300  SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  67   SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  108



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
            M+K  KGTTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MLKHKKGTTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  399  FWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            FWHRNLG+KCRLHELANKR IS+AGASKLLANILYSY
Sbjct  61   FWHRNLGIKCRLHELANKRRISIAGASKLLANILYSY  97



>gb|ABD61730.2| 26S proteasome beta subunit [Lupinus albus]
Length=127

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +3

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            +TLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+
Sbjct  1    STLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGI  60

Query  423  KCRLHELANKRXISVAGASKLLANILYSY  509
            KCRLHELANKR ISV GASKLLANILYSY
Sbjct  61   KCRLHELANKRRISVTGASKLLANILYSY  89



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   179 bits (455),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
            MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  399  FWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            FWHRNLGVKCRLHELANKR IS+AG+SK LANILYSY
Sbjct  61   FWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSY  97



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 112/149 (75%), Gaps = 4/149 (3%)
 Frame = +3

Query  75   VRIDFSGLES-TAPIRGESSELFDEIP---RVPSFQIPNITDFDGFXKDAIQMVKPAKGT  242
            +++DFS L++ T  I  E +E   EI       +F++P + ++D F ++ +  VKP  GT
Sbjct  1    MKLDFSVLDAPTRKIDAEIAECAAEINSDVHAQNFKLPMVENYDSFQREVVDYVKPNHGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  61   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  120

Query  423  KCRLHELANKRXISVAGASKLLANILYSY  509
            +CRLHEL N + ISV+GASKLL+N LY Y
Sbjct  121  QCRLHELENGKRISVSGASKLLSNTLYGY  149



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 111/151 (74%), Gaps = 10/151 (7%)
 Frame = +3

Query  81   IDFSGLESTAPIRG--------ESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAK  236
            +DFS L++TA  RG        ES +  D      +F+ P + DF+GF ++ I  VKP  
Sbjct  6    LDFSFLDATA--RGSMASKHVDESLDAIDGNMHECNFKAPAVEDFEGFQREVINYVKPNH  63

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAFIF+ G++VA DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  64   GTTTLAFIFEHGIVVAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  123

Query  417  GVKCRLHELANKRXISVAGASKLLANILYSY  509
            G++CRLHEL N + I+V  ASKLLAN LYSY
Sbjct  124  GIQCRLHELENGKRITVRAASKLLANTLYSY  154



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 109/157 (69%), Gaps = 11/157 (7%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIP---------RVPSFQIPNITDFDGFXKDAIQ  218
            +T + +DFS L+   P+R E+ EL   +              F IP + DF  F KD ++
Sbjct  1    MTSLNLDFSVLDR--PVRKEADELTSTLENDVLCGINTHDQYFTIPRVEDFSRFQKDVVE  58

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
             VKP  GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQ
Sbjct  59   HVKPQHGTTTLGFIFEHGIIIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQ  118

Query  399  FWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            FW RNLG++CRLHEL   + I+V GASKLLAN LY Y
Sbjct  119  FWQRNLGIQCRLHELETGKRITVTGASKLLANTLYGY  155



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  189   FDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             FDGF K   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLG
Sbjct  1285  FDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLG  1344

Query  369   TMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
             TMAGGAADCQFWHRNLGVKCRLHELANKR IS+AG+SK LANILYSY
Sbjct  1345  TMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSY  1391



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 109/149 (73%), Gaps = 4/149 (3%)
 Frame = +3

Query  75   VRIDFSGLES----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGT  242
            +++D+S L++    T  I  + +          +F++P + ++D F ++ +  VKP  GT
Sbjct  4    LKLDYSVLDAPQRATDRIEADCAREIHGDVHAQNFKLPMVENYDEFQREVVDYVKPNHGT  63

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  64   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  123

Query  423  KCRLHELANKRXISVAGASKLLANILYSY  509
            +CRLHEL N + ISVAGASKLLAN LY Y
Sbjct  124  QCRLHELENGKRISVAGASKLLANTLYGY  152



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score =   176 bits (446),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 104/151 (69%), Gaps = 6/151 (4%)
 Frame = +3

Query  75   VRIDFSGLEST------APIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAK  236
            V +D S L  T         R E+ +         +F  P + DFD F ++ I  VKPA 
Sbjct  3    VNLDLSFLHDTERGAASTKYRDEALQGVSNSVHASNFTAPAVEDFDAFQREVINYVKPAH  62

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  63   GTTTLGFIFEHGIVIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  122

Query  417  GVKCRLHELANKRXISVAGASKLLANILYSY  509
            G++CRLHEL N + I+V  ASKLLAN LYSY
Sbjct  123  GIQCRLHELENGKRITVRAASKLLANTLYSY  153



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score =   176 bits (445),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 109/150 (73%), Gaps = 5/150 (3%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPS----FQIPNITDFDGFXKDAIQMVKPAKG  239
            M ++DFS L S  P+  +S    +++  + S    F +P + D D F  + +  VKP  G
Sbjct  1    MDKLDFSALCSR-PLSEKSGACVEDVASITSAVQDFPLPQVQDVDRFENEVMSYVKPNHG  59

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTL FIFK GV++A DSRASMG YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG
Sbjct  60   TTTLGFIFKYGVIIAVDSRASMGSYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLG  119

Query  420  VKCRLHELANKRXISVAGASKLLANILYSY  509
             +CRL+EL N + ISV  ASKLLAN+++SY
Sbjct  120  QQCRLYELNNGKRISVRAASKLLANVMFSY  149



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 3/149 (2%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFD---EIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGT  242
            M+++D S LE  A    E   L         V SF +P + D D F ++ ++ VKP  GT
Sbjct  1    MMKLDLSCLEPAAGAGREPCGLEAAGVSGVAVDSFPLPAVADIDSFEREVVEYVKPNHGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNLG 
Sbjct  61   TTLGFIFQGGVIIAVDSRASQGSYISSQTVKKVIEINPHLLGTMAGGAADCQFWERNLGR  120

Query  423  KCRLHELANKRXISVAGASKLLANILYSY  509
            +CRL+ELAN + I+V GASKLLAN ++SY
Sbjct  121  QCRLYELANGKRITVRGASKLLANTMFSY  149



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 108/146 (74%), Gaps = 3/146 (2%)
 Frame = +3

Query  78   RIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTL  251
            ++D   LE  A  +G     +L  ++P   SF +P + D D F ++ ++MVKP  GTTTL
Sbjct  4    KLDLGILEPNAGRKGPGLGPDLQLDVP-TASFPLPAVQDLDKFEREVVEMVKPCHGTTTL  62

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
             FIF+ GV++A DSRA+MG +ISSQ+VKK+IEIN +++GTMAGGAADCQFW RNLG++CR
Sbjct  63   GFIFQHGVIIAVDSRATMGSFISSQTVKKVIEINKHLIGTMAGGAADCQFWQRNLGMRCR  122

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            L+EL N + I+V  ASKLLAN ++SY
Sbjct  123  LYELNNGKRITVCAASKLLANTMFSY  148



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            SF +P + D D F ++ ++MVKP  GTTTL FIF+ GV++A DSRA+MG YISSQ+VKK+
Sbjct  34   SFPLPAVQDVDKFEREVVEMVKPCHGTTTLGFIFQHGVIIAVDSRATMGAYISSQTVKKV  93

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            IEIN ++LGTMAGGAADCQFW RNLG++CRL+EL N + I+V  ASKLL+N+++SY
Sbjct  94   IEINKFLLGTMAGGAADCQFWQRNLGMQCRLYELNNGKRITVRAASKLLSNVMFSY  149



>ref|XP_011396916.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
 gb|KFM24035.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
Length=277

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 96/121 (79%), Gaps = 3/121 (2%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  335
            + +F +P + D D F K+ ++ VKP+ GTTTL FIF+ GV+VA DSRAS G YISSQ+VK
Sbjct  31   IDAFPLPAVADLDSFEKEVVEYVKPSHGTTTLGFIFQGGVIVAVDSRASQGSYISSQTVK  90

Query  336  KIIEINPYMLGTMAGGAADCQFWHRNLG---VKCRLHELANKRXISVAGASKLLANILYS  506
            K+IEINP++LGTMAGGAADCQFW RNLG   V CRL+EL N + I+V GASKLLAN ++S
Sbjct  91   KVIEINPFLLGTMAGGAADCQFWERNLGRQVVWCRLYELNNGKRITVRGASKLLANTMFS  150

Query  507  Y  509
            Y
Sbjct  151  Y  151



>ref|XP_002889983.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66242.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/78 (94%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +3

Query  276  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR  455
            MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLH LANKR
Sbjct  1    MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHALANKR  60

Query  456  XISVAGASKLLANILYSY  509
             ISV+GASKLLAN+LYSY
Sbjct  61   RISVSGASKLLANMLYSY  78



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   159 bits (402),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  189  FDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGF +  ++ VKP+ GTTTL FIF+ GV++A DSRAS G Y+SSQ+VKK+IEINPY+LG
Sbjct  9    LDGFERSVVEYVKPSHGTTTLGFIFQGGVIIAVDSRASQGSYLSSQTVKKVIEINPYLLG  68

Query  369  TMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            TMAGGAADCQFW RNLG +CRL+EL   R I+V  ASKLLAN ++SY
Sbjct  69   TMAGGAADCQFWERNLGRQCRLYELKEGRRITVKAASKLLANTMFSY  115



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   156 bits (395),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 92/145 (63%), Gaps = 34/145 (23%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLA  254
            +++D SGLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFPSLISHGNDVVGEFEAPPSFELPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMV                                  AADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMV----------------------------------AADCQFWHRNLGIKCRL  86

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HELANKR ISV GASKLLANILYSY
Sbjct  87   HELANKRRISVTGASKLLANILYSY  111



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 91/123 (74%), Gaps = 6/123 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXKDAIQMVKP------AKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            PSF +P I +   F ++      P        GTTTLAF F+ GV+VA DSRA+MG YIS
Sbjct  37   PSFDVPAIHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIS  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRLHEL NK  ISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSY  509
            YSY
Sbjct  157  YSY  159



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 113/171 (66%), Gaps = 9/171 (5%)
 Frame = +3

Query  21   P*VESTPSFYSRYLVVTMVRIDFSGLESTAPIRGESSELFDEIPRV-------PSFQIPN  179
            P  ++T SF     + +++  DF+ L S  P   ++  L D    +         F +P 
Sbjct  5    PSTKTTKSFKQGANLSSVLSSDFTSL-SIGPQDEDNVILQDPCLDISYGLDGQQGFALPP  63

Query  180  ITDFDGFXKDAIQMVKP-AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINP  356
              +  GF     ++ K  AKGTTTL F+F +G+++A DSRASMG YISSQ+VKK+IEINP
Sbjct  64   SLNNSGFIHQKEKLEKTYAKGTTTLGFVFNKGIVIAVDSRASMGNYISSQNVKKVIEINP  123

Query  357  YMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            Y+LGTMAGGAADCQFW R LG++CRL+EL NKR ISVA ASKLL+NI+Y Y
Sbjct  124  YLLGTMAGGAADCQFWERYLGMQCRLYELRNKRRISVAAASKLLSNIVYQY  174



>emb|CEG76258.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=246

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 6/123 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F +P + +   F ++          +K   GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK  ISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSY  509
            YSY
Sbjct  157  YSY  159



>dbj|GAN10935.1| 20S proteasome subunit [Mucor ambiguus]
Length=277

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 91/127 (72%), Gaps = 14/127 (11%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD     K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK  ISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSY  509
            AN++Y+Y
Sbjct  153  ANMVYAY  159



>gb|EPB87271.1| proteasome component PRE2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=277

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 91/127 (72%), Gaps = 14/127 (11%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD     K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK  ISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSY  509
            AN++Y+Y
Sbjct  153  ANMVYAY  159



>emb|CEP17612.1| hypothetical protein [Parasitella parasitica]
Length=277

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 91/127 (72%), Gaps = 14/127 (11%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            P+F IP          N+TD     K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PAFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQHGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK  ISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSY  509
            AN++Y+Y
Sbjct  153  ANMVYAY  159



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 91/123 (74%), Gaps = 6/123 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXKDAIQMVKP------AKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F +P + +   F ++      P        GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK  ISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSY  509
            YSY
Sbjct  157  YSY  159



>emb|CEJ04297.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=206

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K   GTTTLAF F+ GV+VA DSRA+MG YI+SQ+VKK+IEINPY+LGT+AGGAADCQ+
Sbjct  24   IKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIASQTVKKVIEINPYLLGTLAGGAADCQY  83

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W R LG +CRLHEL NK  ISVA ASKLLAN++YSY
Sbjct  84   WERELGRRCRLHELRNKERISVAAASKLLANMVYSY  119



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISV  467
            +SRASMGGYISSQSV+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKR ISV
Sbjct  1    NSRASMGGYISSQSVEKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISV  60

Query  468  AGASKLLANILYSY  509
             GASKLLANILYSY
Sbjct  61   TGASKLLANILYSY  74



>emb|CDH56820.1| 20s proteasome subunit [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14360.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=277

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F IP++ +   F +           +K   GTTTLAF F+ GV+VA DSRA+MG YI 
Sbjct  37   PTFDIPDVHNPVDFLRSVTDEDSPDYKIKIQHGTTTLAFQFQGGVIVAVDSRATMGNYIG  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK  ISVA ASKLL N++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKLLGNMV  156

Query  501  YSY  509
            YSY
Sbjct  157  YSY  159



>ref|XP_009038619.1| hypothetical protein AURANDRAFT_28593 [Aureococcus anophagefferens]
 gb|EGB06876.1| hypothetical protein AURANDRAFT_28593 [Aureococcus anophagefferens]
Length=287

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  195  GFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q VK AKGTTTLAF F  GV+++ DSR++MG YI+SQ+VKK+IEINP++LGTM
Sbjct  53   GYGTDHHQDVKFAKGTTTLAFKFNGGVIISVDSRSTMGPYIASQTVKKVIEINPFLLGTM  112

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            AGGAADC FW RNLG +CR+ EL NKR +SVA ASK+LAN +YSY
Sbjct  113  AGGAADCSFWERNLGTQCRMFELRNKRRVSVAAASKMLANTMYSY  157



>emb|CBY21147.1| unnamed protein product [Oikopleura dioica]
 emb|CBY40350.1| unnamed protein product [Oikopleura dioica]
Length=287

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P F  P +     F  D    +K   GTT LAF FK GVMVA DSRA+ GGYI+SQ VKK
Sbjct  52   PPFSNPQLHLDQNFGDDKPVKIKFNHGTTCLAFKFKHGVMVATDSRATAGGYIASQEVKK  111

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            +IEINPY+LGTMAGGAADCQFW R L ++CRL+EL NK  ISVA ASKLLAN++Y Y
Sbjct  112  VIEINPYLLGTMAGGAADCQFWERVLAMECRLYELRNKERISVAAASKLLANMVYQY  168



>ref|XP_002290272.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92024.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
Length=276

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 8/115 (7%)
 Frame = +3

Query  165  FQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKII  344
            F++PN+ D  G        VK AKGTTTLAF F  G++V+ DSR++MG YI+S +VKK+I
Sbjct  50   FEVPNVADVSG--------VKFAKGTTTLAFKFNGGIIVSVDSRSTMGAYIASGTVKKVI  101

Query  345  EINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            EINP++LGTMAGGAADC FW RNLG++CRL+EL NK+ I+VA ASKLLAN + SY
Sbjct  102  EINPFLLGTMAGGAADCSFWERNLGMQCRLYELRNKKRITVASASKLLANTMSSY  156



>ref|XP_006957104.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
 gb|EIM23071.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
Length=288

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +P+  +PN  D  GF +       D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  29   IPTLDLPNTADPTGFLRTYTDDQQDPSCRIKINHGTTTLAFKFKGGVIVAVDSRATAGSY  88

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK  ISVA ASK L+N
Sbjct  89   VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKYLSN  148

Query  495  ILYSY  509
            I YSY
Sbjct  149  ITYSY  153



>ref|XP_009265754.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
 gb|EOR04743.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
Length=287

 Score =   150 bits (379),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 11/142 (8%)
 Frame = +3

Query  117  RGESSELFDEIPR----VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIF  263
            RG  + L D+       +P+ Q+PN  D  GF +       D    +K   GTTTLAF +
Sbjct  12   RGIDAALHDDFEGGSGGMPTLQLPNTADPTGFLREYTDEQNDPSCRIKINHGTTTLAFKY  71

Query  264  KEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHEL  443
            K GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL
Sbjct  72   KGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHEL  131

Query  444  ANKRXISVAGASKLLANILYSY  509
             N+  ISVA ASK L+NI YSY
Sbjct  132  RNRERISVAAASKYLSNITYSY  153



>ref|XP_007006996.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
 gb|EIW67092.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
Length=287

 Score =   150 bits (378),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 8/132 (6%)
 Frame = +3

Query  138  FDEIPRVPSFQIPNITD--------FDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADS  293
             DE+ R+   QIP + D         D    +    +K A GTTTLAF FK G++VA DS
Sbjct  28   LDEMGRIKGMQIPRVPDPTAFLNLYTDSMSSNPEAKIKLAHGTTTLAFRFKGGIIVAVDS  87

Query  294  RASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAG  473
            RA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRL+EL NK  ISVA 
Sbjct  88   RATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMRCRLYELRNKERISVAA  147

Query  474  ASKLLANILYSY  509
            ASK+L+NI+Y Y
Sbjct  148  ASKILSNIVYGY  159



>ref|XP_005537552.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81516.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
Length=299

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
            +VK   GTTTLAF+F++G++VA DSRASMG YI S +VKKIIEINPY+LGTMAGGAADC 
Sbjct  64   LVKFLHGTTTLAFVFRDGIIVAVDSRASMGQYIGSGTVKKIIEINPYLLGTMAGGAADCS  123

Query  399  FWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            FW R LG++CRLHEL ++  ISVA ASKLLANI+Y Y
Sbjct  124  FWERYLGMRCRLHELQHRERISVAAASKLLANIVYEY  160



>gb|EJU05281.1| proteasome-domain-containing protein [Dacryopinax sp. DJM-731 
SS1]
Length=315

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF++P++ D   F +       D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  49   IPSFKVPSLADPSAFLRMHTDDYADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIECRLHELRNRERISVAAASKFLSN  168

Query  495  ILYSY  509
            ++YSY
Sbjct  169  LVYSY  173



>gb|KFH71396.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=278

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 5/123 (4%)
 Frame = +3

Query  156  VPSFQIP---NITDFDGFXKDAI--QMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            +P+F IP   N TDF     DA     ++   GTTTLAF F+ G++VA DSRAS G YI+
Sbjct  38   LPAFDIPMVANPTDFLRAHTDASAENRIRIQHGTTTLAFKFQGGIIVAVDSRASGGSYIA  97

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK  ISVA ASK+L+N++
Sbjct  98   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKILSNMV  157

Query  501  YSY  509
            Y Y
Sbjct  158  YDY  160



>emb|CAC43326.1| putative beta5 proteasome subunit [Nicotiana tabacum]
Length=174

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/71 (96%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKR  SVAGA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRTSVAGA  60

Query  477  SKLLANILYSY  509
            SKLLANILYSY
Sbjct  61   SKLLANILYSY  71



>ref|XP_008036606.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
 gb|EIW60150.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
Length=310

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 91/125 (73%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF+IP + D   F +       D    +K   GTTTLAF +K GV+VA DSRA+ G Y
Sbjct  48   VPSFKIPAVADPSSFLRMHTDDHADPSCRIKIKHGTTTLAFRYKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSY  509
            ++YSY
Sbjct  168  LVYSY  172



>ref|XP_001730616.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
 gb|EDP43402.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
Length=295

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS  +   TD D    DA   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PSRFLAQYTDVDSTRPDA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            +IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK  ISVA ASK+L+N++YSY
Sbjct  95   VIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSY  151



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   146 bits (369),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 74/87 (85%), Gaps = 8/87 (9%)
 Frame = +3

Query  273  VMVAADSR--------ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            VM AA  R        ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  10   VMAAAGFRLADTFHTGASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  69

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            RLHELANKR ISV GASKLLANILYSY
Sbjct  70   RLHELANKRRISVTGASKLLANILYSY  96



>emb|CCM00020.1| predicted protein [Fibroporia radiculosa]
Length=302

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 99/149 (66%), Gaps = 7/149 (5%)
 Frame = +3

Query  84   DFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXK-------DAIQMVKPAKGT  242
            + SG E  + +   S    +    +P+F IP++ D   F +       D    +K   GT
Sbjct  22   EISGDEDVSDVMWGSEGFGNLAKEIPTFAIPSVPDPAAFLRLHTDDHADPSCRIKIKHGT  81

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAF +K GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+
Sbjct  82   TTLAFRYKGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETFLGI  141

Query  423  KCRLHELANKRXISVAGASKLLANILYSY  509
            +CRLHEL N+  ISVA ASK L+N++YSY
Sbjct  142  ECRLHELRNRERISVAAASKFLSNLVYSY  170



>gb|KIY65291.1| proteasome-domain-containing protein [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=308

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F +       D    +K A GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  47   VPTFTVPNLPDPSAFLRLHTDDHADPNCKIKIAHGTTTLAFRFKGGVIVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N
Sbjct  107  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKFLSN  166

Query  495  ILYSY  509
            ++Y Y
Sbjct  167  LVYGY  171



>ref|XP_007863011.1| 20S proteasome subunit [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58001.1| 20S proteasome subunit [Gloeophyllum trabeum ATCC 11539]
Length=312

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P + D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPSFSVPAVHDPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  108  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSY  509
            ++YSY
Sbjct  168  LVYSY  172



>ref|XP_007395513.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55176.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
Length=300

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP F IP + D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  43   VPKFNIPAVPDPSAFLRLHTDDFADPSCRIKIKHGTTTLAFRFRGGVIVAVDSRATAGSY  102

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  103  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  162

Query  495  ILYSY  509
            ++YSY
Sbjct  163  LVYSY  167



>ref|XP_002111558.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
 gb|EDV25525.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
Length=276

 Score =   147 bits (370),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 92/131 (70%), Gaps = 6/131 (5%)
 Frame = +3

Query  132  ELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAK-----GTTTLAFIFKEGVMVAADSR  296
            EL   + +  SFQ+P + D   F K   +     K     GTTTLAF FK GV+VAADSR
Sbjct  34   ELRTHLSKELSFQVPPM-DPQVFLKSINERENGVKIQFLHGTTTLAFKFKNGVIVAADSR  92

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGA  476
            ASMG YI SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK  ISVA A
Sbjct  93   ASMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSFWERVLAERCRVYELRNKERISVAAA  152

Query  477  SKLLANILYSY  509
            SKLLAN++Y Y
Sbjct  153  SKLLANMVYYY  163



>gb|KDQ60928.1| hypothetical protein JAAARDRAFT_125152 [Jaapia argillacea MUCL 
33604]
Length=318

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 91/125 (73%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF +P++ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  46   IPSFSVPSVHDPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  105

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  165

Query  495  ILYSY  509
            ++YSY
Sbjct  166  LVYSY  170



>gb|EJK48257.1| hypothetical protein THAOC_32963 [Thalassiosira oceanica]
Length=248

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +3

Query  207  DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGA  386
            D  Q VK AKGTTTLAF F  G++V+ DSR++MG YI+S +VKK+IEINP++LGTMAGGA
Sbjct  28   DQGQEVKFAKGTTTLAFKFNGGIIVSVDSRSTMGAYIASGTVKKVIEINPFLLGTMAGGA  87

Query  387  ADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            ADC FW RNLG++CR++EL NK+ ISVA ASKLLAN + SY
Sbjct  88   ADCSFWERNLGIQCRMYELRNKKRISVAAASKLLANTMRSY  128



>emb|CCU99044.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=268

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P   +   TD D   ++A   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PGRFLAQFTDVDSTNQNA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            +IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK  ISVA ASK+L+N++YSY
Sbjct  95   VIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSY  151



>gb|KDE05583.1| proteasome component PRE2 [Microbotryum violaceum p1A1 Lamole]
Length=308

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF +P + D   F +       D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  46   MPSFDLPTLQDPTAFLQLHTDDSSDPSCRIKINHGTTTLAFRFKGGIIVAVDSRATAGSY  105

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  165

Query  495  ILYSY  509
            ++YSY
Sbjct  166  LVYSY  170



>ref|XP_002162379.2| PREDICTED: proteasome subunit beta type-5-like [Hydra vulgaris]
Length=277

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +3

Query  162  SFQIPNITDFDGFXKDAIQ---MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            +F +PN++D   F  +       ++   GTTTLAF FK GV+VA DSRAS G YI+SQ+V
Sbjct  44   NFPLPNVSDVSQFLNEYTNGDTKIQFHHGTTTLAFKFKHGVIVAVDSRASAGSYIASQTV  103

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            KK+IEINPY+LGTMAGGAADC FW R L  +CRL++L NK  ISVA ASKLLAN++Y Y
Sbjct  104  KKVIEINPYLLGTMAGGAADCAFWQRVLAKECRLYQLRNKERISVAAASKLLANMVYQY  162



>ref|XP_007385467.1| N-terminal nucleophile aminohydrolase [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN07174.1| N-terminal nucleophile aminohydrolase [Punctularia strigosozonata 
HHB-11173 SS5]
Length=317

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPNFSVPNVPDPAAFLRLHTDDHADPSCRIKIKHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSY  509
            ++Y Y
Sbjct  168  LVYGY  172



>gb|AAM18885.1|AF391293_2 unknown [Branchiostoma floridae]
Length=275

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 95/134 (71%), Gaps = 5/134 (4%)
 Frame = +3

Query  123  ESSELFDEIPRVPSFQIPNITDFDGFXK-----DAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            + S++ + +  +  F IP +TD   F K     +    ++   GTTTLAF F+ GV+VA 
Sbjct  28   DESDVLNNLWSLDKFSIPAVTDPAEFLKPFTTGEGNVKIEFDHGTTTLAFKFQHGVIVAV  87

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISV  467
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK  ISV
Sbjct  88   DSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISV  147

Query  468  AGASKLLANILYSY  509
            A ASKLLANI+Y+Y
Sbjct  148  AAASKLLANIVYNY  161



>ref|XP_005713380.1| 20S core proteasome subunit beta 5 [Chondrus crispus]
 emb|CDF33577.1| 20S core proteasome subunit beta 5 [Chondrus crispus]
Length=286

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = +3

Query  162  SFQIPNITDFDGFXKDAI------QMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
            S  +P +     F +DA         ++ A GTTTLAF FK G++VA DSRASMG YI S
Sbjct  35   SLVVPQVDRPSSFLRDAFANVPEKDRIRFAHGTTTLAFSFKGGIIVAVDSRASMGQYIGS  94

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILY  503
             +VKKIIEINPY+LGTMAGGAADC FW R+LG +C+L+EL NK  ISVA ASKLLAN +Y
Sbjct  95   GTVKKIIEINPYLLGTMAGGAADCSFWERDLGRRCKLYELRNKERISVAAASKLLANTVY  154

Query  504  SY  509
             Y
Sbjct  155  YY  156



>ref|XP_002179855.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48841.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=283

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 95/129 (74%), Gaps = 11/129 (9%)
 Frame = +3

Query  156  VP-SFQIPNITDFDGFXK----------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRAS  302
            VP  F +PN+ D   + +          DA Q VK AKGTTTLAF F  G++V+ DSR++
Sbjct  36   VPGQFDVPNVPDPALYCRSNFASACGNADAGQEVKFAKGTTTLAFKFNGGIIVSVDSRST  95

Query  303  MGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASK  482
            MG YI+S +VKK+IEINP++LGTMAGGAADC FW RNLG++CRL+EL N R I+VA ASK
Sbjct  96   MGYYIASGTVKKVIEINPFLLGTMAGGAADCSFWERNLGMECRLYELRNGRRITVAAASK  155

Query  483  LLANILYSY  509
            LLAN++ +Y
Sbjct  156  LLANVMSAY  164



>ref|XP_007326468.1| hypothetical protein AGABI1DRAFT_111072 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM82453.1| hypothetical protein AGABI1DRAFT_111072 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=311

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 91/128 (71%), Gaps = 7/128 (5%)
 Frame = +3

Query  147  IPRVPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            I  +P+F++P + D   F +       D    +K   GTTTLAF FK GV+VA DSRA+ 
Sbjct  46   IKGIPAFKVPAVADPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATA  105

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKL  485
            G Y++S +VKK+IEINPY+LGTMAGGAADCQFW   LG+ CRLHEL N+  ISV+ ASK 
Sbjct  106  GSYVASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHELRNRERISVSAASKY  165

Query  486  LANILYSY  509
            L+N++YSY
Sbjct  166  LSNLVYSY  173



>emb|CCF49354.1| probable PRE2-20S core proteasome subunit (beta5) [Ustilago hordei]
Length=325

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 12/142 (8%)
 Frame = +3

Query  114  IRGESSELFDEIPRVP-SFQIPNI---------TDFDGFXKDAIQMVKPAKGTTTLAFIF  263
            + G +   +D++   P  F +PN+         TD D    +    +K A GTTTLAF F
Sbjct  21   MHGSTGAAYDQLMGAPGQFDLPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRF  78

Query  264  KEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHEL  443
            K G++V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL
Sbjct  79   KGGIIVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHEL  138

Query  444  ANKRXISVAGASKLLANILYSY  509
             NK  ISVA ASK L+N++YSY
Sbjct  139  RNKERISVAAASKYLSNLVYSY  160



>ref|XP_006457891.1| 20S proteasome subunit [Agaricus bisporus var. bisporus H97]
 gb|EKV49845.1| 20S proteasome subunit [Agaricus bisporus var. bisporus H97]
Length=311

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 91/128 (71%), Gaps = 7/128 (5%)
 Frame = +3

Query  147  IPRVPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            I  +P+F++P + D   F +       D    +K   GTTTLAF FK GV+VA DSRA+ 
Sbjct  46   IKGIPAFKVPAVADPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATA  105

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKL  485
            G Y++S +VKK+IEINPY+LGTMAGGAADCQFW   LG+ CRLHEL N+  ISV+ ASK 
Sbjct  106  GSYVASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHELRNRERISVSAASKY  165

Query  486  LANILYSY  509
            L+N++YSY
Sbjct  166  LSNLVYSY  173



>gb|EIF47547.1| proteasome component pre2 precursor [Brettanomyces bruxellensis 
AWRI1499]
Length=284

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 7/124 (6%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXK----DAIQ---MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            PS  +P I+    F +    D++     +K A GTTTLAF FKEG++VA DSRA+ G ++
Sbjct  39   PSISLPPISKPTAFLRANTDDSVNPDCKIKIAHGTTTLAFRFKEGIIVAVDSRATAGSWV  98

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANI  497
            +SQ+VKK+IEINP +LGTMAGGAADCQ+W   LG +CRLHEL NK  ISVA ASK+L+N+
Sbjct  99   ASQTVKKVIEINPMLLGTMAGGAADCQYWETWLGTQCRLHELRNKERISVAAASKILSNL  158

Query  498  LYSY  509
            +YSY
Sbjct  159  VYSY  162



>emb|CCO27714.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
 emb|CEL51643.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
Length=302

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF IP + D   F +       D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  45   VPSFTIPRVPDPTAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSY  509
            ++YSY
Sbjct  165  LVYSY  169



>gb|KDQ33416.1| hypothetical protein PLEOSDRAFT_1110569 [Pleurotus ostreatus 
PC15]
Length=307

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP++ D   F +       D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  48   VPTFSIPSVADPTAFLRLHTDDSSDPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNRERISVSAASKYLSN  167

Query  495  ILYSY  509
            ++Y Y
Sbjct  168  LVYGY  172



>gb|EJT45706.1| proteasome component [Trichosporon asahii var. asahii CBS 2479]
Length=275

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
            E+P VP          D    +    +K A GTTTLAF FK G++VA DSRA+ G YI+S
Sbjct  34   EVPGVPDPLAFLSLHTDSMSTNPAAKIKLAHGTTTLAFRFKGGIIVAVDSRATAGSYIAS  93

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILY  503
             +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK  ISVA ASK+L+NI+Y
Sbjct  94   GTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRNKERISVAAASKILSNIVY  153

Query  504  SY  509
             Y
Sbjct  154  QY  155



>gb|EKD04801.1| proteasome component [Trichosporon asahii var. asahii CBS 8904]
Length=275

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
            E+P VP          D    +    +K A GTTTLAF FK G++VA DSRA+ G YI+S
Sbjct  34   EVPGVPDPLAFLSLHTDSMSTNPAAKIKLAHGTTTLAFRFKGGIIVAVDSRATAGSYIAS  93

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILY  503
             +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK  ISVA ASK+L+NI+Y
Sbjct  94   GTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRNKERISVAAASKILSNIVY  153

Query  504  SY  509
             Y
Sbjct  154  QY  155



>gb|KII89158.1| hypothetical protein PLICRDRAFT_109139 [Plicaturopsis crispa 
FD-325 SS-3]
Length=318

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 88/125 (70%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F +       D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  48   VPTFSVPNVPDPSSFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N   ISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNHERISVSAASKYLSN  167

Query  495  ILYSY  509
            ++Y Y
Sbjct  168  LVYGY  172



>emb|CBN74512.1| conserved unknown protein [Ectocarpus siliculosus]
Length=286

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  195  GFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q +K AKGTTTLAF F+ G++V+ DSR++MG YI+S +VKK+IEINPY+LGTM
Sbjct  54   GYGTDHAQDIKFAKGTTTLAFKFQGGIIVSVDSRSTMGPYIASGTVKKVIEINPYLLGTM  113

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            AGGAADC FW RNLG++CR++EL NK  ISVA ASKLL+N +  Y
Sbjct  114  AGGAADCSFWERNLGIQCRMYELRNKERISVAAASKLLSNTMSQY  158



>gb|KDR73611.1| hypothetical protein GALMADRAFT_124865 [Galerina marginata CBS 
339.88]
Length=314

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            P+F +PN+ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G YI
Sbjct  49   PTFSVPNVADPTSFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSYI  108

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANI  497
            +S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N+
Sbjct  109  ASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSNL  168

Query  498  LYSY  509
            +YSY
Sbjct  169  VYSY  172



>gb|KIK59625.1| hypothetical protein GYMLUDRAFT_201809 [Gymnopus luxurians FD-317 
M1]
Length=303

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P++ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  47   VPNFTVPSVPDPSAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LGV CRLHEL N+  ISV+ ASK L+N
Sbjct  107  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGVHCRLHELRNRERISVSAASKYLSN  166

Query  495  ILYSY  509
            ++YSY
Sbjct  167  LVYSY  171



>ref|XP_007361365.1| N-terminal nucleophile aminohydrolase [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF66103.1| N-terminal nucleophile aminohydrolase [Dichomitus squalens LYAD-421 
SS1]
Length=314

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (73%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP F++P++ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPMFKLPSVPDPTSFLRMHTDDHADPSCRIKIKHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSY  509
            ++YSY
Sbjct  168  LVYSY  172



>ref|XP_003332961.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP88542.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=289

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 89/124 (72%), Gaps = 6/124 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF------XKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            VP F +P + D   F       + A   +K   GTTTLAF F+ G++VA DSRA+ G YI
Sbjct  41   VPRFDLPGVKDPVSFLRTHTDDRSADAKIKIKHGTTTLAFRFQHGIIVAVDSRATAGSYI  100

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANI  497
            +S +VKK+IEINP++LGTMAGGAADCQ+W   LG++CRLHEL NK  ISVA ASK L+N+
Sbjct  101  ASGTVKKVIEINPFLLGTMAGGAADCQYWETYLGIQCRLHELRNKSRISVAAASKYLSNL  160

Query  498  LYSY  509
            +YSY
Sbjct  161  VYSY  164



>gb|KFY06285.1| hypothetical protein V491_08732, partial [Pseudogymnoascus pannorum 
VKM F-3775]
Length=161

 Score =   141 bits (356),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 8/145 (6%)
 Frame = +3

Query  99   ESTAPIRGESSELFDEIPRVP-SFQIPNITDFDGFXKDAIQ-------MVKPAKGTTTLA  254
            E  A  + E  EL  E+P +   F +P +     + + A          +K A GTTTLA
Sbjct  16   EGYAKEQQEEMELVQEVPALSLKFAMPPVAQPSSWLRAATDDYSNPNCPIKIAHGTTTLA  75

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F F+ G++VA DSRA+ G +I+SQ+VKK+IEIN  +LGTMAGGAADCQ+W   LG++CRL
Sbjct  76   FRFQGGIIVATDSRATAGNWIASQTVKKVIEINNSLLGTMAGGAADCQYWLAYLGMQCRL  135

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HEL  KR I+VA ASK+LANI+YSY
Sbjct  136  HELRQKRRITVAAASKILANIVYSY  160



>gb|KIK08153.1| hypothetical protein K443DRAFT_672633 [Laccaria amethystina LaAM-08-1]
Length=302

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP++ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  37   VPTFSIPDVADPTSFLQMHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  96

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N
Sbjct  97   VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  156

Query  495  ILYSY  509
            ++YSY
Sbjct  157  LVYSY  161



>gb|KIM65350.1| hypothetical protein SCLCIDRAFT_542814 [Scleroderma citrinum 
Foug A]
Length=306

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 102/166 (61%), Gaps = 25/166 (15%)
 Frame = +3

Query  87   FSGLESTAPIRGESSELFDEIPRV------------------PSFQIPNITDFDGFXK--  206
            F+GL S   +R  ++ + D+   +                  PSF +P++ D   F +  
Sbjct  8    FTGLSSNVELRRRNATVVDDDEDISDAMWGSLGGFGSLASGAPSFTVPSVPDPAAFLRLH  67

Query  207  -----DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGT  371
                 D    +K   GTTTLAF ++ GV+VA DSRA+ G YI+S +VKK+IEINPY+LGT
Sbjct  68   TDDHADPSCRIKIQHGTTTLAFRYQGGVIVAVDSRATAGNYIASGTVKKVIEINPYLLGT  127

Query  372  MAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            MAGGAADCQFW   LG+ CRLHEL N+  ISV+ ASK L+N++YSY
Sbjct  128  MAGGAADCQFWETYLGMHCRLHELRNRERISVSAASKYLSNLVYSY  173



>gb|KIJ17479.1| hypothetical protein PAXINDRAFT_168130 [Paxillus involutus ATCC 
200175]
Length=315

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P++ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  49   VPSFMVPSVPDPAAFLRLHTDDHADPSCKIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N
Sbjct  109  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNRERISVSAASKYLSN  168

Query  495  ILYSY  509
            ++YSY
Sbjct  169  LVYSY  173



>ref|XP_007100520.1| PREDICTED: proteasome subunit beta type-5 isoform X4 [Physeter 
catodon]
Length=199

 Score =   142 bits (359),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFXKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  I    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLIAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK  ISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSY  509
            SKLLAN++Y Y
Sbjct  139  SKLLANMVYQY  149



>ref|XP_007418509.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
 gb|EGF98220.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
Length=296

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 89/124 (72%), Gaps = 6/124 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            VP+F+ P + D   F +           +K   GTTTLAF FK G++VA DSRA+ G YI
Sbjct  44   VPTFEFPAVDDPAAFLRAHTDDRSPDSRIKIRHGTTTLAFRFKHGIVVAVDSRATAGSYI  103

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANI  497
            +S +VKK+IEINP++LGTMAGGAADCQ+W   LG++CRLHEL NK  ISVA ASK L+N+
Sbjct  104  ASGTVKKVIEINPFLLGTMAGGAADCQYWETYLGMQCRLHELRNKSRISVAAASKHLSNL  163

Query  498  LYSY  509
            +YSY
Sbjct  164  VYSY  167



>ref|XP_007764597.1| 20S proteasome subunit [Coniophora puteana RWD-64-598 SS2]
 gb|EIW84942.1| 20S proteasome subunit [Coniophora puteana RWD-64-598 SS2]
Length=314

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF++P + D   F +       D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  48   VPSFEVPAVPDPSAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  167

Query  495  ILYSY  509
            ++Y Y
Sbjct  168  LVYGY  172



>ref|XP_001875479.1| 20S proteasome subunit [Laccaria bicolor S238N-H82]
 gb|EDR14920.1| 20S proteasome subunit [Laccaria bicolor S238N-H82]
Length=307

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP++ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  41   VPTFSIPDVADPTSFLQLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  100

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N
Sbjct  101  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  160

Query  495  ILYSY  509
            ++YSY
Sbjct  161  LVYSY  165



>ref|XP_003801967.1| PREDICTED: proteasome subunit beta type-5 [Otolemur garnettii]
Length=263

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 95/131 (73%), Gaps = 4/131 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFXKD-AIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P+ PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPKSPSDGLSLVAPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK  ISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSY  509
            SKLLAN++Y Y
Sbjct  139  SKLLANMVYQY  149



>gb|AAS01050.1| putative proteasome 20S beta5 subunit [Brassica napus]
Length=150

 Score =   140 bits (354),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAAD QFWHRNLG+KCRLHELANKR ISV+GA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADRQFWHRNLGIKCRLHELANKRRISVSGA  60

Query  477  SKLLANILYSY  509
            SKLLAN+LYSY
Sbjct  61   SKLLANMLYSY  71



>ref|XP_007850837.1| proteasome component pre2 precursor [Moniliophthora roreri MCA 
2997]
 gb|ESK89859.1| proteasome component pre2 precursor [Moniliophthora roreri MCA 
2997]
Length=297

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P++ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  45   VPTFGVPSVPDPSAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N
Sbjct  105  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNRERISVSAASKYLSN  164

Query  495  ILYSY  509
            ++YSY
Sbjct  165  LVYSY  169



>gb|EUC61688.1| proteasome subunit beta type-5 protein [Rhizoctonia solani AG-3 
Rhs1AP]
Length=302

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP + D  GF +       D    +K   GTTTLAF FK G++V  DSRA+ G Y
Sbjct  45   VPAFNIPRVPDPIGFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGIIVCVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSY  509
            ++YSY
Sbjct  165  LVYSY  169



>gb|KEP54479.1| proteasome subunit beta type-5 protein [Rhizoctonia solani 123E]
Length=302

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP + D  GF +       D    +K   GTTTLAF FK G++V  DSRA+ G Y
Sbjct  45   VPAFNIPRVPDPIGFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGIIVCVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSY  509
            ++YSY
Sbjct  165  LVYSY  169



>gb|EMS25821.1| 20S proteasome subunit beta 5 [Rhodosporidium toruloides NP11]
 emb|CDR38163.1| RHTO0S03e04852g1_1 [Rhodosporidium toruloides]
Length=298

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F++P   D   F +       D    +K   GTTTLAF F+ G++VA DSRA+ G Y
Sbjct  47   VPNFEMPATIDPTSFLQLHTDDASDPSCRIKINHGTTTLAFKFQGGIVVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N   ISVA ASK LAN
Sbjct  107  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNHERISVAAASKYLAN  166

Query  495  ILYSY  509
            ++YSY
Sbjct  167  LVYSY  171



>ref|XP_004347536.2| hypothetical protein CAOG_04785 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94093.1| hypothetical protein CAOG_004785 [Capsaspora owczarzaki ATCC 
30864]
Length=305

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 109/179 (61%), Gaps = 20/179 (11%)
 Frame = +3

Query  9    SPIVP*VESTPSFYS-RYLVVT-----MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQ  170
            +PI     STP+  S RY  ++     M   + SGL        E ++    + ++P F 
Sbjct  20   APITA-ARSTPASVSGRYAALSAEDDAMAESELSGLT-------ELNQQLGAMSQLPVFD  71

Query  171  IPNITD----FDGFXKDAIQMVKP--AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            +P + D       + +D    VK     GTTTLAF FK G++VA DSRA+ G YI+S +V
Sbjct  72   VPAVQDPAAFLHAYTEDPHSKVKIHIQHGTTTLAFKFKHGIIVAVDSRATGGSYIASGTV  131

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            KK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK  ISVA ASKLLAN++Y Y
Sbjct  132  KKVIEINPYLLGTMAGGAADCSFWERELARRCRIYELRNKERISVAAASKLLANMVYGY  190



>gb|KIL00906.1| hypothetical protein PAXRUDRAFT_821100 [Paxillus rubicundulus 
Ve08.2h10]
Length=314

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P++ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPSFMVPSVPDPAAFLRLHTDDHADPSCKIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  167

Query  495  ILYSY  509
            ++YSY
Sbjct  168  LVYSY  172



>ref|XP_007723577.1| proteasome component PRE2 [Capronia coronata CBS 617.96]
 gb|EXJ91383.1| proteasome component PRE2 [Capronia coronata CBS 617.96]
Length=283

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 96/137 (70%), Gaps = 8/137 (6%)
 Frame = +3

Query  123  ESSELFDEIPRVP-SFQIPNITDFDGFXKDAIQ-------MVKPAKGTTTLAFIFKEGVM  278
            E  +  D +P +   F +P ++    F + A          +K A GTTTLAF FK G++
Sbjct  22   EQDDYTDTLPPLSLKFALPPVSRPSAFLRAATDDYSNPNCPIKIAHGTTTLAFRFKGGII  81

Query  279  VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRX  458
            VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+W   LG++CRLHEL +KR 
Sbjct  82   VATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQYWLAYLGIQCRLHELRHKRR  141

Query  459  ISVAGASKLLANILYSY  509
            ISVA ASK+LAN++YSY
Sbjct  142  ISVAAASKILANLVYSY  158



>gb|KIW62885.1| proteasome subunit beta type-5 [Capronia semiimmersa]
Length=283

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 8/137 (6%)
 Frame = +3

Query  123  ESSELFDEIPRVP-SFQIPNITDFDGFXKDAIQ-------MVKPAKGTTTLAFIFKEGVM  278
            E +++ + +P +   F +P I     F + A          +K A GTTTLAF FK G++
Sbjct  22   EQNDICETVPPLSLKFALPPIPRPSAFLRAATDDHSNPNCPIKIAHGTTTLAFRFKGGII  81

Query  279  VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRX  458
            VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+W   LGV+CRLHEL +KR 
Sbjct  82   VATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQYWLAYLGVQCRLHELHHKRR  141

Query  459  ISVAGASKLLANILYSY  509
            ISVA ASK+LAN++YSY
Sbjct  142  ISVAAASKILANLVYSY  158



>gb|KJA27011.1| hypothetical protein HYPSUDRAFT_35526 [Hypholoma sublateritium 
FD-334 SS-4]
Length=319

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            PSF +P+I D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G YI
Sbjct  49   PSFNVPDIPDPTSFLRLHTDDHADPSCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSYI  108

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANI  497
            +S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N+
Sbjct  109  ASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSNL  168

Query  498  LYSY  509
            +YSY
Sbjct  169  VYSY  172



>emb|CDO73558.1| hypothetical protein BN946_scf185014.g28 [Trametes cinnabarina]
Length=311

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (73%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F++P + D   F +       D    +K   GTTTLAF ++ GV+VA DSRA+ G Y
Sbjct  48   VPTFKVPAVPDPTSFLRMHTDDHADPSCRIKIKHGTTTLAFRYQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSY  509
            ++YSY
Sbjct  168  LVYSY  172



>ref|XP_002911819.1| proteasome component pts1 [Coprinopsis cinerea okayama7#130]
 gb|EFI28325.1| proteasome component pts1 [Coprinopsis cinerea okayama7#130]
Length=313

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P + D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  49   VPTFTVPALPDPTAFLRLHTDDHADPSCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL NK  ISV+ ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNKERISVSAASKFLSN  168

Query  495  ILYSY  509
            ++YSY
Sbjct  169  LVYSY  173



>ref|XP_007449603.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Lipotes 
vexillifer]
Length=203

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFXKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK  ISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSY  509
            SKLLAN++Y Y
Sbjct  139  SKLLANMVYQY  149



>ref|XP_004283229.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Orcinus 
orca]
Length=203

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFXKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK  ISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSY  509
            SKLLAN++Y Y
Sbjct  139  SKLLANMVYQY  149



>gb|EWM22648.1| proteasome subunit beta type 5 [Nannochloropsis gaditana]
Length=278

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +3

Query  195  GFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q +K AKGTTTLAF F  G++VA DSR++ G Y++S +VKK+IEINPY+LGTM
Sbjct  55   GYGTDQHQELKFAKGTTTLAFKFDGGIVVAVDSRSTQGAYVASGTVKKVIEINPYLLGTM  114

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            AGGAADC FW RNLG++CRL+EL +K  ISVA ASKLLAN +  Y
Sbjct  115  AGGAADCSFWERNLGIQCRLYELRHKERISVAAASKLLANTVMQY  159



>gb|KIJ69319.1| hypothetical protein HYDPIDRAFT_79749 [Hydnomerulius pinastri 
MD-312]
Length=315

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
             PSF +P++ D   F +       D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  52   TPSFMVPSVPDPAAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  111

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ ASK L+N
Sbjct  112  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  171

Query  495  ILYSY  509
            ++YSY
Sbjct  172  LVYSY  176



>ref|XP_006746559.1| PREDICTED: proteasome subunit beta type-5, partial [Leptonychotes 
weddellii]
Length=160

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  59   GTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  118

Query  417  GVKCRLHELANKRXISVAGASKLLANILYSY  509
              +CR++EL NK  ISVA ASKLLAN++Y Y
Sbjct  119  ARQCRIYELRNKERISVAAASKLLANMVYQY  149



>ref|XP_002730946.1| PREDICTED: proteasome subunit beta type-5-like [Saccoglossus 
kowalevskii]
Length=277

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 98/146 (67%), Gaps = 15/146 (10%)
 Frame = +3

Query  87   FSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXK-----DAIQMVKPAKGTTTL  251
            F  L++  P      E ++E    P F +P + D   + K     D+   ++   GTTTL
Sbjct  26   FEALDNVEP------EFYNE----PKFTLPQVADPAEYLKQFEKEDSDVKIRFHHGTTTL  75

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF F+ GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR
Sbjct  76   AFKFQHGVIVAVDSRATAGPFIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLSQQCR  135

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            ++EL NK  ISVA ASKLLAN++Y+Y
Sbjct  136  IYELRNKERISVAAASKLLANMVYNY  161



>ref|XP_007880004.1| hypothetical protein PFL1_04286 [Pseudozyma flocculosa PF-1]
 gb|EPQ27959.1| hypothetical protein PFL1_04286 [Pseudozyma flocculosa PF-1]
Length=331

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = +3

Query  144  EIPRV-PSFQIPNITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            E+P V P+  +   TD D     A   +K + GTTTLAF F+ G++VA DSRA+ G YI+
Sbjct  47   ELPNVDPATFLSQYTDVDSSNPGA--KIKLSHGTTTLAFRFRGGIIVAVDSRATAGSYIA  104

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANIL  500
            S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK  ISVA ASK L+N++
Sbjct  105  SGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKYLSNLV  164

Query  501  YSY  509
            YSY
Sbjct  165  YSY  167



>gb|ESA00717.1| hypothetical protein GLOINDRAFT_338395 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64892.1| proteasome core particle subunit beta 5 [Rhizophagus irregularis 
DAOM 197198w]
Length=288

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 100/146 (68%), Gaps = 13/146 (9%)
 Frame = +3

Query  84   DFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKD----AIQMVKPAKGTTTL  251
            DF G ++    +G S   FD    VPS   PN T+F     D    A   +K   GTTTL
Sbjct  23   DFVGFDAA---KGFSLPTFD----VPS--CPNPTEFLKAHTDENSTAEYQIKLEHGTTTL  73

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            +F F+ G++VA DSRAS G +I++Q+VKK+IEINPY+LGTMAGGAADC FW R LG +CR
Sbjct  74   SFKFQGGIIVAVDSRASAGSFIATQTVKKVIEINPYLLGTMAGGAADCIFWQRELGRRCR  133

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            L+EL NK  ISVA ASKLLAN++Y+Y
Sbjct  134  LYELRNKERISVAAASKLLANMVYAY  159



>ref|XP_004333043.1| proteasome endopeptidase subunit, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11030.1| proteasome endopeptidase subunit, putative [Acanthamoeba castellanii 
str. Neff]
Length=275

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 102/155 (66%), Gaps = 9/155 (6%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKDAIQM-----V  224
            +    + +DF  L    P   E ++L +E+  V  F +P +++   F  D  Q      +
Sbjct  1    MATAALNLDFLDL----PSEREDNQLQNEVLDVDRFTLPAVSNPASFLTDTFQETQAEPI  56

Query  225  KPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFW  404
            K   GTTTL+F+F+ G++VA DSRA+ G YI+SQSV+K+I INP++LGTMAGGAADC +W
Sbjct  57   KMLHGTTTLSFVFQGGIVVAVDSRATQGTYIASQSVQKVIRINPFLLGTMAGGAADCSYW  116

Query  405  HRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
             R LG + RL++L NK  ++VA ASK+L+NILY Y
Sbjct  117  ERELGRRTRLYQLRNKERMTVAAASKVLSNILYYY  151



>gb|EWC46740.1| proteasome component PRE2 [Drechslerella stenobrocha 248]
Length=282

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 8/149 (5%)
 Frame = +3

Query  87   FSGLESTAPIRGESS-ELFDEIPRVPSFQIPNITDFDGFXK----DAIQMVKPAK---GT  242
            +S +E  A +  +S  E+   +P+  SF +P I     F +    D      P K   GT
Sbjct  8    YSPVELDAALAEDSDDEVSSSLPQTVSFILPPIDQPAKFLRAMTDDHANPAAPIKLKHGT  67

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAF F+ GV+V  DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W   LG+
Sbjct  68   TTLAFKFQGGVIVCTDSRATQGSWIASQTVKKVIEINPYLLGTMAGGAADCQYWLTYLGM  127

Query  423  KCRLHELANKRXISVAGASKLLANILYSY  509
            +CRLH+L +KR ISVA ASK+LAN++YSY
Sbjct  128  ECRLHQLRHKRLISVAAASKILANLVYSY  156



>gb|EST08741.1| 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 
[Pseudozyma brasiliensis GHG001]
Length=344

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 12/138 (9%)
 Frame = +3

Query  126  SSELFDEIPRVP-SFQIPNI---------TDFDGFXKDAIQMVKPAKGTTTLAFIFKEGV  275
            SS   D++   P  F +PN+         TD D    +    +K A GTTTLAF FK G+
Sbjct  44   SSSAHDQMMGAPGQFDLPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRFKGGI  101

Query  276  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR  455
            +V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK 
Sbjct  102  IVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKE  161

Query  456  XISVAGASKLLANILYSY  509
             ISVA ASK L+N++YSY
Sbjct  162  RISVAAASKYLSNLVYSY  179



>gb|KFH47961.1| Proteasome subunit beta type-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=283

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 98/146 (67%), Gaps = 8/146 (5%)
 Frame = +3

Query  96   LESTAPIRGESSELFDEIPRVP-SFQIPNITDFDGFXKDAIQ-------MVKPAKGTTTL  251
            LE   P   E+ EL +    +   F +P +T    + + A          +K A GTTTL
Sbjct  13   LEQNDPFEDEAKELMNPADHLSMKFAMPPVTQPASWLRAATDDRSNPNCPIKIAHGTTTL  72

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF F+ G++VA DSRAS G +I+SQ+VKK+IEIN  +LGTMAGGAADCQFW   LG++CR
Sbjct  73   AFRFQGGIIVATDSRASAGDWIASQTVKKVIEINSVLLGTMAGGAADCQFWLAWLGMQCR  132

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHEL +KR ISVA ASK+LAN++YSY
Sbjct  133  LHELRHKRRISVAAASKILANLIYSY  158



>gb|KIW59603.1| proteasome subunit beta type-5 [Exophiala xenobiotica]
Length=282

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 95/140 (68%), Gaps = 11/140 (8%)
 Frame = +3

Query  123  ESSELFDEIPRVPS----FQIPNITDFDGFXKDAIQ-------MVKPAKGTTTLAFIFKE  269
            +S E  D    VPS    F +P +     F +            +K A GTTTLAF FK 
Sbjct  19   DSEEQNDYTDTVPSLSLKFALPPVARPSAFLRATTDDHANPNCPIKIAHGTTTLAFRFKG  78

Query  270  GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELAN  449
            G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+W   LG++CRLHEL +
Sbjct  79   GIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQYWLAYLGIQCRLHELRH  138

Query  450  KRXISVAGASKLLANILYSY  509
            KR ISVA ASK+LAN++YSY
Sbjct  139  KRRISVAAASKILANLVYSY  158



>ref|XP_628966.1| proteasome subunit beta type 5 [Dictyostelium discoideum AX4]
 sp|Q54BC8.1|PSB5_DICDI RecName: Full=Proteasome subunit beta type-5; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL60569.1| proteasome subunit beta type 5 [Dictyostelium discoideum AX4]
Length=272

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 102/152 (67%), Gaps = 6/152 (4%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFXKD------AIQMVKPA  233
            M+ IDF  +E + P   ++     +    P F++P   +   F ++      A + ++ A
Sbjct  1    MINIDFDNIEQSQPTLYDTLASDVKFLNTPHFELPPNANPGDFLRETFDHPSAPKALEFA  60

Query  234  KGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRN  413
             GTTTLAF++  G++V+ DS+++ G Y++S+SVKK+IEI P +LGTMAGGAADC FW R 
Sbjct  61   HGTTTLAFVYGGGIIVSVDSKSTQGPYVASRSVKKVIEITPTLLGTMAGGAADCSFWERE  120

Query  414  LGVKCRLHELANKRXISVAGASKLLANILYSY  509
            LG +CRL+EL NK  ISVA ASK+LANI+YSY
Sbjct  121  LGRRCRLYELRNKELISVAAASKILANIVYSY  152



>ref|XP_008731643.1| proteasome component PRE2 [Cladophialophora carrionii CBS 160.54]
 gb|ETI19284.1| proteasome component PRE2 [Cladophialophora carrionii CBS 160.54]
Length=283

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W   LGV+CRLHEL +KR ISVA ASK+LAN++YSY
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSY  158



>gb|EAW66194.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_b [Homo sapiens]
Length=148

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRXISVAGASKLLANILYSY  509
              +CR++EL NK  ISVA ASKLLAN++Y Y
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQY  94



>ref|XP_008156743.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Eptesicus 
fuscus]
Length=201

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 98/147 (67%), Gaps = 9/147 (6%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFXKDAIQMVKPAKGTTT  248
            S LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTT
Sbjct  5    SVLESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEEP--KIEILHGTTT  62

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +C
Sbjct  63   LAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC  122

Query  429  RLHELANKRXISVAGASKLLANILYSY  509
            R++EL NK  ISVA ASKLLAN++Y Y
Sbjct  123  RIYELRNKERISVAAASKLLANMVYQY  149



>gb|ELU16739.1| hypothetical protein CAPTEDRAFT_41193, partial [Capitella teleta]
Length=131

 Score =   139 bits (349),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF FK GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +
Sbjct  2    GTTTLAFKFKHGVIVAVDSRATAGDWIASQTVKKVIEINPYLLGTMAGGAADCQYWERVV  61

Query  417  GVKCRLHELANKRXISVAGASKLLANILYSY  509
              +CR++EL NK  ISVA ASKLLANI+Y+Y
Sbjct  62   ARQCRIYELRNKERISVAAASKLLANIVYNY  92



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 8/125 (6%)
 Frame = +3

Query  156  VPSFQIP-------NITDFDGFXKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
              +F+IP       ++  F     D I+ ++ A GTTTLAF FK GV+VA DSRA+ G +
Sbjct  38   TETFEIPQNFNPGEDLKQFTEGNDDNIK-IRIAHGTTTLAFKFKHGVIVAVDSRATAGDW  96

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +  +CR++EL NK  ISVA ASKLLAN
Sbjct  97   IASQTVKKVIEINPYLLGTMAGGAADCQYWERVVARQCRIYELRNKERISVAAASKLLAN  156

Query  495  ILYSY  509
            I+Y+Y
Sbjct  157  IVYNY  161



>ref|XP_007761346.1| proteasome component PRE2 [Cladophialophora yegresii CBS 114405]
 gb|EXJ53831.1| proteasome component PRE2 [Cladophialophora yegresii CBS 114405]
Length=283

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W   LGV+CRLHEL +KR ISVA ASK+LAN++YSY
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSY  158



>ref|XP_007321997.1| hypothetical protein SERLADRAFT_475676 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN95513.1| hypothetical protein SERLA73DRAFT_186558 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO21040.1| hypothetical protein SERLADRAFT_475676 [Serpula lacrymans var. 
lacrymans S7.9]
Length=317

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 8/132 (6%)
 Frame = +3

Query  138  FDEIPR-VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADS  293
            F  + R VPSF +P+++D   F +       D    +K   GTTTLAF F+ GV+VA DS
Sbjct  40   FGSLARGVPSFTVPSVSDPAAFLRLHTDDHADPNCKIKIQHGTTTLAFRFQGGVIVAVDS  99

Query  294  RASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAG  473
            RA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISV+ 
Sbjct  100  RATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSA  159

Query  474  ASKLLANILYSY  509
            ASK L+N++Y Y
Sbjct  160  ASKYLSNLVYGY  171



>ref|XP_007739562.1| proteasome component PRE2 [Cladophialophora psammophila CBS 110553]
 gb|EXJ76245.1| proteasome component PRE2 [Cladophialophora psammophila CBS 110553]
 gb|KIW99083.1| proteasome subunit beta type-5 [Cladophialophora bantiana CBS 
173.52]
Length=283

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W   LGV+CRLHEL +KR ISVA ASK+LAN++YSY
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSY  158



>gb|KIX98319.1| proteasome subunit beta type-5 [Fonsecaea multimorphosa CBS 102226]
Length=283

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W   LGV+CRLHEL +KR ISVA ASK+LAN++YSY
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSY  158



>gb|KIW29970.1| proteasome subunit beta type-5 [Cladophialophora immunda]
Length=283

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W   LGV+CRLHEL +KR ISVA ASK+LAN++YSY
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSY  158



>gb|KDQ18004.1| hypothetical protein BOTBODRAFT_104582 [Botryobasidium botryosum 
FD-172 SS1]
Length=308

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF+IP + D   F +       D    +K   GTTTLAF F+ G++VA DSRA+ G Y
Sbjct  45   IPSFEIPRVPDPTNFLRMHTDDRNDPSCRIKIQHGTTTLAFRFQGGIIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSY  509
            ++Y Y
Sbjct  165  LVYGY  169



>ref|XP_006696296.1| hypothetical protein CTHT_0059780 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS17965.1| hypothetical protein CTHT_0059780 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=283

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 97/146 (66%), Gaps = 17/146 (12%)
 Frame = +3

Query  123  ESSELFDEI----------PRVPSFQIPNITDFDGFXKDAIQ-------MVKPAKGTTTL  251
            + +ELFDE+          P    F +P +T    + +            +K A GTTTL
Sbjct  14   QQTELFDELEQQDLVTTNPPLSLKFAMPPVTHPSAWLRAVTDDRSNPSCPIKIAHGTTTL  73

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF FKEG++VA DSRA+ G +I+SQ+VKK+IEIN  +LGTMAGGAADCQ+W   LG++CR
Sbjct  74   AFRFKEGIIVATDSRATAGNWIASQTVKKVIEINSELLGTMAGGAADCQYWLAWLGMQCR  133

Query  432  LHELANKRXISVAGASKLLANILYSY  509
            LHEL +KR ISVA ASK+LAN++Y Y
Sbjct  134  LHELRHKRRISVAAASKILANLVYQY  159



>gb|KIW80298.1| hypothetical protein Z517_06913 [Fonsecaea pedrosoi CBS 271.37]
Length=283

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W   LGV+CRLHEL +KR ISVA ASK+LAN++YSY
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSY  158



>ref|XP_007730075.1| proteasome component PRE2 [Capronia epimyces CBS 606.96]
 gb|EXJ93185.1| proteasome component PRE2 [Capronia epimyces CBS 606.96]
Length=283

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 97/137 (71%), Gaps = 8/137 (6%)
 Frame = +3

Query  123  ESSELFDEIPRVP-SFQIPNITDFDGFXKDAIQ-------MVKPAKGTTTLAFIFKEGVM  278
            E ++  + +P +   F +P ++    F + A          +K A GTTTLAF FK G++
Sbjct  22   EQNDYTETLPPLSLKFALPPVSRPSAFLRAATDDYSNPNCPIKIAHGTTTLAFRFKGGII  81

Query  279  VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRX  458
            VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+W   LG++CRLHEL +KR 
Sbjct  82   VATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQYWLAYLGIQCRLHELRHKRR  141

Query  459  ISVAGASKLLANILYSY  509
            ISVA ASK+LAN++YSY
Sbjct  142  ISVAAASKILANLVYSY  158



>emb|CDI55907.1| probable PRE2-20S core proteasome subunit (beta5) (C-terminal 
fragment) [Melanopsichium pennsylvanicum 4]
Length=324

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 95/140 (68%), Gaps = 12/140 (9%)
 Frame = +3

Query  120  GESSELFDEIPRVP-SFQIPNI---------TDFDGFXKDAIQMVKPAKGTTTLAFIFKE  269
            G SS   D++   P  F +PN+         TD D    +    +K A GTTTLAF F+ 
Sbjct  22   GGSSAAQDQLMGAPGQFALPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRFRG  79

Query  270  GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELAN  449
            G++V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N
Sbjct  80   GIIVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRN  139

Query  450  KRXISVAGASKLLANILYSY  509
            K  ISVA ASK L+N++YSY
Sbjct  140  KERISVAAASKYLSNLVYSY  159



>gb|KIO13433.1| hypothetical protein M404DRAFT_122218 [Pisolithus tinctorius 
Marx 270]
Length=304

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P++ D   F +       D    +K   GTTTLAF ++ GV+VA DSRA+ G Y
Sbjct  49   VPTFTVPSVPDPAAFLRLHTDDHADPSCRIKIQHGTTTLAFRYQGGVIVAVDSRATAGNY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQFW   LG+ CRLHEL N   ISV+ ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHELRNHERISVSAASKYLSN  168

Query  495  ILYSY  509
            ++YSY
Sbjct  169  LVYSY  173



>gb|KIW10869.1| proteasome subunit beta type-5 [Exophiala spinifera]
Length=283

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W   LG++CRLHEL +KR ISVA ASK+LAN++YSY
Sbjct  123  WLAYLGIQCRLHELRHKRRISVAAASKILANLVYSY  158



>gb|KIP12266.1| hypothetical protein PHLGIDRAFT_17679 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=306

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 93/140 (66%), Gaps = 7/140 (5%)
 Frame = +3

Query  111  PIRGESSELFDEIPRVPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKE  269
            P+ G  +   +    V  F IP + D   F +       D    +K   GTTTLAF F+ 
Sbjct  33   PMWGSQAGFGNLASGVVKFNIPTVPDPSAFLRMHTDDFADPSCRIKIKHGTTTLAFRFQG  92

Query  270  GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELAN  449
            GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N
Sbjct  93   GVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRN  152

Query  450  KRXISVAGASKLLANILYSY  509
            +  ISVA ASK L+N++YSY
Sbjct  153  RERISVAAASKYLSNLVYSY  172



>ref|XP_009541838.1| subunit beta type peptidase T1A, 20S proteasome [Heterobasidion 
irregulare TC 32-1]
 gb|ETW85983.1| subunit beta type peptidase T1A, 20S proteasome [Heterobasidion 
irregulare TC 32-1]
Length=313

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = +3

Query  162  SFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            SF +P++ D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y++
Sbjct  50   SFDVPSVADPAAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSYVA  109

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANIL  500
            S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N++
Sbjct  110  SGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLV  169

Query  501  YSY  509
            YSY
Sbjct  170  YSY  172



>ref|XP_007319616.1| hypothetical protein SERLADRAFT_470232 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN98284.1| hypothetical protein SERLA73DRAFT_183200 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO23854.1| hypothetical protein SERLADRAFT_470232 [Serpula lacrymans var. 
lacrymans S7.9]
Length=319

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 87/125 (70%), Gaps = 7/125 (6%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F  P + D   F +       D    +K   GTTTLAF FK GV+VA DSR+S G Y
Sbjct  48   VPAFAFPAVQDPAAFLRLHTDDHDDPNCKIKIQHGTTTLAFKFKGGVIVAVDSRSSAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLAN  494
            I S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+  ISVA ASK L+N
Sbjct  108  IGSGTVKKVIEINPYLLGTMAGGAADCQYWEMYLGMHCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSY  509
            ++YSY
Sbjct  168  LVYSY  172



>ref|XP_006682354.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF76856.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=267

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K  KGTTTLAF F +GV+VA DSRA+MG YI SQ+VKK+IEINPY+LGTMAGGAADC F
Sbjct  1    IKLEKGTTTLAFKFAKGVVVAVDSRATMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSF  60

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W R LG + RL+EL NK  ISVA ASKLL+N++Y Y
Sbjct  61   WERELGRRARLYELRNKERISVAAASKLLSNMVYGY  96



>ref|XP_009160370.1| proteasome component PRE2 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59909.1| proteasome component PRE2 [Exophiala dermatitidis NIH/UT8656]
Length=283

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W   LG++CRLHEL +KR ISVA ASK+LAN++YSY
Sbjct  123  WLAYLGIQCRLHELRHKRRISVAAASKILANLVYSY  158



>gb|KIW41006.1| proteasome subunit beta type-5 [Exophiala oligosperma]
Length=283

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRXISVAGASKLLANILYSY  509
            W   LG++CRLHEL +KR ISVA ASK+LAN++YSY
Sbjct  123  WLAYLGIQCRLHELRHKRRISVAAASKILANLVYSY  158



>ref|XP_007821942.1| hypothetical protein MAA_05753 [Metarhizium robertsii ARSEF 23]
 gb|EFY98614.1| hypothetical protein MAA_05753 [Metarhizium robertsii ARSEF 23]
 gb|EXV04235.1| proteasome subunit [Metarhizium robertsii]
 gb|KFG81833.1| proteasome component PRE2 precursor [Metarhizium anisopliae]
 gb|KID68564.1| Proteasome B-type subunit, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID80098.1| hypothetical protein MBR_01410, partial [Metarhizium brunneum 
ARSEF 3297]
 gb|KID91131.1| hypothetical protein MGU_02085 [Metarhizium guizhouense ARSEF 
977]
 gb|KIE00047.1| Proteasome B-type subunit, partial [Metarhizium majus ARSEF 297]
Length=283

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 98/145 (68%), Gaps = 8/145 (6%)
 Frame = +3

Query  99   ESTAPIRGESSELFDEIPRVPS-FQIPNITDFDGFXKDAIQ-------MVKPAKGTTTLA  254
            E   P   E+ E+ D    + + F +P I+    + + A          +K A GTTTLA
Sbjct  14   EQNEPFENEAQEMMDATSSLTTKFAMPPISQPSSWLRAATDDRSNPDCPIKIAHGTTTLA  73

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F F+ G++VA DSRA+ G +I+SQ+VKK+IEIN  +LGTMAGGAADCQ+W   LG++CRL
Sbjct  74   FRFQGGIIVATDSRATAGNWIASQTVKKVIEINSVLLGTMAGGAADCQYWLAWLGMQCRL  133

Query  435  HELANKRXISVAGASKLLANILYSY  509
            HEL +KR ISVA ASK+LAN++YSY
Sbjct  134  HELRHKRRISVAAASKILANLVYSY  158



>ref|XP_007100517.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Physeter 
catodon]
Length=263

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFXKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  I    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLIAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK  ISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSY  509
            SKLLAN++Y Y
Sbjct  139  SKLLANMVYQY  149



>ref|XP_007989006.1| PREDICTED: proteasome subunit beta type-5 isoform X3 [Chlorocebus 
sabaeus]
Length=197

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFXKD-AIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLAAPGWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK  ISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSY  509
            SKLLAN++Y Y
Sbjct  139  SKLLANMVYQY  149



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 103/153 (67%), Gaps = 14/153 (9%)
 Frame = +3

Query  72   MVRIDFSGLESTAPI-----RGESSELFDEIPRV--PSFQIPNITDFDGFXKDAIQMVKP  230
            M  I+   L++ AP+     R +  E   +IP V  P+  +  +TD   + K     +K 
Sbjct  1    MAMIEECSLDAFAPLSLKAPRDDGVEF--QIPEVINPALHLRELTD-SKYGKG----IKF  53

Query  231  AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHR  410
              GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R
Sbjct  54   NHGTTTLAFKFQHGVVVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMFWER  113

Query  411  NLGVKCRLHELANKRXISVAGASKLLANILYSY  509
             L  +CR++EL NK  ISVA ASK+LAN++Y+Y
Sbjct  114  VLAKQCRIYELRNKERISVAAASKILANMVYNY  146



>gb|EPS96804.1| hypothetical protein FOMPIDRAFT_1025230 [Fomitopsis pinicola 
FP-58527 SS1]
Length=304

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +3

Query  159  PSFQIPNITDFDGFXK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            P+F +P++ D   F +       D    +K   GTTTLAF +K GV+VA DSRA+ G Y+
Sbjct  49   PNFMVPDVPDPAAFLRLHTDDHADPSCRIKIKHGTTTLAFRYKGGVVVAVDSRATAGSYV  108

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRXISVAGASKLLANI  497
            +S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+  ISVA ASK L+N+
Sbjct  109  ASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRNRERISVAAASKYLSNL  168

Query  498  LYSY  509
            +Y Y
Sbjct  169  VYGY  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115