BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006J06

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594336.1|  PREDICTED: squalene synthase-like                  278   1e-88   Nicotiana tomentosiformis
gb|AAD20626.1|  squalene synthase                                       277   2e-88   Capsicum annuum
ref|NP_001236365.1|  squalene synthase                                  274   2e-87   
ref|XP_009759256.1|  PREDICTED: squalene synthase-like                  274   3e-87   Nicotiana sylvestris
ref|XP_006591920.1|  PREDICTED: squalene synthase isoform X2            273   9e-87   
gb|AEX26930.1|  squalene synthase 1-2                                   272   1e-86   Solanum tuberosum [potatoes]
dbj|BAA82093.1|  squalene synthase                                      272   1e-86   Solanum tuberosum [potatoes]
ref|XP_006362006.1|  PREDICTED: squalene synthase-like isoform X1       272   1e-86   Solanum tuberosum [potatoes]
gb|ADG36719.1|  squalene synthase 2                                     272   2e-86   Glycyrrhiza uralensis [Chinese licorice]
gb|ACT52825.1|  squalene synthase 2                                     272   2e-86   Glycyrrhiza uralensis [Chinese licorice]
gb|ACS66749.1|  squalene synthase                                       272   2e-86   Glycyrrhiza uralensis [Chinese licorice]
gb|AGS57530.1|  squalene synthase                                       272   2e-86   Solanum nigrum
gb|ADG36717.1|  squalene synthase 2                                     272   2e-86   Glycyrrhiza uralensis [Chinese licorice]
emb|CAJ77655.1|  squalene synthase 2                                    272   2e-86   Glycyrrhiza eurycarpa
ref|XP_006591919.1|  PREDICTED: squalene synthase isoform X1            273   2e-86   
ref|NP_001234716.1|  squalene synthase                                  271   2e-86   
emb|CAJ77653.1|  squalene synthase 2                                    271   2e-86   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_009631700.1|  PREDICTED: squalene synthase                       271   3e-86   Nicotiana tomentosiformis
ref|XP_003537842.1|  PREDICTED: squalene synthase-like isoform X1       271   3e-86   Glycine max [soybeans]
gb|AAB02945.1|  squalene synthase                                       270   3e-86   Nicotiana tabacum [American tobacco]
ref|XP_008236983.1|  PREDICTED: squalene synthase-like                  271   4e-86   Prunus mume [ume]
gb|AGB05603.1|  squalene synthase                                       271   4e-86   Camellia oleifera [abura-tsubaki]
gb|AEX26929.1|  squalene synthase 1-1                                   271   5e-86   Solanum tuberosum [potatoes]
ref|XP_006360639.1|  PREDICTED: squalene synthase-like                  271   5e-86   
gb|KDP41726.1|  hypothetical protein JCGZ_26744                         271   5e-86   Jatropha curcas
gb|AFR77735.1|  squalene synthase                                       270   7e-86   Camellia oleifera [abura-tsubaki]
gb|AAM27472.1|  squalene synthase                                       266   1e-85   Nicotiana tabacum [American tobacco]
gb|ACN69082.1|  squalene synthase                                       270   2e-85   Diospyros kaki [Japanese persimmon]
gb|AEX26932.1|  squalene synthase                                       269   2e-85   Solanum chacoense
gb|AAB08578.1|  squalene synthase                                       269   2e-85   Nicotiana tabacum [American tobacco]
gb|ADW27427.1|  squalene synthase                                       268   5e-85   Astragalus membranaceus
gb|ADV57358.1|  squalene synthase                                       268   5e-85   Astragalus membranaceus
dbj|BAA13084.1|  squalene synthase                                      268   6e-85   Glycyrrhiza glabra
dbj|BAH23428.1|  squalene synthetase                                    268   7e-85   Euphorbia tirucalli
gb|ACU21003.1|  unknown                                                 268   8e-85   Glycine max [soybeans]
ref|XP_002512982.1|  farnesyl-diphosphate farnesyltransferase, pu...    268   8e-85   
gb|AHA84150.1|  squalene synthase                                       268   9e-85   Phaseolus vulgaris [French bean]
ref|XP_009802568.1|  PREDICTED: squalene synthase                       267   9e-85   Nicotiana sylvestris
ref|XP_004248691.1|  PREDICTED: squalene synthase-like                  267   1e-84   Solanum lycopersicum
ref|XP_009376518.1|  PREDICTED: squalene synthase-like                  267   2e-84   Pyrus x bretschneideri [bai li]
emb|CDP20866.1|  unnamed protein product                                267   2e-84   Coffea canephora [robusta coffee]
gb|AFI33135.3|  squalene synthase                                       266   2e-84   Eriobotrya japonica [loquat]
gb|ADC95435.1|  squalene synthase                                       266   2e-84   Withania somnifera [ashwagandha]
ref|XP_010066209.1|  PREDICTED: squalene synthase                       266   3e-84   Eucalyptus grandis [rose gum]
gb|KDO43896.1|  hypothetical protein CISIN_1g015087mg                   262   3e-84   Citrus sinensis [apfelsine]
ref|XP_011088477.1|  PREDICTED: squalene synthase-like                  266   5e-84   Sesamum indicum [beniseed]
gb|KDO43895.1|  hypothetical protein CISIN_1g015087mg                   263   5e-84   Citrus sinensis [apfelsine]
ref|XP_006487314.1|  PREDICTED: squalene synthase isoform X1            265   6e-84   
gb|KDO43893.1|  hypothetical protein CISIN_1g015087mg                   265   6e-84   Citrus sinensis [apfelsine]
gb|KDO43892.1|  hypothetical protein CISIN_1g015087mg                   264   7e-84   Citrus sinensis [apfelsine]
ref|XP_011047507.1|  PREDICTED: squalene synthase isoform X2            263   8e-84   Populus euphratica
sp|P53800.1|FDFT_NICBE  RecName: Full=Squalene synthase; Short=SQ...    265   8e-84   Nicotiana benthamiana
ref|XP_004290304.1|  PREDICTED: squalene synthase-like isoform X1       265   9e-84   Fragaria vesca subsp. vesca
ref|XP_011458278.1|  PREDICTED: squalene synthase-like isoform X2       265   9e-84   Fragaria vesca subsp. vesca
ref|XP_004150142.1|  PREDICTED: squalene synthase-like                  265   1e-83   
ref|XP_007199882.1|  hypothetical protein PRUPE_ppa006420mg             265   1e-83   
emb|CAD23250.1|  farnesyl-diphosphate farnesyltransferase               265   1e-83   Medicago truncatula
ref|XP_007131767.1|  hypothetical protein PHAVU_011G040100g             265   2e-83   Phaseolus vulgaris [French bean]
gb|ADX01171.1|  putative squalene synthase                              265   2e-83   Bacopa monnieri
gb|AGS78117.1|  squalene synthase 1                                     264   2e-83   Malus domestica [apple tree]
ref|XP_011047498.1|  PREDICTED: squalene synthase isoform X1            264   3e-83   Populus euphratica
gb|AEA41712.1|  squalene synthase                                       263   4e-83   Eleutherococcus senticosus
gb|AEA41713.1|  squalene synthase                                       263   4e-83   Eleutherococcus senticosus
ref|XP_003607040.1|  Squalene synthase                                  263   4e-83   
gb|AEM42980.1|  squalene synthase                                       263   5e-83   Siraitia grosvenorii [arhat fruit]
gb|AED99863.1|  squalene synthase                                       263   6e-83   Panax quinquefolius
gb|ABA29019.1|  squalene synthase                                       263   6e-83   Panax notoginseng [san-qi]
gb|AGI19256.1|  squalene synthase                                       263   7e-83   Panax notoginseng [san-qi]
ref|XP_006423442.1|  hypothetical protein CICLE_v10028537mg             263   8e-83   
ref|XP_009378420.1|  PREDICTED: squalene synthase-like                  262   8e-83   Pyrus x bretschneideri [bai li]
gb|AER23670.1|  squalene synthase                                       263   8e-83   Eleutherococcus senticosus
ref|XP_010109768.1|  hypothetical protein L484_008444                   262   9e-83   Morus notabilis
ref|XP_002266150.1|  PREDICTED: squalene synthase                       262   1e-82   Vitis vinifera
gb|EYU37849.1|  hypothetical protein MIMGU_mgv1a007228mg                260   1e-82   Erythranthe guttata [common monkey flower]
ref|NP_001280921.1|  squalene synthase-like                             261   2e-82   Malus domestica [apple tree]
emb|CAN81937.1|  hypothetical protein VITISV_028001                     262   2e-82   Vitis vinifera
gb|AFK29283.1|  putative squalene synthase 1                            261   2e-82   Salvia miltiorrhiza [Chinese salvia]
gb|ACR57219.1|  squalene synthase                                       261   2e-82   Salvia miltiorrhiza [Chinese salvia]
dbj|BAC56854.1|  squalene synthase                                      261   2e-82   Lotus japonicus
dbj|BAA24289.1|  squalene synthase                                      261   2e-82   Panax ginseng [Asiatic ginseng]
gb|ACX42426.1|  squalene synthase                                       261   2e-82   Bupleurum chinense
gb|ACX42425.1|  squalene synthase                                       261   2e-82   Bupleurum chinense
gb|ACA66014.1|  squalene synthase                                       261   3e-82   Panax ginseng [Asiatic ginseng]
gb|ADC32654.1|  squalene synthase                                       261   3e-82   Aralia elata
gb|ACX42423.1|  squalene synthase                                       261   4e-82   Bupleurum chinense
ref|XP_008461009.1|  PREDICTED: squalene synthase-like                  261   4e-82   Cucumis melo [Oriental melon]
emb|CAJ77652.1|  squalene synthase 1                                    261   4e-82   Glycyrrhiza uralensis [Chinese licorice]
gb|EYU37850.1|  hypothetical protein MIMGU_mgv1a007228mg                261   4e-82   Erythranthe guttata [common monkey flower]
gb|AAV58897.1|  squalene synthase                                       260   6e-82   Centella asiatica [Asiatic pennywort]
gb|AFZ93644.1|  squalene synthetase                                     260   7e-82   Euphorbia lathyris
ref|XP_004507500.1|  PREDICTED: squalene synthase-like                  260   8e-82   Cicer arietinum [garbanzo]
gb|ACS66750.1|  squalene synthase                                       260   8e-82   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36702.1|  squalene synthase 1                                     260   9e-82   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36705.1|  squalene synthase 1                                     260   9e-82   Glycyrrhiza uralensis [Chinese licorice]
gb|ACX42424.1|  squalene synthase                                       259   1e-81   Bupleurum chinense
gb|AAY46017.1|  squalene synthase                                       259   1e-81   Bupleurum falcatum
emb|CAJ58418.1|  squalene synthase                                      259   1e-81   Panax quinquefolius
gb|ACV88718.1|  squalene synthase                                       259   1e-81   Panax ginseng [Asiatic ginseng]
gb|AIK21786.1|  squalene synthase                                       259   1e-81   Panax notoginseng [san-qi]
gb|KHG01756.1|  Squalene synthase                                       259   2e-81   Gossypium arboreum [tree cotton]
gb|AEX26931.1|  squalene synthase 1-3                                   249   2e-81   Solanum tuberosum [potatoes]
gb|AFK36923.1|  unknown                                                 259   2e-81   Medicago truncatula
gb|ADD54645.1|  squalene synthase                                       259   3e-81   Bruguiera gymnorhiza [Burma mangrove]
gb|ADG36706.1|  squalene synthase 1                                     258   3e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36704.1|  squalene synthase 1                                     258   4e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36703.1|  squalene synthase 1                                     258   4e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|ADW78251.1|  squalene synthase                                       258   5e-81   Withania somnifera [ashwagandha]
ref|XP_011092839.1|  PREDICTED: squalene synthase-like                  258   5e-81   Sesamum indicum [beniseed]
gb|ACT52826.1|  squalene synthase 1                                     258   5e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36709.1|  squalene synthase 1                                     258   6e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36707.1|  squalene synthase 1                                     258   6e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36699.1|  squalene synthase 1                                     258   6e-81   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_010263865.1|  PREDICTED: squalene synthase-like                  258   6e-81   Nelumbo nucifera [Indian lotus]
gb|ADG36711.1|  squalene synthase 1                                     258   7e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36701.1|  squalene synthase 1                                     257   8e-81   Glycyrrhiza uralensis [Chinese licorice]
gb|KJB12166.1|  hypothetical protein B456_002G004400                    257   8e-81   Gossypium raimondii
ref|XP_011037190.1|  PREDICTED: squalene synthase-like                  257   1e-80   Populus euphratica
gb|KJB12169.1|  hypothetical protein B456_002G004400                    258   1e-80   Gossypium raimondii
gb|EYU42585.1|  hypothetical protein MIMGU_mgv1a007225mg                257   1e-80   Erythranthe guttata [common monkey flower]
gb|AFK29284.1|  putative squalene synthase 2                            257   1e-80   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010548076.1|  PREDICTED: squalene synthase-like isoform X2       257   1e-80   Tarenaya hassleriana [spider flower]
gb|AFN61199.1|  squalene synthase                                       257   1e-80   Chlorophytum borivilianum
ref|XP_010548075.1|  PREDICTED: squalene synthase-like isoform X1       257   1e-80   Tarenaya hassleriana [spider flower]
gb|ABG66304.1|  squalene synthase                                       256   3e-80   Polygala tenuifolia [Chinese senega-root]
ref|XP_010039888.1|  PREDICTED: squalene synthase-like isoform X2       256   4e-80   Eucalyptus grandis [rose gum]
dbj|BAA13083.1|  squalene synthase                                      256   4e-80   Glycyrrhiza glabra
emb|CAJ77654.1|  squalene synthase 1                                    255   4e-80   Glycyrrhiza eurycarpa
gb|ADG36708.1|  squalene synthase 1                                     255   5e-80   Glycyrrhiza uralensis [Chinese licorice]
gb|ACZ71037.1|  squalene synthase                                       255   7e-80   Panax ginseng [Asiatic ginseng]
ref|XP_010526913.1|  PREDICTED: squalene synthase-like                  255   8e-80   
gb|ACQ90302.1|  squalene synthase                                       255   9e-80   Gynostemma pentaphyllum [jiaogulan]
ref|XP_010039880.1|  PREDICTED: squalene synthase-like isoform X1       255   1e-79   Eucalyptus grandis [rose gum]
gb|AFT92039.1|  squalene synthase                                       254   2e-79   Euphorbia pekinensis
emb|CAJ58419.1|  squalene synthase                                      253   3e-79   Panax quinquefolius
gb|AAR20329.1|  squalene synthase                                       253   5e-79   Artemisia annua [sweet Annie]
ref|XP_002305455.2|  hypothetical protein POPTR_0004s16830g             254   8e-79   
gb|KJB32574.1|  hypothetical protein B456_005G247700                    252   9e-79   Gossypium raimondii
gb|AAG14896.2|AF302464_1  squalene synthase                             251   3e-78   Artemisia annua [sweet Annie]
ref|XP_002313765.1|  squalene synthase family protein                   251   3e-78   Populus trichocarpa [western balsam poplar]
gb|AAR20328.1|  squalene synthase                                       251   4e-78   Artemisia annua [sweet Annie]
ref|XP_007042047.1|  Squalene synthase 1 isoform 1                      250   6e-78   
gb|AIX97193.1|  squalene synthase                                       249   1e-77   Matricaria chamomilla var. recutita [German chamomile]
gb|ABX10442.1|  squalene synthase 2                                     249   1e-77   Gossypium hirsutum [American cotton]
gb|KHG07441.1|  Squalene synthase                                       248   2e-77   Gossypium arboreum [tree cotton]
gb|KHN25422.1|  Squalene synthase                                       248   3e-77   Glycine soja [wild soybean]
gb|ABQ96265.1|  squalene synthase                                       248   3e-77   Psammosilene tunicoides
gb|KJB12171.1|  hypothetical protein B456_002G004400                    248   4e-77   Gossypium raimondii
ref|NP_195190.1|  Squalene synthase 1                                   247   9e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690774.1|  PREDICTED: squalene synthase-like                  245   3e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002869133.1|  hypothetical protein ARALYDRAFT_912921             244   1e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_006412201.1|  hypothetical protein EUTSA_v10025338mg             244   1e-75   Eutrema salsugineum [saltwater cress]
ref|XP_010432389.1|  PREDICTED: squalene synthase                       243   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010437580.1|  PREDICTED: squalene synthase-like isoform X2       243   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010447048.1|  PREDICTED: squalene synthase-like                  243   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010437579.1|  PREDICTED: squalene synthase-like isoform X1       243   2e-75   Camelina sativa [gold-of-pleasure]
gb|KFK30097.1|  hypothetical protein AALP_AA7G216600                    243   2e-75   Arabis alpina [alpine rockcress]
ref|XP_009110610.1|  PREDICTED: squalene synthase                       242   5e-75   
ref|XP_008796682.1|  PREDICTED: squalene synthase-like isoform X3       241   6e-75   
ref|XP_009760451.1|  PREDICTED: squalene synthase-like                  242   7e-75   Nicotiana sylvestris
ref|XP_009108714.1|  PREDICTED: squalene synthase-like isoform X1       242   8e-75   Brassica rapa
ref|XP_006283828.1|  hypothetical protein CARUB_v10004929mg             242   1e-74   Capsella rubella
gb|EPS74249.1|  hypothetical protein M569_00507                         237   2e-74   Genlisea aurea
ref|XP_008796681.1|  PREDICTED: squalene synthase-like isoform X2       241   2e-74   Phoenix dactylifera
ref|XP_008796678.1|  PREDICTED: squalene synthase-like isoform X1       241   2e-74   Phoenix dactylifera
ref|XP_010934354.1|  PREDICTED: squalene synthase-like                  240   3e-74   Elaeis guineensis
gb|AGW25489.1|  squalene synthase                                       240   4e-74   Paris polyphylla var. yunnanensis
ref|XP_006412200.1|  hypothetical protein EUTSA_v10025392mg             239   5e-74   
ref|XP_009138312.1|  PREDICTED: squalene synthase-like                  239   9e-74   Brassica rapa
ref|XP_010025621.1|  PREDICTED: squalene synthase-like                  238   2e-73   Eucalyptus grandis [rose gum]
ref|XP_008795798.1|  PREDICTED: squalene synthase-like isoform X2       236   3e-73   
ref|XP_010447047.1|  PREDICTED: squalene synthase-like                  236   1e-72   Camelina sativa [gold-of-pleasure]
gb|AAY22201.1|  squalene synthase                                       236   1e-72   Datura inoxia [downy thornapple]
ref|XP_008795796.1|  PREDICTED: squalene synthase-like isoform X1       236   1e-72   Phoenix dactylifera
gb|AGI56082.1|  squalene synthase                                       235   3e-72   Dendrobium officinale
ref|XP_010432387.1|  PREDICTED: squalene synthase-like                  235   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006285747.1|  hypothetical protein CARUB_v10007220mg             234   7e-72   Capsella rubella
ref|XP_009389044.1|  PREDICTED: squalene synthase-like                  234   7e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002869132.1|  squalene synthase 2                                234   1e-71   
emb|CDX72493.1|  BnaC07g45150D                                          234   1e-71   
gb|KJB32578.1|  hypothetical protein B456_005G247700                    233   2e-71   Gossypium raimondii
gb|AHB20141.2|  squalene synthase                                       233   2e-71   Fritillaria thunbergii
gb|AFY63035.1|  squalene synthase                                       233   2e-71   Alisma plantago-aquatica subsp. orientale
gb|ACI14294.1|  squalene synthase                                       228   3e-71   Linum usitatissimum
gb|AGN32410.1|  squalene synthase                                       233   3e-71   Dioscorea zingiberensis
ref|XP_010437577.1|  PREDICTED: squalene synthase-like isoform X1       232   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010437578.1|  PREDICTED: squalene synthase-like isoform X2       232   6e-71   Camelina sativa [gold-of-pleasure]
emb|CDX69076.1|  BnaC01g03770D                                          232   1e-70   
emb|CDY17472.1|  BnaC03g65910D                                          231   2e-70   Brassica napus [oilseed rape]
gb|AAB61927.1|  squalene synthase 2                                     230   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195191.2|  squalene synthase 2                                   230   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690775.1|  PREDICTED: squalene synthase-like                  230   3e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009591242.1|  PREDICTED: squalene synthase-like                  226   3e-70   
gb|KFK30098.1|  hypothetical protein AALP_AA7G216700                    230   4e-70   Arabis alpina [alpine rockcress]
ref|XP_009396917.1|  PREDICTED: squalene synthase-like                  229   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX72494.1|  BnaC07g45160D                                          228   8e-70   
ref|XP_009110500.1|  PREDICTED: squalene synthase                       229   8e-70   Brassica rapa
ref|XP_010065915.1|  PREDICTED: squalene synthase-like                  229   1e-69   Eucalyptus grandis [rose gum]
emb|CDX75451.1|  BnaA01g02510D                                          228   2e-69   
ref|XP_006841632.1|  hypothetical protein AMTR_s00003p00232080          228   2e-69   Amborella trichopoda
emb|CDY45323.1|  BnaA03g52960D                                          221   3e-69   Brassica napus [oilseed rape]
ref|XP_002466259.1|  hypothetical protein SORBIDRAFT_01g004550          224   5e-68   Sorghum bicolor [broomcorn]
ref|XP_006651930.1|  PREDICTED: squalene synthase-like                  222   3e-67   Oryza brachyantha
ref|NP_001051625.1|  Os03g0805100                                       219   4e-66   
gb|EEE60131.1|  hypothetical protein OsJ_13016                          219   6e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130502.1|  uncharacterized protein LOC100191601               218   7e-66   
ref|NP_001104839.1|  squalene synthase1                                 218   9e-66   Zea mays [maize]
tpg|DAA52014.1|  TPA: hypothetical protein ZEAMMB73_299336              218   9e-66   
ref|XP_010025618.1|  PREDICTED: squalene synthase-like                  218   1e-65   Eucalyptus grandis [rose gum]
gb|ABI14439.1|  squalene synthase                                       217   2e-65   Taxus cuspidata [ichii]
gb|AFJ15526.1|  squalene synthase                                       216   5e-65   Azadirachta indica [Indian-lilac]
emb|CDX75450.1|  BnaA01g02520D                                          215   1e-64   
emb|CDX69075.1|  BnaC01g03780D                                          213   5e-64   
emb|CDX76294.1|  BnaA08g11060D                                          213   6e-64   
ref|XP_010312074.1|  PREDICTED: squalene synthase-like isoform X2       206   2e-61   
ref|XP_006351382.1|  PREDICTED: squalene synthase-like                  206   3e-61   
ref|XP_006351216.1|  PREDICTED: squalene synthase-like                  207   3e-61   Solanum tuberosum [potatoes]
ref|XP_004249733.1|  PREDICTED: squalene synthase-like isoform X1       206   5e-61   Solanum lycopersicum
gb|AHI96421.1|  squalene synthase                                       205   1e-60   Pinus massoniana [Chinese red pine]
dbj|BAJ87710.1|  predicted protein                                      204   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24732.1|  unknown                                                 204   4e-60   Picea sitchensis
emb|CDY45322.1|  BnaA03g52950D                                          201   5e-59   Brassica napus [oilseed rape]
ref|XP_003564211.1|  PREDICTED: squalene synthase-like                  201   6e-59   Brachypodium distachyon [annual false brome]
ref|NP_001059129.1|  Os07g0200700                                       194   2e-56   
gb|AEX58673.1|  squalene synthase                                       192   1e-55   Huperzia serrata [toothed club-moss]
ref|XP_001775898.1|  predicted protein                                  190   5e-55   
ref|XP_001773253.1|  predicted protein                                  184   2e-53   
ref|XP_007042048.1|  Squalene synthase 1 isoform 2                      182   4e-53   
gb|AIW04729.1|  squalene synthase                                       185   6e-53   Dryopteris fragrans
ref|XP_003559279.1|  PREDICTED: squalene synthase-like                  184   9e-53   Brachypodium distachyon [annual false brome]
ref|XP_009769885.1|  PREDICTED: squalene synthase-like                  177   4e-50   Nicotiana sylvestris
emb|CDM86349.1|  unnamed protein product                                176   4e-50   Triticum aestivum [Canadian hard winter wheat]
gb|EMT03383.1|  Squalene synthetase                                     177   2e-49   
ref|XP_003058046.1|  predicted protein                                  167   9e-46   Micromonas pusilla CCMP1545
ref|XP_005851990.1|  hypothetical protein CHLNCDRAFT_18492              160   9e-45   Chlorella variabilis
ref|XP_001756673.1|  predicted protein                                  162   4e-44   
ref|XP_005651444.1|  farnesyl-diphosphate farnesyltransferase           159   2e-43   Coccomyxa subellipsoidea C-169
ref|XP_001417488.1|  predicted protein                                  161   2e-43   Ostreococcus lucimarinus CCE9901
ref|XP_007512409.1|  squalene synthase                                  160   4e-43   Bathycoccus prasinos
ref|XP_008351286.1|  PREDICTED: squalene synthase-like                  150   5e-43   Malus domestica [apple tree]
ref|XP_011395550.1|  Squalene synthase                                  159   1e-42   Auxenochlorella protothecoides
ref|XP_002501456.1|  predicted protein                                  159   1e-42   Micromonas commoda
ref|XP_006423443.1|  hypothetical protein CICLE_v10028537mg             156   3e-42   
ref|XP_009619298.1|  PREDICTED: squalene synthase-like                  154   3e-41   
ref|XP_003078740.1|  FDFT_NICBE Farnesyl-diphosphate farnesyltran...    148   1e-40   
ref|XP_002946755.1|  hypothetical protein VOLCADRAFT_79344              153   2e-40   Volvox carteri f. nagariensis
ref|XP_001703447.1|  farnesyl-diphosphate farnesyltransferase           149   9e-40   Chlamydomonas reinhardtii
emb|CEF97547.1|  Squalene/phytoene synthase                             147   7e-39   Ostreococcus tauri
ref|XP_002971951.1|  hypothetical protein SELMODRAFT_96714              146   2e-38   
ref|XP_004986173.1|  PREDICTED: squalene synthase-like                  139   2e-38   
gb|KIZ04121.1|  farnesyl-diphosphatefarnesyltransferase                 145   2e-37   Monoraphidium neglectum
gb|ACF35716.1|  squalene synthase 1                                     135   2e-37   Glycyrrhiza uralensis [Chinese licorice]
gb|ACF35714.1|  squalene synthase 1                                     135   2e-37   Glycyrrhiza uralensis [Chinese licorice]
gb|KDD74507.1|  squalene/phytoene synthase                              140   1e-36   Helicosporidium sp. ATCC 50920
gb|EMT23370.1|  Squalene synthetase                                     141   1e-36   
ref|XP_011004277.1|  PREDICTED: squalene synthase-like                  135   3e-36   Populus euphratica
sp|G0Y287.1|BOSS_BOTBR  RecName: Full=Botryococcus squalene synth...    140   7e-36   Botryococcus braunii
sp|Q9SDW9.1|BSS_BOTBR  RecName: Full=Squalene synthase                  136   3e-34   Botryococcus braunii
gb|ADP89473.1|  squalene synthase                                       126   4e-33   Betula platyphylla [Asian white birch]
ref|XP_005837525.1|  farnesyl-diphosphate farnesyltransferase           132   9e-33   Guillardia theta CCMP2712
gb|ABW37701.1|  squalene synthase                                       125   1e-32   Panax notoginseng [san-qi]
gb|AEY76157.1|  squalene synthase                                       120   4e-31   Dioscorea zingiberensis
sp|G0Y288.1|BOCS_BOTBR  RecName: Full=Botryococcene synthase; Alt...    124   4e-30   Botryococcus braunii
gb|ELT92149.1|  hypothetical protein CAPTEDRAFT_164295                  123   9e-30   Capitella teleta
gb|AAI68496.1|  Unknown (protein for MGC:173117)                        123   9e-30   Xenopus tropicalis [western clawed frog]
ref|NP_001135642.2|  farnesyl-diphosphate farnesyltransferase 1         123   1e-29   
emb|CCC50058.1|  putative farnesyltransferase                           122   2e-29   Trypanosoma vivax Y486
gb|ESL10210.1|  farnesyltransferase                                     121   3e-29   Trypanosoma rangeli SC58
ref|XP_009560856.1|  PREDICTED: squalene synthase isoform X1            120   1e-28   Cuculus canorus
ref|XP_006681876.1|  hypothetical protein BATDEDRAFT_14137              119   1e-28   Batrachochytrium dendrobatidis JAM81
ref|XP_009560858.1|  PREDICTED: squalene synthase isoform X2            119   1e-28   Cuculus canorus
ref|XP_806809.1|  farnesyltransferase                                   119   2e-28   Trypanosoma cruzi strain CL Brener
gb|KCW84806.1|  hypothetical protein EUGRSUZ_B01607                     112   2e-28   Eucalyptus grandis [rose gum]
ref|XP_005146462.1|  PREDICTED: squalene synthase                       119   3e-28   Melopsittacus undulatus
ref|NP_001034383.1|  squalene synthase                                  119   3e-28   Gallus gallus [bantam]
emb|CAN64028.1|  hypothetical protein VITISV_030715                     117   3e-28   Vitis vinifera
gb|ABA01562.1|  squalene synthase                                       113   3e-28   Bupleurum falcatum
gb|KJE94382.1|  farnesyl-diphosphate farnesyltransferase 1              119   4e-28   Capsaspora owczarzaki ATCC 30864
ref|XP_007429056.1|  PREDICTED: squalene synthase isoform X4            117   7e-28   
ref|XP_004346713.1|  farnesyl-diphosphate farnesyltransferase 1         117   7e-28   Capsaspora owczarzaki ATCC 30864
gb|EKG06138.1|  squalene synthase, putative                             117   1e-27   
ref|XP_806417.1|  farnesyltransferase                                   117   1e-27   
ref|XP_005075330.1|  PREDICTED: squalene synthase                       117   1e-27   
ref|XP_007429053.1|  PREDICTED: squalene synthase isoform X1            117   1e-27   
ref|XP_003498025.1|  PREDICTED: squalene synthase isoform X2            116   2e-27   
ref|XP_003225597.2|  PREDICTED: squalene synthase                       116   2e-27   
ref|XP_002756812.1|  PREDICTED: squalene synthase isoform X1            116   2e-27   
ref|XP_008977274.1|  PREDICTED: squalene synthase isoform X2            115   3e-27   
dbj|BAE36836.1|  unnamed protein product                                116   3e-27   
ref|XP_009210757.1|  PREDICTED: squalene synthase isoform X3            115   3e-27   
ref|XP_008170096.1|  PREDICTED: squalene synthase                       116   3e-27   
ref|XP_005044492.1|  PREDICTED: squalene synthase                       115   3e-27   
ref|NP_034321.2|  squalene synthase                                     115   3e-27   
ref|XP_006716310.1|  PREDICTED: squalene synthase isoform X1            115   4e-27   
gb|KFO77427.1|  Squalene synthase                                       115   4e-27   
ref|XP_009046088.1|  hypothetical protein LOTGIDRAFT_56072              113   5e-27   
ref|NP_001247653.1|  squalene synthase                                  115   5e-27   
gb|AAF00038.1|  squalene synthase                                       115   5e-27   
ref|XP_005528843.1|  PREDICTED: squalene synthase                       115   5e-27   
ref|XP_010863270.1|  PREDICTED: squalene synthase                       115   6e-27   
ref|XP_010382892.1|  PREDICTED: squalene synthase isoform X2            115   6e-27   
ref|XP_006774849.1|  PREDICTED: squalene synthase isoform X2            115   6e-27   
ref|XP_004046700.1|  PREDICTED: squalene synthase isoform 1             115   6e-27   
ref|XP_004707702.1|  PREDICTED: squalene synthase isoform X2            115   6e-27   
ref|XP_005290732.1|  PREDICTED: squalene synthase-like                  115   6e-27   
emb|CAA48896.1|  farnesyl-diphosphate farnesyltransferase               115   7e-27   
ref|NP_004453.3|  squalene synthase isoform 1                           115   7e-27   
ref|XP_008629248.1|  PREDICTED: squalene synthase                       115   7e-27   
ref|XP_003271489.1|  PREDICTED: squalene synthase isoform 1             115   7e-27   
gb|AAB33404.1|  squalene synthase                                       115   7e-27   
gb|AAP36671.1|  Homo sapiens farnesyl-diphosphate farnesyltransfe...    115   7e-27   
gb|AAH09251.1|  Farnesyl-diphosphate farnesyltransferase 1              115   7e-27   
dbj|BAA06102.1|  squalene synthase                                      114   8e-27   
ref|XP_009438499.1|  PREDICTED: squalene synthase isoform X1            114   8e-27   
ref|XP_006864384.1|  PREDICTED: squalene synthase isoform X2            114   1e-26   
ref|XP_003386611.1|  PREDICTED: squalene synthase-like                  114   1e-26   
ref|XP_006658375.1|  PREDICTED: squalene synthase-like                  114   1e-26   
ref|XP_002709483.1|  PREDICTED: squalene synthase isoform X2            114   1e-26   
ref|NP_062111.1|  squalene synthase                                     114   1e-26   
ref|XP_003793967.1|  PREDICTED: squalene synthase isoform 1             114   1e-26   
ref|XP_002186800.1|  PREDICTED: squalene synthase                       114   1e-26   
gb|AFJ73943.1|  squalene synthase                                       110   2e-26   
ref|XP_003944232.1|  PREDICTED: squalene synthase isoform X2            114   2e-26   
ref|XP_007128199.1|  PREDICTED: squalene synthase isoform X2            114   2e-26   
ref|XP_005495474.1|  PREDICTED: squalene synthase                       114   2e-26   
ref|XP_010771634.1|  PREDICTED: squalene synthase isoform X2            114   2e-26   
ref|XP_004671442.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    114   2e-26   
ref|XP_007192741.1|  PREDICTED: squalene synthase isoform X1            114   2e-26   
ref|XP_002749744.1|  PREDICTED: squalene synthase-like isoform X1       113   2e-26   
gb|AAL91344.1|  squalene synthase                                       109   2e-26   
ref|XP_008997579.1|  PREDICTED: squalene synthase-like isoform X2       113   2e-26   
ref|XP_008826308.1|  PREDICTED: squalene synthase                       113   3e-26   
ref|XP_005683583.1|  PREDICTED: squalene synthase                       113   3e-26   
gb|ESA03184.1|  hypothetical protein GLOINDRAFT_619                     113   3e-26   
ref|XP_008574546.1|  PREDICTED: squalene synthase isoform X3            112   3e-26   
ref|XP_008574545.1|  PREDICTED: squalene synthase isoform X2            113   4e-26   
gb|EKF38258.1|  squalene synthase, putative                             112   4e-26   
gb|AFJ73947.1|  squalene synthase                                       110   4e-26   
ref|XP_004433568.1|  PREDICTED: squalene synthase isoform 2             112   4e-26   
ref|XP_007068988.1|  PREDICTED: squalene synthase-like                  112   4e-26   
ref|XP_005859689.1|  PREDICTED: squalene synthase                       112   4e-26   
ref|XP_008290524.1|  PREDICTED: squalene synthase-like                  111   5e-26   
ref|XP_008311147.1|  PREDICTED: squalene synthase isoform X2            112   5e-26   
ref|NP_001267081.1|  squalene synthase                                  112   5e-26   
ref|XP_008529254.1|  PREDICTED: squalene synthase isoform X2            112   5e-26   
ref|XP_010971494.1|  PREDICTED: squalene synthase                       112   5e-26   
ref|XP_010993460.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    112   6e-26   
ref|XP_005800260.1|  PREDICTED: squalene synthase-like                  112   6e-26   
ref|NP_001189454.1|  squalene synthase                                  112   6e-26   
gb|AFJ73953.1|  squalene synthase                                       109   6e-26   
ref|XP_006263357.1|  PREDICTED: squalene synthase-like                  112   9e-26   
ref|XP_010838568.1|  PREDICTED: squalene synthase                       112   9e-26   
ref|XP_006060304.1|  PREDICTED: squalene synthase                       112   1e-25   
ref|NP_001013022.1|  squalene synthase                                  112   1e-25   
gb|AFJ73959.1|  squalene synthase                                       108   1e-25   
gb|AFJ73955.1|  squalene synthase                                       108   1e-25   
gb|AFJ73951.1|  squalene synthase                                       108   1e-25   
sp|Q32KR6.1|FDFT_BOVIN  RecName: Full=Squalene synthase; Short=SQ...    111   1e-25   
ref|XP_004004500.1|  PREDICTED: squalene synthase                       111   1e-25   
ref|XP_004382266.1|  PREDICTED: squalene synthase isoform 2             111   1e-25   
gb|AFJ73957.1|  squalene synthase                                       108   1e-25   
ref|NP_001161120.1|  squalene synthase                                  111   1e-25   
gb|AEP82679.1|  farnesyltransferase                                     108   1e-25   
gb|AHG98484.1|  FDFT1                                                   109   1e-25   
gb|AFJ73941.1|  squalene synthase                                       108   1e-25   
ref|XP_006906366.1|  PREDICTED: squalene synthase isoform X2            111   2e-25   
ref|XP_002588446.1|  hypothetical protein BRAFLDRAFT_198828             107   2e-25   
ref|XP_004278741.1|  PREDICTED: squalene synthase                       111   2e-25   
ref|XP_005095010.1|  PREDICTED: squalene synthase-like isoform X1       110   2e-25   
gb|EMP27211.1|  Squalene synthase                                       112   2e-25   
ref|XP_006884952.1|  PREDICTED: squalene synthase isoform X2            110   2e-25   
ref|XP_004707701.1|  PREDICTED: squalene synthase isoform X1            111   2e-25   
gb|AFJ73937.1|  squalene synthase                                       108   2e-25   
ref|XP_004541881.1|  PREDICTED: squalene synthase-like isoform X2       110   2e-25   
ref|XP_007099547.1|  Squalene synthase 1-like protein                   107   3e-25   
gb|AFJ73935.1|  squalene synthase                                       107   3e-25   
ref|XP_007552931.1|  PREDICTED: squalene synthase isoform X2            110   3e-25   
gb|ELR63024.1|  Squalene synthase                                       110   3e-25   
ref|XP_003971766.1|  PREDICTED: squalene synthase-like                  110   3e-25   
pdb|3WCA|A  Chain A, The Complex Structure Of Tcsqs With Ligand, ...    110   3e-25   
pdb|3WCB|A  Chain A, The Complex Structure Of Tcsqs With Ligand, ...    110   3e-25   
ref|XP_007471181.1|  PREDICTED: squalene synthase isoform X2            110   3e-25   
gb|AFJ73961.1|  squalene synthase                                       107   3e-25   
gb|EDL20655.1|  mCG10034                                                110   3e-25   
gb|AFJ73945.1|  squalene synthase                                       107   3e-25   
gb|EAY92248.1|  hypothetical protein OsI_13969                          110   4e-25   
ref|XP_007936895.1|  PREDICTED: squalene synthase isoform X2            110   4e-25   
ref|XP_005914533.1|  PREDICTED: squalene synthase-like                  110   4e-25   
ref|XP_003757973.1|  PREDICTED: squalene synthase                       110   4e-25   
gb|AFJ73939.1|  squalene synthase                                       107   4e-25   
ref|XP_005734456.1|  PREDICTED: squalene synthase-like                  110   4e-25   
gb|KFW77295.1|  Squalene synthase                                       109   5e-25   
ref|XP_008396056.1|  PREDICTED: squalene synthase isoform X2            109   5e-25   
ref|XP_005535962.1|  squalene synthase                                  110   5e-25   
gb|KFO99755.1|  Squalene synthase                                       109   5e-25   
ref|XP_008120692.1|  PREDICTED: squalene synthase-like                  109   6e-25   
ref|XP_003449965.1|  PREDICTED: squalene synthase-like                  109   6e-25   
gb|AFJ73933.1|  squalene synthase                                       106   8e-25   
ref|XP_007238776.1|  PREDICTED: squalene synthase                       108   8e-25   
ref|XP_008116142.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    108   1e-24   
gb|KFW01543.1|  Squalene synthase                                       108   1e-24   
ref|XP_008148988.1|  PREDICTED: squalene synthase isoform X2            108   1e-24   
ref|XP_008116141.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    108   1e-24   
ref|XP_004766139.1|  PREDICTED: squalene synthase isoform X2            108   1e-24   
ref|XP_011243253.1|  PREDICTED: squalene synthase isoform X2            108   2e-24   
ref|XP_008311146.1|  PREDICTED: squalene synthase isoform X1            108   2e-24   
ref|XP_002923714.1|  PREDICTED: squalene synthase isoform X2            108   2e-24   
ref|XP_534557.2|  PREDICTED: squalene synthase isoformX1                108   2e-24   
ref|XP_004395309.1|  PREDICTED: squalene synthase isoform 2             108   2e-24   
ref|XP_007618604.1|  PREDICTED: squalene synthase isoform X1            108   2e-24   
ref|XP_006729443.1|  PREDICTED: squalene synthase isoform X2            108   2e-24   
ref|XP_006864383.1|  PREDICTED: squalene synthase isoform X1            108   2e-24   
gb|KFP31735.1|  Squalene synthase                                       107   2e-24   
ref|XP_004766138.1|  PREDICTED: squalene synthase isoform X1            108   2e-24   
ref|XP_008977276.1|  PREDICTED: squalene synthase isoform X4            108   3e-24   
emb|CCC92493.1|  unnamed protein product                                107   3e-24   
ref|XP_005562631.1|  PREDICTED: squalene synthase isoform X3            107   3e-24   
ref|XP_010771633.1|  PREDICTED: squalene synthase isoform X1            107   3e-24   
pdb|1EZF|A  Chain A, Crystal Structure Of Human Squalene Synthase       107   3e-24   
pdb|3WEJ|A  Chain A, Crystal Structure Of The Human Squalene Synt...    107   3e-24   
ref|XP_006642983.1|  PREDICTED: squalene synthase-like                  107   3e-24   
ref|XP_003479432.1|  PREDICTED: squalene synthase isoform X1            107   3e-24   
ref|XP_790906.1|  PREDICTED: squalene synthase                          107   4e-24   
pdb|3LEE|A  Chain A, Crystal Structure Of The Human Squalene Synt...    107   4e-24   
ref|XP_007517287.1|  PREDICTED: squalene synthase isoform X1            107   4e-24   
pdb|3WEK|A  Chain A, Crystal Structure Of The Human Squalene Synt...    107   4e-24   
gb|EFA80770.1|  farnesyl-diphosphate farnesyltransferase                107   4e-24   
ref|XP_005513697.1|  PREDICTED: squalene synthase                       107   4e-24   
pdb|3VJ8|A  Chain A, Crystal Structure Of The Human Squalene Synt...    107   4e-24   
ref|XP_002114185.1|  hypothetical protein TRIADDRAFT_27912              107   4e-24   
pdb|3WC9|A  Chain A, The Complex Structure Of Hssqs Wtih Ligand, ...    107   4e-24   
ref|XP_005425026.1|  PREDICTED: squalene synthase                       108   4e-24   
ref|XP_007959826.1|  PREDICTED: squalene synthase isoform X1            107   5e-24   
ref|XP_005562629.1|  PREDICTED: squalene synthase isoform X1            107   5e-24   
emb|CBH13794.1|  farnesyltransferase, putative                          107   5e-24   
ref|XP_004848518.1|  PREDICTED: squalene synthase isoform X2            107   5e-24   
emb|CCD12912.1|  unnamed protein product                                107   5e-24   
ref|XP_010382891.1|  PREDICTED: squalene synthase isoform X1            107   5e-24   
ref|XP_008768968.1|  PREDICTED: squalene synthase isoform X1            107   5e-24   
ref|XP_847542.1|  farnesyltransferase                                   107   5e-24   
ref|XP_004382265.1|  PREDICTED: squalene synthase isoform 1             107   5e-24   
emb|CCD17497.1|  unnamed protein product                                107   6e-24   
ref|XP_004088003.1|  PREDICTED: squalene synthase                       106   6e-24   
dbj|BAG60195.1|  unnamed protein product                                107   7e-24   
ref|NP_001274679.1|  squalene synthase isoform 3                        107   7e-24   
ref|XP_009438497.1|  PREDICTED: squalene synthase isoform X2            107   7e-24   
ref|XP_009241805.1|  PREDICTED: squalene synthase isoform X1            107   7e-24   
ref|XP_001467618.1|  putative farnesyltransferase                       106   7e-24   
gb|KFV73970.1|  Squalene synthase                                       106   7e-24   
ref|XP_003863390.1|  farnesyltransferase, putative                      106   7e-24   
gb|KFH73802.1|  farnesyl-diphosphate farnesyltransferase                106   7e-24   
ref|XP_009906049.1|  PREDICTED: squalene synthase isoform X1            106   9e-24   
ref|XP_006774848.1|  PREDICTED: squalene synthase isoform X1            106   9e-24   
ref|XP_006906365.1|  PREDICTED: squalene synthase isoform X1            106   9e-24   
ref|XP_003283681.1|  farnesyl-diphosphate farnesyltransferase           106   9e-24   
ref|XP_007936894.1|  PREDICTED: squalene synthase isoform X1            106   1e-23   
ref|XP_003225609.1|  PREDICTED: squalene synthase-like                  105   1e-23   
ref|XP_001372440.1|  PREDICTED: squalene synthase isoform X1            105   2e-23   
ref|XP_006884951.1|  PREDICTED: squalene synthase isoform X1            105   2e-23   
ref|XP_010330373.1|  PREDICTED: squalene synthase isoform X1            105   2e-23   
ref|XP_003868895.1|  GTP-binding protein                                104   2e-23   
ref|XP_004541880.1|  PREDICTED: squalene synthase-like isoform X1       105   2e-23   
ref|XP_010743678.1|  PREDICTED: squalene synthase-like                  104   2e-23   
ref|XP_001915483.1|  PREDICTED: squalene synthase                       105   2e-23   
ref|XP_007552930.1|  PREDICTED: squalene synthase isoform X1            105   2e-23   
ref|XP_006993063.1|  PREDICTED: squalene synthase                       105   2e-23   
ref|XP_006864385.1|  PREDICTED: squalene synthase isoform X3            104   3e-23   
ref|XP_004083804.1|  PREDICTED: squalene synthase                       105   3e-23   
ref|XP_002735807.1|  PREDICTED: squalene synthase-like                  103   3e-23   
ref|XP_004198715.1|  Piso0_002102                                       105   3e-23   
ref|XP_002619326.1|  hypothetical protein CLUG_00485                    105   3e-23   
ref|XP_007882609.1|  PREDICTED: squalene synthase                       104   3e-23   
ref|XP_008247080.1|  PREDICTED: squalene synthase isoform X1            105   3e-23   
ref|XP_008396055.1|  PREDICTED: squalene synthase isoform X1            104   4e-23   
pdb|3WEI|A  Chain A, Crystal Structure Of The Human Squalene Synt...    103   5e-23   
dbj|BAO39180.1|  squalene synthetase                                    104   5e-23   
ref|XP_004579357.1|  PREDICTED: squalene synthase                       103   6e-23   
gb|ERE90221.1|  squalene synthase                                       104   6e-23   
ref|XP_008574544.1|  PREDICTED: squalene synthase isoform X1            104   7e-23   
ref|XP_008529253.1|  PREDICTED: squalene synthase isoform X1            104   7e-23   
ref|XP_004614762.1|  PREDICTED: squalene synthase                       103   7e-23   
ref|XP_009025212.1|  hypothetical protein HELRODRAFT_68312              103   7e-23   
ref|XP_004433567.1|  PREDICTED: squalene synthase isoform 1             104   8e-23   
ref|XP_629811.1|  farnesyl-diphosphate farnesyltransferase              103   8e-23   
ref|WP_040444080.1|  hypothetical protein                               103   9e-23   
ref|XP_007128198.1|  PREDICTED: squalene synthase isoform X1            103   9e-23   
ref|XP_004328595.1|  PREDICTED: squalene synthase                       103   9e-23   
ref|XP_004046701.1|  PREDICTED: squalene synthase isoform 2             102   1e-22   
dbj|BAG58807.1|  unnamed protein product                                102   1e-22   
ref|XP_003271490.1|  PREDICTED: squalene synthase isoform 2             102   1e-22   
ref|XP_010805999.1|  PREDICTED: squalene synthase isoform X1            103   1e-22   
emb|CAG09159.1|  unnamed protein product                                103   1e-22   
ref|XP_005635705.1|  PREDICTED: squalene synthase isoform X2            102   1e-22   
ref|XP_003984893.2|  PREDICTED: squalene synthase                       102   1e-22   
ref|XP_001685284.1|  putative squalene synthase                         102   1e-22   
gb|AAC17923.1|  squalene synthase                                       102   2e-22   
ref|XP_007374454.1|  hypothetical protein SPAPADRAFT_60279              102   2e-22   
ref|XP_006039244.1|  PREDICTED: squalene synthase-like                  103   2e-22   
ref|XP_004707703.1|  PREDICTED: squalene synthase isoform X3            102   2e-22   
ref|XP_011228676.1|  PREDICTED: squalene synthase isoform X1            102   2e-22   
emb|CDR47668.1|  CYFA0S36e00188g1_1                                     102   2e-22   



>ref|XP_009594336.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=411

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGAML++P+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML+KVSRSF+LVIQQLP+
Sbjct  1    MGSLGAMLRNPEDIYPLMKLKLAARYAEKQIPPQPHWAFCYIMLRKVSRSFSLVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTS+ATEVK PIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSVATEVKAPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+Y+EAIEDITMR
Sbjct  121  QFHHVSTAFLELGKHYKEAIEDITMR  146



>gb|AAD20626.1| squalene synthase [Capsicum annuum]
Length=411

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHIYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELGKNYQQAIEDITMR  146



>ref|NP_001236365.1| squalene synthase [Glycine max]
 dbj|BAA22559.1| squalene synthase [Glycine max]
Length=413

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL I
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGI  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>ref|XP_009759256.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=411

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGAML++P+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML KVSRSF+LVIQQLP+
Sbjct  1    MGSLGAMLRNPEDIYPLMKLKLAARYAEKQIPPQPHWAFCYIMLHKVSRSFSLVIQQLPL  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL K+Y+EAIEDITMR
Sbjct  121  QFHHVSTAFLELEKHYKEAIEDITMR  146



>ref|XP_006591920.1| PREDICTED: squalene synthase isoform X2 [Glycine max]
Length=413

 Score =   273 bits (697),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>gb|AEX26930.1| squalene synthase 1-2 [Solanum tuberosum]
Length=411

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMR  146



>dbj|BAA82093.1| squalene synthase [Solanum tuberosum]
Length=411

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMR  146



>ref|XP_006362006.1| PREDICTED: squalene synthase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362007.1| PREDICTED: squalene synthase-like isoform X2 [Solanum tuberosum]
 ref|XP_006362008.1| PREDICTED: squalene synthase-like isoform X3 [Solanum tuberosum]
Length=411

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMR  146



>gb|ADG36719.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36721.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>gb|ACT52825.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36714.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>gb|ACS66749.1| squalene synthase [Glycyrrhiza uralensis]
 gb|ADG36715.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36716.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36720.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36722.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36723.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36724.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>gb|AGS57530.1| squalene synthase [Solanum nigrum]
Length=411

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMR  146



>gb|ADG36717.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36718.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>emb|CAJ77655.1| squalene synthase 2 [Glycyrrhiza eurycarpa]
Length=412

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>ref|XP_006591919.1| PREDICTED: squalene synthase isoform X1 [Glycine max]
Length=451

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>ref|NP_001234716.1| squalene synthase [Solanum lycopersicum]
 gb|ACY25092.1| squalene synthase [Solanum lycopersicum]
Length=411

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMR  146



>emb|CAJ77653.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>ref|XP_009631700.1| PREDICTED: squalene synthase [Nicotiana tomentosiformis]
Length=411

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+Y+VLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYRVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELGKHYQQAIEDITMR  146



>ref|XP_003537842.1| PREDICTED: squalene synthase-like isoform X1 [Glycine max]
 ref|XP_006590871.1| PREDICTED: squalene synthase-like isoform X2 [Glycine max]
 gb|KHN39832.1| Squalene synthase [Glycine soja]
Length=413

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>gb|AAB02945.1| squalene synthase [Nicotiana tabacum]
Length=376

 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL K+YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMR  146



>ref|XP_008236983.1| PREDICTED: squalene synthase-like [Prunus mume]
Length=412

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+LG ++KHPDD+YPL+KLK+AA+ +EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGTLGTLMKHPDDIYPLLKLKMAAKNLEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKR  146



>gb|AGB05603.1| squalene synthase [Camellia oleifera]
Length=414

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR+ EK IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLMKLKMAARRAEKNIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILMAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAF ELG+ YQEAIEDITMR
Sbjct  121  EFHHVSTAFSELGRGYQEAIEDITMR  146



>gb|AEX26929.1| squalene synthase 1-1 [Solanum tuberosum]
Length=411

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSR FALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRGFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELGKLYQQAIEDITMR  146



>ref|XP_006360639.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=411

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L A+LKHP+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML KVSRSF+LVI+QLP+
Sbjct  1    MGILRAILKHPEDIYPLLKLKVAARYAEKQIPPQPHWAFCYIMLHKVSRSFSLVIKQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDA+CIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+Y+EAIEDITMR
Sbjct  121  QFHHVSTAFLELGKHYKEAIEDITMR  146



>gb|KDP41726.1| hypothetical protein JCGZ_26744 [Jatropha curcas]
Length=413

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD++WHF CG KDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDQDWHFSCGAKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+YQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKSYQEAIEDITKR  146



>gb|AFR77735.1| squalene synthase, partial [Camellia oleifera]
Length=413

 Score =   270 bits (691),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR+ EK IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLMKLKMAARRAEKNIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILMAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAF ELG+ YQEAIEDITMR
Sbjct  121  EFHHVSTAFSELGRGYQEAIEDITMR  146



>gb|AAM27472.1| squalene synthase [Nicotiana tabacum]
Length=290

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL K+YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMR  146



>gb|ACN69082.1| squalene synthase [Diospyros kaki]
Length=415

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL AML+HPDDVYPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLAAMLRHPDDVYPLVKLKMAARHAEKQIPPEPHWAFCYTMLHKVSRSFGLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FH HIYDR+WHF CGT++YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILLAFHHHIYDRDWHFSCGTREYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELGK YQEAIEDITMR
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITMR  146



>gb|AEX26932.1| squalene synthase [Solanum chacoense]
Length=411

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLE GK YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLEHGKLYQQAIEDITMR  146



>gb|AAB08578.1| squalene synthase [Nicotiana tabacum]
Length=411

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL K+YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMR  146



>gb|ADW27427.1| squalene synthase [Astragalus membranaceus]
Length=413

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSF LV QQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFGLVFQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLR LDTVEDDTSIATEVKVPILI FHRHIYD +WHFLCGTK+YKVLM+
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIATEVKVPILIAFHRHIYDHDWHFLCGTKEYKVLME  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSAAFLELGKNYQEAIEDITKR  146



>gb|ADV57358.1| squalene synthase [Astragalus membranaceus]
Length=405

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSF LV QQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFGLVFQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLR LDTVEDDTSIATEVKVPILI FHRHIYD +WHFLCGTK+YKVLM+
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIATEVKVPILIAFHRHIYDHDWHFLCGTKEYKVLME  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSAAFLELGKNYQEAIEDITKR  146



>dbj|BAA13084.1| squalene synthase [Glycyrrhiza glabra]
Length=412

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDCDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>dbj|BAH23428.1| squalene synthetase [Euphorbia tirucalli]
 dbj|BAH23429.1| squalene synthetase [Euphorbia tirucalli]
Length=411

 Score =   268 bits (684),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDD YPL+KLK+A++  EKQIP QPHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMASKHAEKQIPAQPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHIYDREWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+YQEAIE+IT R
Sbjct  121  QFHHVSTAFLELGKSYQEAIENITKR  146



>gb|ACU21003.1| unknown [Glycine max]
Length=413

 Score =   268 bits (684),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW F YTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFRYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKNYQEAIEDITKR  146



>ref|XP_002512982.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
 gb|EEF49485.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
Length=412

 Score =   268 bits (684),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+GA+L+HPDD YPL+KLK+AAR  EKQIPP+P WGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSVGAILRHPDDFYPLLKLKMAARNAEKQIPPEPRWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFH+HIY+ EWHF CGTKDYKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIDFHKHIYNPEWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+YQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKSYQEAIEDITKR  146



>gb|AHA84150.1| squalene synthase [Phaseolus vulgaris]
Length=413

 Score =   268 bits (684),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L ++LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGTLRSILKHPDDFYPLLKLKIAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            Q HHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QIHHVSTAFLELGKNYQEAIEDITKR  146



>ref|XP_009802568.1| PREDICTED: squalene synthase [Nicotiana sylvestris]
Length=411

 Score =   267 bits (683),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL K+YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMR  146



>ref|XP_004248691.1| PREDICTED: squalene synthase-like [Solanum lycopersicum]
Length=411

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L A+LKHP+D+YPL+KLK+AA+  EKQIP QPHW FCY ML KVSRSF+LVIQQLP+
Sbjct  1    MGILRAILKHPEDIYPLLKLKVAAQYAEKQIPSQPHWAFCYIMLHKVSRSFSLVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDA+CIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYKVLMD
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK Y+EAIEDITMR
Sbjct  121  QFHHVSTAFLELGKQYKEAIEDITMR  146



>ref|XP_009376518.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=412

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  MLKHPDD+YPL+KLKIA+RQIEKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+A+C+FYLVLRALDTVEDDTS+AT+VKVPIL+ FHRHIYD  WHF CGTK+YKVLMD
Sbjct  61   ELRNAICLFYLVLRALDTVEDDTSVATDVKVPILLAFHRHIYDPNWHFACGTKNYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKR  146



>emb|CDP20866.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M +LGA+LKHPDD+YPLIKLK+A  Q EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MRTLGAILKHPDDLYPLIKLKVAVMQAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDA+C+FYLVLRALDTVEDDT+IATEVKVPIL+ FHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAICVFYLVLRALDTVEDDTNIATEVKVPILMAFHRHIYDREWHFACGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELG +YQ+ IEDITMR
Sbjct  121  QFHHVSTAFLELGSSYQKVIEDITMR  146



>gb|AFI33135.3| squalene synthase [Eriobotrya japonica]
 gb|AGU36305.1| squalene synthase [Eriobotrya japonica]
Length=412

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  MLKHPDD+YPL+KLKIA+RQI+KQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIKKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSIAT+VKVPIL+ FHRHIYD EWHF CGT +YKVLMD
Sbjct  61   ELRNAVCLFYLVLRALDTVEDDTSIATDVKVPILLAFHRHIYDPEWHFACGTNNYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKR  146



>gb|ADC95435.1| squalene synthase [Withania somnifera]
Length=411

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG++ A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHW FCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTVRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWAFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI  +VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPADVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+YQ+AIEDIT+R
Sbjct  121  QFHHVSTAFLELGKHYQQAIEDITLR  146



>ref|XP_010066209.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 ref|XP_010066210.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 gb|KCW64053.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64054.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64055.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64056.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
Length=413

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EK+IPPQPHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARNAEKRIPPQPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+YQEAI+DIT R
Sbjct  121  QFHHVSTAFLELGKSYQEAIDDITKR  146



>gb|KDO43896.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=294

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKR  146



>ref|XP_011088477.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011088478.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   266 bits (679),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YP++KLK+A R  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPMVKLKLAVRSAEKQIPAEPHWAFCYSMLHKVSRSFGLVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSIATEVKVPIL+DFHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIATEVKVPILMDFHRHIYDREWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELG+ YQEAIEDITM+
Sbjct  121  EFHHVSTAFLELGRGYQEAIEDITMK  146



>gb|KDO43895.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=340

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKR  146



>ref|XP_006487314.1| PREDICTED: squalene synthase isoform X1 [Citrus sinensis]
 gb|KDO43888.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43889.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=413

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKR  146



>gb|KDO43893.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43894.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=386

 Score =   265 bits (676),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKR  146



>gb|KDO43892.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=384

 Score =   264 bits (675),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKR  146



>ref|XP_011047507.1| PREDICTED: squalene synthase isoform X2 [Populus euphratica]
Length=346

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIP +PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPSEPHWAFCYSMLHRVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYL+LRALDTVEDDTSI TEVKVPILI FHRHIYDR WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLILRALDTVEDDTSIPTEVKVPILIAFHRHIYDRNWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFH VSTAFLELGK YQEAIEDIT R
Sbjct  121  QFHVVSTAFLELGKGYQEAIEDITKR  146



>sp|P53800.1|FDFT_NICBE RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Nicotiana benthamiana]
 gb|AAA87048.1| squalene synthetase [Nicotiana benthamiana]
Length=411

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP P+WGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPNWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL K+YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELRKHYQQAIEDITMR  146



>ref|XP_004290304.1| PREDICTED: squalene synthase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   265 bits (677),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GAMLKHPDD+YPL+KLK+AAR +EKQIPPQPHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAMLKHPDDIYPLLKLKMAARNLEKQIPPQPHWAFCYTMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDT++ T+VK+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTAVETDVKLPILIAFHRHIYDPKWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHV+TAFLELGK YQEAIEDIT R
Sbjct  121  EFHHVATAFLELGKGYQEAIEDITKR  146



>ref|XP_011458278.1| PREDICTED: squalene synthase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   265 bits (677),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GAMLKHPDD+YPL+KLK+AAR +EKQIPPQPHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAMLKHPDDIYPLLKLKMAARNLEKQIPPQPHWAFCYTMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDT++ T+VK+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTAVETDVKLPILIAFHRHIYDPKWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHV+TAFLELGK YQEAIEDIT R
Sbjct  121  EFHHVATAFLELGKGYQEAIEDITKR  146



>ref|XP_004150142.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 ref|XP_004167323.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 gb|KGN61845.1| hypothetical protein Csa_2G251460 [Cucumis sativus]
Length=417

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLKP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKR  146



>ref|XP_007199882.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
 gb|EMJ01081.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
Length=412

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+LG ++KHPDD+YPL+KLK+AA+ +EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGTLGTLMKHPDDIYPLLKLKMAAKNLEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSIA +VKVPIL+ FHRHIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIAADVKVPILLAFHRHIYDPDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKR  146



>emb|CAD23250.1| farnesyl-diphosphate farnesyltransferase [Medicago truncatula]
 gb|AES89237.2| squalene synthase [Medicago truncatula]
Length=413

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDWHFGCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLELGKNYQ+AIEDIT R
Sbjct  121  QFHHVSKAFLELGKNYQDAIEDITKR  146



>ref|XP_007131767.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 ref|XP_007131768.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03761.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03762.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
Length=413

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L ++LKHPDD YPL+KLKIAAR  EKQIPP+ HW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGTLRSILKHPDDFYPLLKLKIAARNAEKQIPPELHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            Q HHVSTAFLELGKNYQEAIEDIT R
Sbjct  121  QIHHVSTAFLELGKNYQEAIEDITKR  146



>gb|ADX01171.1| putative squalene synthase [Bacopa monnieri]
Length=414

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LKHPDD+YP++KLK+A R  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLRAILKHPDDLYPMVKLKLAVRNAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAV IFYLVLRALDTVEDDTSI+ EVKVPIL  FHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAVRIFYLVLRALDTVEDDTSISAEVKVPILKAFHRHIYDREWHFACGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELG  YQEAIEDITMR
Sbjct  121  EFHHVSTAFLELGSGYQEAIEDITMR  146



>gb|AGS78117.1| squalene synthase 1 [Malus domestica]
Length=412

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  MLKHPDD+YPL+KLKIA+RQIEKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTS+AT+VKVPIL+ FHRHIYD +WHF CGT +YKVLMD
Sbjct  61   ELRNAVCLFYLVLRALDTVEDDTSVATDVKVPILLAFHRHIYDPDWHFACGTNNYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELG  YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELGTGYQEAIEDITKR  146



>ref|XP_011047498.1| PREDICTED: squalene synthase isoform X1 [Populus euphratica]
Length=413

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIP +PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPSEPHWAFCYSMLHRVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYL+LRALDTVEDDTSI TEVKVPILI FHRHIYDR WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLILRALDTVEDDTSIPTEVKVPILIAFHRHIYDRNWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFH VS AFLELGK YQEAIEDIT R
Sbjct  121  QFHDVSAAFLELGKGYQEAIEDITKR  146



>gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41714.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41716.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILIAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELG  Y++AIEDITMR
Sbjct  121  EFHHVSNAFLELGSGYKDAIEDITMR  146



>gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41715.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41717.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILIAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELG  Y++AIEDITMR
Sbjct  121  EFHHVSNAFLELGSGYKDAIEDITMR  146



>ref|XP_003607040.1| Squalene synthase [Medicago truncatula]
Length=423

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDWHFGCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLELGKNYQ+AIEDIT R
Sbjct  121  QFHHVSKAFLELGKNYQDAIEDITKR  146



>gb|AEM42980.1| squalene synthase [Siraitia grosvenorii]
Length=417

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLAP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+A+CIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYKVLMD
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKR  146



>gb|AED99863.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELG  YQEAIEDITMR
Sbjct  121  EFHHVSNAFLELGSGYQEAIEDITMR  146



>gb|ABA29019.1| squalene synthase [Panax notoginseng]
 gb|AGS79226.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELG  YQEAIEDITMR
Sbjct  121  EFHHVSNAFLELGNGYQEAIEDITMR  146



>gb|AGI19256.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELG  YQEAIEDITMR
Sbjct  121  EFHHVSNAFLELGNGYQEAIEDITMR  146



>ref|XP_006423442.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36682.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=413

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPSEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQ+AIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQDAIEDITKR  146



>ref|XP_009378420.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=410

 Score =   262 bits (670),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  M+KHPDD+YPL+KLKIA+R +EKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMIKHPDDIYPLLKLKIASRHVEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTS+AT+VKVPIL+ FH HIYD EWHF CGT +YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSVATDVKVPILLAFHEHIYDPEWHFACGTNNYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKR  146



>gb|AER23670.1| squalene synthase [Eleutherococcus senticosus]
Length=414

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLDA  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELG  +QEAIEDITMR
Sbjct  121  EFHHVSNAFLELGSGFQEAIEDITMR  146



>ref|XP_010109768.1| hypothetical protein L484_008444 [Morus notabilis]
 gb|EXC24673.1| hypothetical protein L484_008444 [Morus notabilis]
Length=411

 Score =   262 bits (670),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDDVYPLIKLK+AAR  EK+IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALLRHPDDVYPLIKLKMAARNAEKRIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDT+EDDTSI T+VKVPIL +F+RH+Y+ +WHF CGTKDYKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTIEDDTSIPTDVKVPILKEFYRHMYNPKWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  QFHHVSTAFLELGKGYQEAIEDITKR  146



>ref|XP_002266150.1| PREDICTED: squalene synthase [Vitis vinifera]
 ref|XP_010647676.1| PREDICTED: squalene synthase [Vitis vinifera]
 emb|CBI38008.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L HPDD+YPL+KLK+A R  EKQIPP+PHW FCYT+L KVSRSF LVIQQL  
Sbjct  1    MGSLGAILTHPDDIYPLLKLKMAVRHAEKQIPPEPHWAFCYTLLHKVSRSFGLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+A+CIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIRTDVKVPILIAFHRHIYDRDWHFACGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL + YQEAIEDIT R
Sbjct  121  QFHHVSTAFLELERGYQEAIEDITKR  146



>gb|EYU37849.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=346

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L++P+D+YPL+KLK+A+R  EKQIP +PHWGFCY+MLQKVSRSFA VIQQL  
Sbjct  1    MGSLRAILRNPEDLYPLLKLKLASRNAEKQIPSEPHWGFCYSMLQKVSRSFAFVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI TE+KVPIL+ FH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIKTEIKVPILMAFHQHIYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELG+ YQEAIEDITMR
Sbjct  121  EFHHVSTAFLELGRGYQEAIEDITMR  146



>ref|NP_001280921.1| squalene synthase-like [Malus domestica]
 ref|XP_008382334.1| PREDICTED: squalene synthase-like [Malus domestica]
 gb|AGS78118.1| squalene synthase 2 [Malus domestica]
Length=410

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  M+KHPDD+YPL+KLKIA+R +EKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMIKHPDDIYPLLKLKIASRHVEKQIPSEPHWAFCYTMLQKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSIAT+VKVPIL+ FH+HIYD EWHF CGT +YKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATDVKVPILLAFHQHIYDPEWHFACGTNNYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELG  YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELGNGYQEAIEDITKR  146



>emb|CAN81937.1| hypothetical protein VITISV_028001 [Vitis vinifera]
Length=431

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L HPDD+YPL+KLK+A R  EKQIPP+PHW FCYT+L KVSRSF LVIQQL  
Sbjct  1    MGSLGAILTHPDDIYPLLKLKMAVRHAEKQIPPEPHWAFCYTLLHKVSRSFGLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+A+CIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIRTDVKVPILIAFHRHIYDRDWHFACGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL + YQEAIEDIT R
Sbjct  121  QFHHVSTAFLELERGYQEAIEDITKR  146



>gb|AFK29283.1| putative squalene synthase 1 [Salvia miltiorrhiza]
 gb|AFV13322.1| putative squalene synthase 1 [Salvia miltiorrhiza]
Length=413

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK AAR  EKQIPP+PHWGFCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPLLKLKYAARNAEKQIPPEPHWGFCYTMLHKVSRSFGLVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDA+CIFYLVLRALDTVEDDTSIATE+KVPIL+ FHRHI+DREWHF CGTK+Y+VLMD
Sbjct  61   DLRDAICIFYLVLRALDTVEDDTSIATELKVPILMAFHRHIFDREWHFSCGTKEYRVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL   YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELAPGYQDAIEDITMR  146



>gb|ACR57219.1| squalene synthase [Salvia miltiorrhiza]
Length=413

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK AAR  EKQIPP+PHWGFCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPLLKLKYAARNAEKQIPPEPHWGFCYTMLHKVSRSFGLVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDA+CIFYLVLRALDTVEDDTSIATE+KVPIL+ FHRHI+DREWHF CGTK+Y+VLMD
Sbjct  61   DLRDAICIFYLVLRALDTVEDDTSIATELKVPILMAFHRHIFDREWHFSCGTKEYRVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL   YQ+AIEDITMR
Sbjct  121  QFHHVSTAFLELAPGYQDAIEDITMR  146



>dbj|BAC56854.1| squalene synthase [Lotus japonicus]
Length=413

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD+YPL+KLK+AAR  EKQIP +PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVKHPDDLYPLLKLKMAARHAEKQIPSEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL  FHRHIYDR+WHF CGTK+YKVLM 
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATEVKVPILKAFHRHIYDRDWHFSCGTKEYKVLMG  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFH VSTAFLEL KNYQEAIEDIT R
Sbjct  121  QFHLVSTAFLELAKNYQEAIEDITDR  146



>dbj|BAA24289.1| squalene synthase [Panax ginseng]
 dbj|BAD08242.1| squalene synthase [Panax ginseng]
Length=415

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHP+D YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPEDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELG  YQEAIEDITMR
Sbjct  121  EFHHVSNAFLELGSGYQEAIEDITMR  146



>gb|ACX42426.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELGK YQEAIEDITMR
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMR  146



>gb|ACX42425.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELGK YQEAIEDITMR
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMR  146



>gb|ACA66014.1| squalene synthase [Panax ginseng]
Length=415

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHP+D YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPEDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELG  YQEAIEDITMR
Sbjct  121  EFHHVSNAFLELGSGYQEAIEDITMR  146



>gb|ADC32654.1| squalene synthase [Aralia elata]
Length=414

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIY+++WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYEKDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHH+S AFLELG  YQEAIEDITMR
Sbjct  121  EFHHLSNAFLELGSGYQEAIEDITMR  146



>gb|ACX42423.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNSSWHFSCGTKEYKILMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELGK YQEAIEDITMR
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMR  146



>ref|XP_008461009.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461010.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461011.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461012.1| PREDICTED: squalene synthase-like [Cucumis melo]
Length=417

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+ HWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARHAEKQIPPESHWGFCYTMLHKVSRSFALVIQQLKP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITKR  146



>emb|CAJ77652.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKR  146



>gb|EYU37850.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=414

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L++P+D+YPL+KLK+A+R  EKQIP +PHWGFCY+MLQKVSRSFA VIQQL  
Sbjct  1    MGSLRAILRNPEDLYPLLKLKLASRNAEKQIPSEPHWGFCYSMLQKVSRSFAFVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI TE+KVPIL+ FH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIKTEIKVPILMAFHQHIYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELG+ YQEAIEDITMR
Sbjct  121  EFHHVSTAFLELGRGYQEAIEDITMR  146



>gb|AAV58897.1| squalene synthase [Centella asiatica]
Length=415

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL  FHRHIYD  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILKAFHRHIYDNNWHFSCGTKEYKILMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELG  Y+EAIEDITMR
Sbjct  121  EFHHVSNAFLELGSGYKEAIEDITMR  146



>gb|AFZ93644.1| squalene synthetase [Euphorbia lathyris]
Length=410

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AA+  EKQIP QPHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAAKHAEKQIPAQPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYD EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHIYDPEWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            Q HH+STAFLELGK+YQEAIEDIT +
Sbjct  121  QIHHLSTAFLELGKSYQEAIEDITKK  146



>ref|XP_004507500.1| PREDICTED: squalene synthase-like [Cicer arietinum]
Length=413

 Score =   260 bits (664),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SLGA+LK+PDD +PL+KLK+AAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MASLGAILKNPDDFFPLLKLKMAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIDTDVKVPILKAFHRHIYDHDWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+YQ+AIEDIT R
Sbjct  121  QFHHVSTAFLELGKDYQDAIEDITKR  146



>gb|ACS66750.1| squalene synthase [Glycyrrhiza uralensis]
Length=413

 Score =   260 bits (664),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKR  146



>gb|ADG36702.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36710.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36712.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36713.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   260 bits (664),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKR  146



>gb|ADG36705.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   260 bits (664),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKR  146



>gb|ACX42424.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAFLKHPDDLYPLLKLKYAVKLAEKQIPPQPHWAFCYSMLHKVSRSFCLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELGK YQEAIEDITMR
Sbjct  121  EFHHVSNAFLELGKGYQEAIEDITMR  146



>gb|AAY46017.1| squalene synthase [Bupleurum falcatum]
Length=415

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAFLKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK+LMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYKILMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
             FHHVS AFLELGK YQEAIEDITMR
Sbjct  121  GFHHVSNAFLELGKGYQEAIEDITMR  146



>emb|CAJ58418.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFL+LG  Y+EAIEDITMR
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMR  146



>gb|ACV88718.1| squalene synthase [Panax ginseng]
Length=415

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFL+LG  Y+EAIEDITMR
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMR  146



>gb|AIK21786.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFL+LG  Y+EAIEDITMR
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMR  146



>gb|KHG01756.1| Squalene synthase [Gossypium arboreum]
Length=413

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+ HIYDR+WHF CGTK++KVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYHHIYDRDWHFSCGTKEFKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIEDIT+R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITLR  146



>gb|AEX26931.1| squalene synthase 1-3 [Solanum tuberosum]
Length=136

 Score =   249 bits (637),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKTPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNY  519
            QFHHVSTAFLELGK Y
Sbjct  121  QFHHVSTAFLELGKLY  136



>gb|AFK36923.1| unknown [Medicago truncatula]
Length=413

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD + HF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDRHFGCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLELGKNYQ+AIED+T R
Sbjct  121  QFHHVSKAFLELGKNYQDAIEDLTKR  146



>gb|ADD54645.1| squalene synthase [Bruguiera gymnorhiza]
Length=416

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ KHPDD+YPL+KLK+A +  EKQIPPQPHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIFKHPDDLYPLLKLKMAMKHAEKQIPPQPHWGFCYTMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVC+FYLVLRALDTVEDDTSIAT+VKVPILI FH H+YDR+WHF CGTKDYKVLMD
Sbjct  61   QLRDAVCVFYLVLRALDTVEDDTSIATDVKVPILIAFHHHLYDRDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
             FHHVSTAF ELGK +QEAIE+IT R
Sbjct  121  LFHHVSTAFSELGKGHQEAIEEITKR  146



>gb|ADG36706.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHH STAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHDSTAFLELEKNYQAAIENITKR  146



>gb|ADG36704.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDIT  543
            QFHHVSTAFLEL KNYQ AIE+IT
Sbjct  121  QFHHVSTAFLELEKNYQAAIENIT  144



>gb|ADG36703.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDIT  543
            QFHHVSTAFLEL KNYQ AIE+IT
Sbjct  121  QFHHVSTAFLELEKNYQAAIENIT  144



>gb|ADW78251.1| squalene synthase [Withania somnifera]
 gb|ADO22708.1| squalene synthase [Withania somnifera]
Length=413

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHW FCY MLQKVSRSFAL IQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWAFCYLMLQKVSRSFALAIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHF--LCGTKDYKVL  465
            ELRDAVCIFYLVLRALDTVEDDTSI  +VKVPILI FH+H+YDREWHF  L GTK+YKVL
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPADVKVPILISFHQHVYDREWHFSLLGGTKEYKVL  120

Query  466  MDQFHHVSTAFLELGKNYQEAIEDITMR  549
            MDQFHHVSTAFLELGK+YQ+AI+DIT+R
Sbjct  121  MDQFHHVSTAFLELGKHYQQAIQDITLR  148



>ref|XP_011092839.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011092841.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SL A+ +HPDD+YP++KLK+AAR+ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLQAIWRHPDDLYPMVKLKLAARRAEKQIPAEPHWAFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI+ EVKVPIL+ FHRHIYDREWHF CGTKDYKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSISMEVKVPILMAFHRHIYDREWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELG  YQEAIEDITMR
Sbjct  121  EFHHVSTAFLELGSGYQEAIEDITMR  146



>gb|ACT52826.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36700.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKR  146



>gb|ADG36709.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDIT  543
            QFHHVSTAFLEL KNYQ AIE+IT
Sbjct  121  QFHHVSTAFLELEKNYQAAIENIT  144



>gb|ADG36707.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKR  146



>gb|ADG36699.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKR  146



>ref|XP_010263865.1| PREDICTED: squalene synthase-like [Nelumbo nucifera]
Length=415

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +LKHPDD+YPL KLK+AAR + KQIPP+PHWGFCY ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTVLKHPDDIYPLFKLKMAARNVGKQIPPEPHWGFCYKMLHKVSRSFSLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSIA+++KVPIL +FH+HIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIASDIKVPILKNFHQHIYDGDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFH VSTAFLELG++YQEAIEDIT R
Sbjct  121  QFHLVSTAFLELGRSYQEAIEDITKR  146



>gb|ADG36711.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHH STAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHDSTAFLELEKNYQAAIENITKR  146



>gb|ADG36701.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL KNYQ AIE IT R
Sbjct  121  QFHHVSTAFLELEKNYQAAIESITKR  146



>gb|KJB12166.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=413

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIEDIT+R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITLR  146



>ref|XP_011037190.1| PREDICTED: squalene synthase-like [Populus euphratica]
Length=413

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHP D+YPL+KLK+AA+  EKQIPP+PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPVDIYPLLKLKMAAKHAEKQIPPEPHWAFCYSMLHRVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDHDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFH+VS AFLELGK Y EAIEDIT R
Sbjct  121  QFHNVSNAFLELGKGYHEAIEDITKR  146



>gb|KJB12169.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=427

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIEDIT+R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITLR  146



>gb|EYU42585.1| hypothetical protein MIMGU_mgv1a007225mg [Erythranthe guttata]
Length=414

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SL A+LKHPDD+YP++KLK+AAR+ EKQI  +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLRAILKHPDDLYPMVKLKLAARKAEKQIRSEPHWAFCYSMLLKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTS+AT+VKVPIL+DFH+HIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSVATDVKVPILMDFHQHIYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELG  YQ+AIEDITMR
Sbjct  121  EFHHVSTAFLELGSGYQQAIEDITMR  146



>gb|AFK29284.1| putative squalene synthase 2 [Salvia miltiorrhiza]
 gb|AGE45641.1| squalene synthase 2 [Salvia miltiorrhiza]
 gb|AJR21118.1| squalene synthase 2 [Salvia miltiorrhiza]
Length=414

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M +LGA+LKHP+D+YP++KLK+AARQ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVNLGAILKHPEDLYPMVKLKLAARQAEKQIPAEPHWAFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSIA+EVKVPIL  FHRHIY+ EWHF CGTK+YKVLMD
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIASEVKVPILKAFHRHIYNSEWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFLELGK YQEAIE+ITMR
Sbjct  121  EFHHVSVAFLELGKGYQEAIENITMR  146



>ref|XP_010548076.1| PREDICTED: squalene synthase-like isoform X2 [Tarenaya hassleriana]
Length=415

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDD YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
             LR+AVC+FYLVLR LDTVEDD SI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   HLRNAVCVFYLVLRGLDTVEDDMSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQ+AIEDIT+R
Sbjct  121  QFHHVSAAFLELEKGYQDAIEDITLR  146



>gb|AFN61199.1| squalene synthase [Chlorophytum borivilianum]
Length=410

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+ GA+LKHPDD YP++KL +A +   KQIPPQPHW FCYTML KVSRSFALVIQQL +
Sbjct  1    MGTFGAILKHPDDFYPIMKLAMAMKSAAKQIPPQPHWAFCYTMLHKVSRSFALVIQQLDV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
             LRDAVC+FYLVLRALDTVEDDTSI T+VKVPIL  FHRHIYD EWHF CGTKDYKVLMD
Sbjct  61   NLRDAVCVFYLVLRALDTVEDDTSIPTDVKVPILNSFHRHIYDCEWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLELGK YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELGKGYQEAIEDITRR  146



>ref|XP_010548075.1| PREDICTED: squalene synthase-like isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDD YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
             LR+AVC+FYLVLR LDTVEDD SI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   HLRNAVCVFYLVLRGLDTVEDDMSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQ+AIEDIT+R
Sbjct  121  QFHHVSAAFLELEKGYQDAIEDITLR  146



>gb|ABG66304.1| squalene synthase [Polygala tenuifolia]
Length=413

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+A R  EKQIP +PHWGF Y+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAVLKHPDDFYPLLKLKLAVRHAEKQIPHEPHWGFSYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTS+ T+VKVPIL  FHRHIYDREWHF CGTK+YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSVPTDVKVPILKAFHRHIYDREWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL K YQEAIEDIT R
Sbjct  121  QFHHVSTAFLELDKGYQEAIEDITQR  146



>ref|XP_010039888.1| PREDICTED: squalene synthase-like isoform X2 [Eucalyptus grandis]
Length=414

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GA+L+HP D YPL+KLK+AA   EKQIPPQPHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSWGAILRHPGDFYPLMKLKMAASNAEKQIPPQPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLELGK+YQEAIEDIT R
Sbjct  121  QFHHVSMAFLELGKSYQEAIEDITKR  146



>dbj|BAA13083.1| squalene synthase [Glycyrrhiza glabra]
Length=413

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPD+VYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDEVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VK PILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKEPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDIT  543
            QFHHVSTAFLEL KNYQ AIE+IT
Sbjct  121  QFHHVSTAFLELEKNYQAAIENIT  144



>emb|CAJ77654.1| squalene synthase 1 [Glycyrrhiza eurycarpa]
Length=413

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PH  FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHRAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL KNYQ AIE+IT R
Sbjct  121  QFHHVSTAFLELEKNYQAAIENITKR  146



>gb|ADG36708.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPGEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDIT  543
            QFHHVSTA LEL KNYQ AIE+IT
Sbjct  121  QFHHVSTALLELEKNYQAAIENIT  144



>gb|ACZ71037.1| squalene synthase [Panax ginseng]
Length=415

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPI++ FH HIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPIVMAFHCHIYDNDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFL+LG +Y+EAIEDITMR
Sbjct  121  EFHHVSNAFLDLGSSYKEAIEDITMR  146



>ref|XP_010526913.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526914.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526915.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
Length=413

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M +LGA+L+HPD+ YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MRNLGAILRHPDEFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHH+S AFLEL K YQ AIEDIT R
Sbjct  121  QFHHLSAAFLELEKGYQNAIEDITRR  146



>gb|ACQ90302.1| squalene synthase [Gynostemma pentaphyllum]
Length=417

 Score =   255 bits (651),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GA+L+HPDD YPL+KLK+AAR  EKQIP +PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAILRHPDDFYPLLKLKMAARNAEKQIPQEPHWGFCYTMLHKVSRSFALVIQQLQP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSI T++KVPILI+FHRHIY+R+WHF CGTK YKVLMD
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIETDIKVPILINFHRHIYNRDWHFSCGTKHYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLEL K YQEAI D+T R
Sbjct  121  EFHHVSTAFLELEKGYQEAIGDVTNR  146



>ref|XP_010039880.1| PREDICTED: squalene synthase-like isoform X1 [Eucalyptus grandis]
Length=419

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GA+L+HP D YPL+KLK+AA   EKQIPPQPHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSWGAILRHPGDFYPLMKLKMAASNAEKQIPPQPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YKVLMD
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLELGK+YQEAIEDIT R
Sbjct  121  QFHHVSMAFLELGKSYQEAIEDITKR  146



>gb|AFT92039.1| squalene synthase [Euphorbia pekinensis]
Length=411

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AA+  EK IP  PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAAKNAEKHIPALPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDA+CIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YKV MD
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHVYDREWHFPCGTKEYKVPMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK+YQ+ IEDI  R
Sbjct  121  QFHHVSTAFLELGKSYQDVIEDIAKR  146



>emb|CAJ58419.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRA DTVEDDTSI+TEVKVPI++ FH HIYD +WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRAFDTVEDDTSISTEVKVPIVMAFHCHIYDNDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVS AFL+LG  Y+EAIEDITMR
Sbjct  121  EFHHVSNAFLDLGSGYKEAIEDITMR  146



>gb|AAR20329.1| squalene synthase [Artemisia annua]
Length=418

 Score =   253 bits (646),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  
Sbjct  1    MSSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL + YQEAIEDITMR
Sbjct  121  QFHHVSTAFLELKRGYQEAIEDITMR  146



>ref|XP_002305455.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
 gb|EEE85966.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
Length=476

 Score =   254 bits (649),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +1

Query  109  KMGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLP  288
            KMGSLGA+LKHP D+YPL+KLK+AA+  EKQIP +PHW FCY+ML +VSRSFALVIQQL 
Sbjct  63   KMGSLGAILKHPVDIYPLLKLKMAAKHAEKQIPREPHWAFCYSMLPRVSRSFALVIQQLD  122

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  468
             ELR+AVC+FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD +WHF CGTK+YKVLM
Sbjct  123  TELRNAVCVFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDHDWHFSCGTKEYKVLM  182

Query  469  DQFHHVSTAFLELGKNYQEAIEDITMR  549
            DQFH+VS AFLELGK YQEAIEDIT R
Sbjct  183  DQFHNVSNAFLELGKGYQEAIEDITKR  209



>gb|KJB32574.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
 gb|KJB32576.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=412

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDRDWHFSCGTKNYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLEL K YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELEKGYQEAIEDITKR  146



>gb|AAG14896.2|AF302464_1 squalene synthase [Artemisia annua]
 gb|AAK92539.1|AF405310_1 squalene synthase [Artemisia annua]
Length=418

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  
Sbjct  1    MSSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL + YQEAI DITMR
Sbjct  121  QFHHVSTAFLELKRGYQEAIGDITMR  146



>ref|XP_002313765.1| squalene synthase family protein [Populus trichocarpa]
 gb|EEE87720.1| squalene synthase family protein [Populus trichocarpa]
Length=413

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHP D+YPL+KLK+AA+   KQIP +PHW FCY+ML +VSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPADLYPLLKLKMAAKHAAKQIPSEPHWAFCYSMLHRVSRSFAFVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR WHF CGT DY+VLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDRNWHFSCGTNDYRVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFH VSTAFLEL K YQEAIEDIT R
Sbjct  121  QFHDVSTAFLELEKGYQEAIEDITKR  146



>gb|AAR20328.1| squalene synthase [Artemisia annua]
Length=413

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  115  GSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIE  294
             SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  +
Sbjct  1    SSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNPQ  60

Query  295  LRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQ  474
            LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMDQ
Sbjct  61   LRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYKVLMDQ  120

Query  475  FHHVSTAFLELGKNYQEAIEDITMR  549
            FHHVSTAFLEL + YQEAIEDITMR
Sbjct  121  FHHVSTAFLELKRGYQEAIEDITMR  145



>ref|XP_007042047.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
 gb|EOX97878.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
Length=413

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++++PDD YPL KLK+AAR  EKQIP +PHW FC++ML KVSRSFA VIQQL  
Sbjct  1    MGSLGALVRNPDDFYPLFKLKMAARHAEKQIPSEPHWAFCFSMLLKVSRSFAFVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILIDFHRHIY+R+WHF CGTK YKVLMD
Sbjct  61   KLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIDFHRHIYNRDWHFSCGTKHYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLEL K YQ AIEDIT R
Sbjct  121  EFHHVSTAFLELEKGYQVAIEDITKR  146



>gb|AIX97193.1| squalene synthase [Matricaria chamomilla var. recutita]
Length=409

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LKHPDD +PL+KLK+AA + EKQIP +PHW F Y+ML KVSR+FALVIQQL  
Sbjct  1    MGSLKAVLKHPDDFFPLLKLKMAANKAEKQIPSEPHWAFSYSMLHKVSRNFALVIQQLNP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YKVLMD
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHQHIYNRDWHFACGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLEL + YQEAIEDITMR
Sbjct  121  QFHHVSTAFLELKRGYQEAIEDITMR  146



>gb|ABX10442.1| squalene synthase 2 [Gossypium hirsutum]
Length=412

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHP D YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPGDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR+WHF CGTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILEEFYRHIYDRDWHFSCGTKNYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLEL K YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELEKGYQEAIEDITKR  146



>gb|KHG07441.1| Squalene synthase [Gossypium arboreum]
Length=412

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDPDWHFSCGTKNYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLEL K YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELEKGYQEAIEDITKR  146



>gb|KHN25422.1| Squalene synthase [Glycine soja]
Length=408

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +1

Query  136  KHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCI  315
            +  D+ YPL+KLKI AR  EKQIPP+PHW FCYTML KVSRSFALVIQQL IELR+AVCI
Sbjct  4    RSEDEFYPLLKLKIVARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGIELRNAVCI  63

Query  316  FYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTA  495
            FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YKVLM QFHHVSTA
Sbjct  64   FYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYKVLMGQFHHVSTA  123

Query  496  FLELGKNYQEAIEDITMR  549
            FLELGKNYQEAIEDIT R
Sbjct  124  FLELGKNYQEAIEDITKR  141



>gb|ABQ96265.1| squalene synthase [Psammosilene tunicoides]
Length=414

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LK+PD+ YPL+KLK+A ++ EKQIP + HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKYPDEFYPLLKLKMAIKEAEKQIPQEHHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSIATEVKVPIL  FH+HIYDR+WHF CGTK YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIATEVKVPILRAFHQHIYDRDWHFSCGTKHYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLEL + YQEAIEDIT R
Sbjct  121  EFHHVSTAFLELDRGYQEAIEDITKR  146



>gb|KJB12171.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=412

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K   EAIEDIT+R
Sbjct  121  QFHHVSAAFLELEKGL-EAIEDITLR  145



>ref|NP_195190.1| Squalene synthase 1 [Arabidopsis thaliana]
 sp|P53799.1|FDFT_ARATH RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Arabidopsis thaliana]
 emb|CAA60385.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 dbj|BAA06103.1| squalene synthase [Arabidopsis thaliana]
 gb|AAB62242.1| squalene synthase 1 [Arabidopsis thaliana]
 emb|CAA18843.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAD00296.1| squalene synthase [Arabidopsis thaliana]
 emb|CAB80181.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAM20719.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AAO30082.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86403.1| Squalene synthase [Arabidopsis thaliana]
Length=410

 Score =   247 bits (630),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIYD +WH+ CGTK+YK+LMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYDTDWHYSCGTKEYKILMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEEITRR  146



>ref|XP_010690774.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPD+ YPL+KLK+A ++ EKQIPP+ HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDEFYPLLKLKMAVKEAEKQIPPEAHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSI  +VK+PIL +FH+HIYDR+WHF CGTK YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIDNDVKLPILRNFHQHIYDRDWHFSCGTKHYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLEL + YQ AIEDIT R
Sbjct  121  EFHHVSTAFLELDRGYQLAIEDITKR  146



>ref|XP_002869133.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45392.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGT +YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTNEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEEITRR  146



>ref|XP_006412201.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 ref|XP_006412202.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53654.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53655.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
Length=409

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  Q EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEQAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PIL  FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILKAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHV+ AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKR  146



>ref|XP_010432389.1| PREDICTED: squalene synthase [Camelina sativa]
Length=410

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHV+ AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKR  146



>ref|XP_010437580.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=410

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHV+ AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKR  146



>ref|XP_010447048.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=410

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHV+ AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKR  146



>ref|XP_010437579.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=419

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHV+ AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKR  146



>gb|KFK30097.1| hypothetical protein AALP_AA7G216600 [Arabis alpina]
Length=412

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SLG +L++PDD+YPL+K+K A  Q EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MASLGTILRYPDDIYPLLKMKRAIEQAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEEITKR  146



>ref|XP_009110610.1| PREDICTED: squalene synthase [Brassica rapa]
 ref|XP_009110680.1| PREDICTED: squalene synthase [Brassica rapa]
Length=409

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIY+ +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYNTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVSAAFLELDKGYQEAIEEITKR  146



>ref|XP_008796682.1| PREDICTED: squalene synthase-like isoform X3 [Phoenix dactylifera]
Length=378

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH+VSTAFLELG +YQEAIEDIT R
Sbjct  121  KFHYVSTAFLELGASYQEAIEDITKR  146



>ref|XP_009760451.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
 ref|XP_009760452.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=406

 Score =   242 bits (617),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +G +++HP+++YPLIKL + A+  EKQIP +P+W FCY ML+ +SRSF+LVIQQLP+
Sbjct  1    MGIIGDIVRHPNEIYPLIKLLVTAKLAEKQIPSKPNWSFCYLMLRNISRSFSLVIQQLPL  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVC+FYLVLRALDTVEDDTSIATEVKVPILI FHRHIYD EWHF CGT  YK LMD
Sbjct  61   ELRDAVCVFYLVLRALDTVEDDTSIATEVKVPILIAFHRHIYDHEWHFSCGTDAYKDLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLELG NYQ+ IEDITMR
Sbjct  121  QFHHVSMAFLELGTNYQQVIEDITMR  146



>ref|XP_009108714.1| PREDICTED: squalene synthase-like isoform X1 [Brassica rapa]
 ref|XP_009108715.1| PREDICTED: squalene synthase-like isoform X2 [Brassica rapa]
Length=410

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHV+ AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKR  146



>ref|XP_006283828.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
 gb|EOA16726.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
Length=414

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD++PL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIFPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FH+HIY+ +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHQHIYNTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHV+ AFLEL K YQEAIE+IT R
Sbjct  121  QFHHVAAAFLELEKGYQEAIEEITKR  146



>gb|EPS74249.1| hypothetical protein M569_00507, partial [Genlisea aurea]
Length=292

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG++GA+L+HP+D  P++KLK+A ++ EKQIP +P W FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGTVGAILRHPNDFIPMLKLKMAMKKAEKQIPEEPQWRFCYSMLHRVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDA+C+FYLVLRALDTVEDDTSIAT+VKVPILI FH H+YDR WHF CGTKDYK+LMD
Sbjct  61   DLRDAICVFYLVLRALDTVEDDTSIATDVKVPILISFHSHLYDRGWHFSCGTKDYKILMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH+V TAF ELG++YQEAIEDIT R
Sbjct  121  EFHNVQTAFSELGRSYQEAIEDITKR  146



>ref|XP_008796681.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=404

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH+VSTAFLELG +YQEAIEDIT R
Sbjct  121  KFHYVSTAFLELGASYQEAIEDITKR  146



>ref|XP_008796678.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008796679.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=409

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH+VSTAFLELG +YQEAIEDIT R
Sbjct  121  KFHYVSTAFLELGASYQEAIEDITKR  146



>ref|XP_010934354.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
 ref|XP_010910886.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
Length=408

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LGA+++HP+D+YPL+KLK+AA +I++QIP +PHW F Y MLQKVSRSFALVIQQL +
Sbjct  1    MGMLGAIMEHPEDLYPLVKLKMAADRIKRQIPGEPHWAFSYAMLQKVSRSFALVIQQLGL  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FHRHIYD +WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHRHIYDCDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH+VSTAFLELG +YQ AIEDIT R
Sbjct  121  KFHYVSTAFLELGPSYQVAIEDITKR  146



>gb|AGW25489.1| squalene synthase [Paris polyphylla var. yunnanensis]
Length=403

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG + A+L HP D+Y L+KLK+AA +IE+QIP +PHW F YTMLQKVSRSFA+VIQQL  
Sbjct  1    MGMMAAVLDHPGDLYVLVKLKMAASRIERQIPAEPHWAFAYTMLQKVSRSFAIVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FHRHIYDR+WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHRHIYDRDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH+VSTAFLEL K YQEAIE+IT R
Sbjct  121  KFHYVSTAFLELDKGYQEAIEEITKR  146



>ref|XP_006412200.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
 gb|ESQ53653.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
Length=396

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +++HPD++YPL+KLKIA  + + QIP +PH  FCY+MLQKVS+SF+LVIQQL  
Sbjct  1    MGSLSTIVRHPDEIYPLLKLKIAITKAQNQIPLEPHLAFCYSMLQKVSKSFSLVIQQLAT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYL+LRALDTVEDDTSI  E+KVPILI FHRHI+DR WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSIPVEIKVPILIAFHRHIFDRNWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIEDIT R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKR  146



>ref|XP_009138312.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138313.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138314.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=417

 Score =   239 bits (611),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            Q HHVS AFLEL K YQEAIE+IT R
Sbjct  121  QLHHVSAAFLELEKGYQEAIEEITKR  146



>ref|XP_010025621.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPD++YPL+KLK+ AR  EKQ+P QPHW FCY+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGAILKHPDELYPLLKLKMKARNAEKQLPQQPHWRFCYSMLRKFSKTFAFVIEQLPT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCI YLVLRALDTVEDDTSI  +VKVPIL  F +H++D+EWHF CGTK+ KVLMD
Sbjct  61   ELRDAVCILYLVLRALDTVEDDTSIPVDVKVPILKAFLQHVFDKEWHFSCGTKECKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQE IE+IT R
Sbjct  121  QFHHVSTAFLELGKRYQEVIEEITKR  146



>ref|XP_008795798.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=373

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M  LGA+++HP+++YPL+KLK+AA +I+KQIP +PHW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MRMLGAIVEHPEELYPLVKLKMAAARIKKQIPGEPHWAFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI  ++KVPIL  FH HIYDR+WHF CGTKDY+VLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPCDIKVPILESFHCHIYDRDWHFSCGTKDYRVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH+VSTAFLELG +YQ+AIEDIT R
Sbjct  121  KFHYVSTAFLELGASYQQAIEDITKR  146



>ref|XP_010447047.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +P+  FCYTML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKQIPLEPNLAFCYTMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAVEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIEDIT R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKR  146



>gb|AAY22201.1| squalene synthase [Datura inoxia]
Length=387

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  181  ARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDT  360
            AR  EKQIPP+PHWGFCY ML KVSRSFALVIQQLP+ELRDAVCIFYLVLRALDTVEDDT
Sbjct  1    ARHAEKQIPPEPHWGFCYLMLHKVSRSFALVIQQLPVELRDAVCIFYLVLRALDTVEDDT  60

Query  361  SIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDI  540
            SI T+VKVPILI FH+H+YDREWHF CGTK+YKVLMDQFHHVSTAFLELGK+YQ+AIEDI
Sbjct  61   SIPTDVKVPILISFHQHVYDREWHFSCGTKEYKVLMDQFHHVSTAFLELGKHYQQAIEDI  120

Query  541  TMR  549
            TMR
Sbjct  121  TMR  123



>ref|XP_008795796.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=408

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M  LGA+++HP+++YPL+KLK+AA +I+KQIP +PHW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MRMLGAIVEHPEELYPLVKLKMAAARIKKQIPGEPHWAFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI  ++KVPIL  FH HIYDR+WHF CGTKDY+VLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPCDIKVPILESFHCHIYDRDWHFSCGTKDYRVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH+VSTAFLELG +YQ+AIEDIT R
Sbjct  121  KFHYVSTAFLELGASYQQAIEDITKR  146



>gb|AGI56082.1| squalene synthase [Dendrobium catenatum]
Length=410

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG + A+L+HP+D+ PL K+ + A QI++QIPP+PHWGF Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMVKAVLEHPEDLIPLTKMMMTAEQIKRQIPPEPHWGFAYSMLQKVSRSFALVIQQLDA  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLRALDTVEDDTSI  ++KVPIL++FH+HIYDR+WHF CGT  YKVLMD
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPVDIKVPILLEFHKHIYDRDWHFSCGTNAYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH +S AFLELGK+YQEAIED+T+R
Sbjct  121  KFHFISIAFLELGKSYQEAIEDVTLR  146



>ref|XP_010432387.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKQIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAVEIKLPILIAFHRHIYDCDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIEDIT R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKR  146



>ref|XP_006285747.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
 gb|EOA18645.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
Length=413

 Score =   234 bits (598),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +PH  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAITKAQKQIPLEPHLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYL+LRALDTVEDDTS+  E+K+PILI FHRHIYD +WHF CGTK+YKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVEMEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIED+T R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDVTKR  146



>ref|XP_009389044.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=408

 Score =   234 bits (597),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L AM+ HPD+VYP++KLK+A+ +I +QIP +PHW F Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMLAAMVTHPDEVYPMVKLKLASDRIRRQIPAEPHWSFSYSMLQKVSRSFALVIQQLEP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVC+FYLVLRALDTVEDDTSI +++KVPIL +F+ HIYDR+WHF CG KDYK+LMD
Sbjct  61   QLRDAVCVFYLVLRALDTVEDDTSIPSDIKVPILQNFYLHIYDRKWHFSCGAKDYKILMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH VSTAFLEL K+YQEAIEDIT R
Sbjct  121  KFHLVSTAFLELDKSYQEAIEDITRR  146



>ref|XP_002869132.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45391.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYL+LRALDTVEDDTSI  E KVPILI FHRH+YD  WHF CGTKDYKVLMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSIPMETKVPILIAFHRHLYDGGWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIEDIT R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKR  146



>emb|CDX72493.1| BnaC07g45150D [Brassica napus]
Length=426

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 127/155 (82%), Gaps = 9/155 (6%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLC---------G  444
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C         G
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCKFYSIQTLGG  120

Query  445  TKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMR  549
            TK+YKVLMDQFHHVS AFLEL K YQEAIE+IT R
Sbjct  121  TKEYKVLMDQFHHVSAAFLELEKGYQEAIEEITKR  155



>gb|KJB32578.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=406

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 6/146 (4%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR      GTK+YKVLMD
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDR------GTKNYKVLMD  114

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVSTAFLEL K YQEAIEDIT R
Sbjct  115  EFHHVSTAFLELEKGYQEAIEDITKR  140



>gb|AHB20141.2| squalene synthase [Fritillaria thunbergii]
Length=409

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +   L HP+D+Y L+K+K AA Q+EKQIPP PHW FCYTMLQKVSRSFA VIQQL  
Sbjct  1    MGMMKEALMHPEDLYVLVKMKRAAAQVEKQIPPDPHWAFCYTMLQKVSRSFAFVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC+FYLVLRALDTVEDDTSI  ++K+PIL  FHRHIY+ +WHF CGTKDYKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPEDIKLPILESFHRHIYNPDWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
             F ++STAFLELGK+YQE IEDIT R
Sbjct  121  NFRNISTAFLELGKSYQEGIEDITER  146



>gb|AFY63035.1| squalene synthase [Alisma plantago-aquatica subsp. orientale]
Length=409

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +GA+L+HP+D+  L+KLK+A R+IEKQIPP+PHWGF YTMLQ+VSRSFA+VIQQL  
Sbjct  1    MGVVGAILEHPEDLVALLKLKVAVRKIEKQIPPEPHWGFSYTMLQRVSRSFAIVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLR LDT+EDDTSI T+ K+PIL  FH+HIYD +WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRGLDTIEDDTSIPTDTKLPILNSFHQHIYDPDWHFSCGVKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
             FH+VS AFLEL K+Y++AIEDIT R
Sbjct  121  NFHYVSNAFLELDKSYKDAIEDITKR  146



>gb|ACI14294.1| squalene synthase [Linum usitatissimum]
Length=271

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +1

Query  193  EKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIAT  372
            EKQIPP PHWGFCYTML KVSRSFALVIQQL  ELRDAVCIFYLVLRALDTVEDDTSIAT
Sbjct  2    EKQIPPHPHWGFCYTMLLKVSRSFALVIQQLGTELRDAVCIFYLVLRALDTVEDDTSIAT  61

Query  373  EVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMR  549
            EVKVPIL DFHRHIYD+EWHF CGTKDYKVLMD+FHHVSTAFLELG+ YQEAIEDIT R
Sbjct  62   EVKVPILNDFHRHIYDQEWHFSCGTKDYKVLMDEFHHVSTAFLELGRGYQEAIEDITKR  120



>gb|AGN32410.1| squalene synthase [Dioscorea zingiberensis]
Length=409

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +GAM+++P +   L+KLK+AA +I +QIPP+ HW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MGMMGAMVENPGEAVALVKLKVAAARIARQIPPEEHWAFAYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLRALDTVEDDTSI  +VKVPIL  FH HIYDR+WHF CG KDYKVLMD
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPADVKVPILQAFHCHIYDRDWHFSCGAKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FH+VSTAFLELGK YQEAI+DIT R
Sbjct  121  KFHYVSTAFLELGKGYQEAIDDITRR  146



>ref|XP_010437577.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=410

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +K+IP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKKIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLM+
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAMEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLME  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIEDIT R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKR  146



>ref|XP_010437578.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=407

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +K+IP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKKIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YKVLM+
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAMEIKLPILIAFHRHIYDGDWHFSCGTKEYKVLME  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIEDIT R
Sbjct  121  QFHHVSAAFLELEKGYQEAIEDITKR  146



>emb|CDX69076.1| BnaC01g03770D [Brassica napus]
Length=428

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  288
            MGSL  +L+HPD++YPL+KLK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAIIKAQNQIPLDDPHLALCYSLLQKVSRSFSLVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  468
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR+WHF+CGT++YKVLM
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPMEIKVPILLAFHRHIYDRDWHFICGTEEYKVLM  120

Query  469  DQFHHVSTAFLELGKNYQEAIEDITMR  549
            DQFHHVS AFLEL K YQEAIEDIT R
Sbjct  121  DQFHHVSAAFLELEKGYQEAIEDITKR  147



>emb|CDY17472.1| BnaC03g65910D [Brassica napus]
Length=426

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 128/162 (79%), Gaps = 16/162 (10%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLC----------  441
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C          
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCKSEESFNLFD  120

Query  442  ------GTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMR  549
                  GTK+YKVLMDQFHHV+ AFLEL K YQEAIE+IT R
Sbjct  121  LSHPFGGTKEYKVLMDQFHHVAAAFLELEKGYQEAIEEITKR  162



>gb|AAB61927.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY++L KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSILHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYL+LRALDTVEDDTS+  E+KVPILI FHRHIYD +WHF CGTK+YK+LMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVPVEIKVPILIAFHRHIYDGDWHFSCGTKEYKLLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFL+L K YQEAIEDIT R
Sbjct  121  QFHHVSAAFLKLEKGYQEAIEDITKR  146



>ref|NP_195191.2| squalene synthase 2 [Arabidopsis thaliana]
 emb|CAA18844.2| putative squalene synthase [Arabidopsis thaliana]
 emb|CAB80182.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86404.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY++L KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSILHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYL+LRALDTVEDDTS+  E+KVPILI FHRHIYD +WHF CGTK+YK+LMD
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVPVEIKVPILIAFHRHIYDGDWHFSCGTKEYKLLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFL+L K YQEAIEDIT R
Sbjct  121  QFHHVSAAFLKLEKGYQEAIEDITKR  146



>ref|XP_010690775.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SLGA++KHPD+ YPL+KLK+A  + EKQIP + HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLGAIMKHPDEFYPLLKLKMAVNKAEKQIPSEAHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC+FYLVLRALDTVEDDTS+A +VK+PIL  FH HIYDR+WHF CGTK YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSLADDVKIPILRAFHEHIYDRDWHFSCGTKHYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +F++V TAFLEL + YQ AIEDIT R
Sbjct  121  EFNYVRTAFLELDRGYQVAIEDITKR  146



>ref|XP_009591242.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=282

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +G +++HPD+VYPL+KL +AA+ IEK  P QPHW FC T L KVSRSFAL+IQQLP 
Sbjct  1    MGMMGKIMRHPDEVYPLMKLMLAAKLIEKGTPLQPHWAFCNTTLHKVSRSFALLIQQLPT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC++YLVLR LDTVEDDTS+ATEV+VPIL + + H YDREWHF CGTK +KVLMD
Sbjct  61   DLRNAVCVYYLVLRVLDTVEDDTSLATEVRVPILRNVYCHFYDREWHFSCGTKAFKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFH VSTAFLEL KNYQE I+DIT R
Sbjct  121  QFHDVSTAFLELDKNYQEVIKDITKR  146



>gb|KFK30098.1| hypothetical protein AALP_AA7G216700 [Arabis alpina]
Length=413

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  288
            MGSL  +L HPD++YPL KL IA  + + QIP  +PH  FCY+ML KVS+SF+LVIQQL 
Sbjct  1    MGSLSTILSHPDEIYPLFKLVIAITKAKNQIPFHEPHLAFCYSMLHKVSKSFSLVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  468
             ELR+AVC+FYL+LRALDTVEDDTSI  E+KVPILIDFHRH+YDR+WHF CGTKDYKVLM
Sbjct  61   TELRNAVCLFYLILRALDTVEDDTSIPIEIKVPILIDFHRHMYDRDWHFSCGTKDYKVLM  120

Query  469  DQFHHVSTAFLELGKNYQEAIEDITMR  549
            +QFHHVS AFLEL K YQEAIEDIT R
Sbjct  121  NQFHHVSAAFLELDKGYQEAIEDITKR  147



>ref|XP_009396917.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396918.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=409

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG ++ +P++VYPL+KLK+AA +I +QIP +PHW F Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMLGTVVAYPEEVYPLVKLKLAADRIRRQIPAEPHWAFSYSMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC+FYLVLRALDTVEDDTSI +++KVPIL +F+RHIYD EWHF CGTKDYKVLMD
Sbjct  61   QLRNAVCVFYLVLRALDTVEDDTSIPSDIKVPILQNFYRHIYDCEWHFSCGTKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            + H VSTAFLEL ++YQEAIEDIT R
Sbjct  121  KLHLVSTAFLELERSYQEAIEDITKR  146



>emb|CDX72494.1| BnaC07g45160D [Brassica napus]
Length=395

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP  PH  FCY+ L KVS++F+L+IQQL  
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAITKAQKQIPLDPHLTFCYSTLNKVSKTFSLIIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVC+FYL+LRALDTVEDDTSI TE+KVPILI FHRHIYDR+WHF+CG + YKVLM+
Sbjct  61   ELRDAVCLFYLILRALDTVEDDTSIPTEIKVPILIAFHRHIYDRDWHFVCGEEKYKVLME  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQE IEDIT R
Sbjct  121  QFHHVSAAFLELEKGYQEIIEDITKR  146



>ref|XP_009110500.1| PREDICTED: squalene synthase [Brassica rapa]
Length=418

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  288
            MGSL  +L+HPD++YPL++LK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLRLKLAIMKAQNQIPLDDPHLAVCYSLLQKVSRSFSLVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  468
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR+WHF CGTK+YKVLM
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPIEIKVPILLAFHRHIYDRDWHFTCGTKEYKVLM  120

Query  469  DQFHHVSTAFLELGKNYQEAIEDITMR  549
            DQFHHVS AFLEL + YQEAIEDIT R
Sbjct  121  DQFHHVSAAFLELEEGYQEAIEDITKR  147



>ref|XP_010065915.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +LKHPD++Y L+KLK+ AR  EKQIP QPHW F Y+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGVILKHPDELYHLLKLKMEARNAEKQIPQQPHWRFGYSMLRKFSKTFAFVIEQLPT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCI YLVLRALDTVEDDTSI  EVKVPIL  F  H++D+EWH  CGTK  KVLMD
Sbjct  61   ELRDAVCILYLVLRALDTVEDDTSIPIEVKVPILKAFLEHVFDKEWHLSCGTKKCKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQE IEDIT R
Sbjct  121  QFHHVSTAFLELGKRYQEVIEDITKR  146



>emb|CDX75451.1| BnaA01g02510D [Brassica napus]
Length=413

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  288
            MGSL  +L+HPD++YPL+KLK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAIMKAQNQIPLDDPHLAICYSLLQKVSRSFSLVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  468
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR WHF CGT++YKVLM
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPMEIKVPILLAFHRHIYDRGWHFTCGTEEYKVLM  120

Query  469  DQFHHVSTAFLELGKNYQEAIEDITMR  549
            DQFHHVS AFLEL + YQEAIEDIT R
Sbjct  121  DQFHHVSAAFLELEEGYQEAIEDITKR  147



>ref|XP_006841632.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
 gb|ERN03307.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
Length=407

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG++LKHP D+  L+KLK A+   EKQ+PP+PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGKLGSLLKHPADLPALVKLKFASLYAEKQVPPEPHWAFCYTMLQKVSRSFALVIQQLEP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLR LDTVEDDTSI  +VK+PIL  FHRHIYD  WHF CGT  YK+LMD
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIPADVKLPILESFHRHIYDVNWHFSCGTNHYKMLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDIT  543
             F HV+++FLELG+ YQEAIEDIT
Sbjct  121  HFQHVASSFLELGRRYQEAIEDIT  144



>emb|CDY45323.1| BnaA03g52960D [Brassica napus]
Length=218

 Score =   221 bits (564),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L HPD++YPL+KLK+A  + +KQIP  PH  FCY+ L KV ++F+L+IQQL  
Sbjct  1    MGSLSTILIHPDEIYPLLKLKLAITKAQKQIPLDPHLTFCYSTLNKVFKTFSLIIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVC+FYL+LRALDTVEDDTSI TE+KVPI I FHRHIYDR+WHF+CG + YKVLM+
Sbjct  61   ELRDAVCVFYLILRALDTVEDDTSIPTEIKVPIRIAFHRHIYDRDWHFVCGEEKYKVLME  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQE IEDIT R
Sbjct  121  QFHHVSAAFLELEKGYQEIIEDITKR  146



>ref|XP_002466259.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
 gb|EER93257.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
Length=403

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQLP +LR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFGYSMLQKVSRSFALVIQQLPPQLR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  480
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RHIY+R+WHF CGT  Y+VLMD FH
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHIYNRDWHFSCGTNHYRVLMDNFH  119

Query  481  HVSTAFLELGKNYQEAIEDITMR  549
            HVSTAFLELG+ YQ+AIE+IT R
Sbjct  120  HVSTAFLELGQGYQKAIEEITRR  142



>ref|XP_006651930.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=403

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V PL+KL++AA ++++QIPP+ HW F YTMLQKVSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRLKRQIPPEEHWAFAYTMLQKVSRSFALVIQQLGPDLRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  486
            VCIFYLVLRALDTVEDDTSI TEVKVPIL  FH+HIY+R+WH+ CGTKDYKVLMD+F  V
Sbjct  62   VCIFYLVLRALDTVEDDTSIPTEVKVPILQQFHKHIYNRDWHYSCGTKDYKVLMDKFRLV  121

Query  487  STAFLELGKNYQEAIEDIT  543
            STAFLELG+ YQEAIE+IT
Sbjct  122  STAFLELGQGYQEAIEEIT  140



>ref|NP_001051625.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAA22557.1| squalene synthase [Oryza sativa Japonica Group]
 gb|AAS07223.1| squalene synthase [Oryza sativa Japonica Group]
 gb|ABF99429.1| Squalene synthetase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13539.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAH01306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V PL+KL++AA +I++QIPP+ HW F YTMLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVSRSFALVIQQLGPDLRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  486
            VCIFYLVLRALDTVEDDTSI   VKVPIL +FHRHIY+R+WH+ CGTKDYK+LMD+F  V
Sbjct  62   VCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDWHYSCGTKDYKLLMDKFRLV  121

Query  487  STAFLELGKNYQEAIEDIT  543
            STAFLELG+ YQEAIE+IT
Sbjct  122  STAFLELGQGYQEAIEEIT  140



>gb|EEE60131.1| hypothetical protein OsJ_13016 [Oryza sativa Japonica Group]
Length=413

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V PL+KL++AA +I++QIPP+ HW F YTMLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVSRSFALVIQQLGPDLRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  486
            VCIFYLVLRALDTVEDDTSI   VKVPIL +FHRHIY+R+WH+ CGTKDYK+LMD+F  V
Sbjct  62   VCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDWHYSCGTKDYKLLMDKFRLV  121

Query  487  STAFLELGKNYQEAIEDIT  543
            STAFLELG+ YQEAIE+IT
Sbjct  122  STAFLELGQGYQEAIEEIT  140



>ref|NP_001130502.1| uncharacterized protein LOC100191601 [Zea mays]
 gb|ACF78747.1| unknown [Zea mays]
Length=403

 Score =   218 bits (556),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  480
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RH+Y+R+WH+ CGT  YKVLMD+FH
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHVYNRDWHYSCGTNHYKVLMDKFH  119

Query  481  HVSTAFLELGKNYQEAIEDITMR  549
             VSTAFLELG+ YQ+AIE+IT R
Sbjct  120  LVSTAFLELGQGYQKAIEEITRR  142



>ref|NP_001104839.1| squalene synthase1 [Zea mays]
 dbj|BAA22558.1| squalene synthase [Zea mays]
 gb|ACN34757.1| unknown [Zea mays]
 gb|AFW67298.1| Squalene synthase isoform 1 [Zea mays]
 gb|AFW67299.1| Squalene synthase isoform 2 [Zea mays]
Length=401

 Score =   218 bits (556),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  480
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RHIY+R+WH+ CGT  YK+LMD+F 
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHIYNRDWHYSCGTNHYKMLMDKFR  119

Query  481  HVSTAFLELGKNYQEAIEDITMR  549
            HVSTAFLELG+ YQ+AIE++T R
Sbjct  120  HVSTAFLELGEGYQKAIEEVTRR  142



>tpg|DAA52014.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=403

 Score =   218 bits (556),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  480
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RH+Y+R+WH+ CGT  YKVLMD+FH
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHVYNRDWHYSCGTNHYKVLMDKFH  119

Query  481  HVSTAFLELGKNYQEAIEDITMR  549
             VSTAFLELG+ YQ+AIE+IT R
Sbjct  120  LVSTAFLELGQGYQKAIEEITRR  142



>ref|XP_010025618.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=407

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 6/146 (4%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPD+      LK+ AR  EK IP QPHW FCY+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGAILKHPDE------LKMEARNAEKLIPQQPHWRFCYSMLRKFSKTFAFVIEQLPT  54

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVCI YLVLRALDTVEDDTSI   VKVPIL  F +H++D+EWH  CG+K+ KVLMD
Sbjct  55   ELRDAVCILYLVLRALDTVEDDTSIPVAVKVPILKAFLQHVFDKEWHLSCGSKECKVLMD  114

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFLELGK YQE IEDIT R
Sbjct  115  QFHHVSTAFLELGKRYQEVIEDITKR  140



>gb|ABI14439.1| squalene synthase [Taxus cuspidata]
Length=409

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M S+GA+LKHP+DV  L+K+K AA    KQIP  P   FCYTMLQKVSRSFA VIQQL +
Sbjct  1    MASIGAILKHPEDVPALLKMKFAAAHASKQIPLDPDLAFCYTMLQKVSRSFAFVIQQLGL  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLR LDTVEDD SI  + K+PIL +FH+HIYD  WHF CG  DYK LMD
Sbjct  61   ELRNAVCVFYLVLRGLDTVEDDMSIPVDTKLPILTNFHQHIYDPSWHFSCGVNDYKELMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVSTAFL LGK YQE IE+IT R
Sbjct  121  QFHHVSTAFLALGKRYQEGIEEITKR  146



>gb|AFJ15526.1| squalene synthase [Azadirachta indica]
Length=392

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  175  IAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVED  354
            +A R  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  +LR+AVCIFYLVLRALDTVED
Sbjct  1    MAVRHAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGTDLRNAVCIFYLVLRALDTVED  60

Query  355  DTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIE  534
            DTSI  +VKVPILI F  H+YDR WHF CGTK+YKVLMDQFH VSTAFLELGK YQEAIE
Sbjct  61   DTSIPADVKVPILIAFRHHVYDRNWHFSCGTKEYKVLMDQFHLVSTAFLELGKGYQEAIE  120

Query  535  DITMR  549
            DIT R
Sbjct  121  DITKR  125



>emb|CDX75450.1| BnaA01g02520D [Brassica napus]
Length=398

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 120/146 (82%), Gaps = 11/146 (8%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GTK+YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTKEYKVLMD  109

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIE+IT R
Sbjct  110  QFHHVSAAFLELDKGYQEAIEEITKR  135



>emb|CDX69075.1| BnaC01g03780D [Brassica napus]
Length=398

 Score =   213 bits (543),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 11/146 (8%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GT +YKVLMD
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTNEYKVLMD  109

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVS AFLEL K YQEAIE+IT R
Sbjct  110  QFHHVSAAFLELDKGYQEAIEEITKR  135



>emb|CDX76294.1| BnaA08g11060D [Brassica napus]
Length=400

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 11/146 (8%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GTK+YKVLMD
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTKEYKVLMD  109

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHV+ AFLEL K YQEAIE+IT R
Sbjct  110  QFHHVAAAFLELEKGYQEAIEEITKR  135



>ref|XP_010312074.1| PREDICTED: squalene synthase-like isoform X2 [Solanum lycopersicum]
Length=384

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 120/149 (81%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  282
            MG +  +L HPD++YPLIKL ++ +++E +      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MGFMQEILMHPDELYPLIKLMLSVKRVENKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  283  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKV  462
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +W+F CGTK +KV
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWNFSCGTKAFKV  120

Query  463  LMDQFHHVSTAFLELGKNYQEAIEDITMR  549
            LMDQFHHVSTAFLEL  NYQE I+DIT R
Sbjct  121  LMDQFHHVSTAFLELDTNYQEVIKDITKR  149



>ref|XP_006351382.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=400

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 121/146 (83%), Gaps = 3/146 (2%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQLPI  291
            +G ++KHPD++YPL+KL ++A+++EK+      QPHW FCY +L+KVSRSFALVIQQLP 
Sbjct  1    MGEIMKHPDELYPLMKLMLSAKRVEKKTSVWLLQPHWAFCYAILRKVSRSFALVIQQLPS  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRD VC++YLVLRALDTVEDDTS+ TEV+VPIL DF+ H++D EWHF C T  +KVLMD
Sbjct  61   DLRDVVCVYYLVLRALDTVEDDTSLTTEVRVPILKDFYSHLHDPEWHFSCDTIAFKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVST+ LEL  +YQE I+DIT R
Sbjct  121  QFHHVSTSLLELDTDYQEVIKDITKR  146



>ref|XP_006351216.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=412

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 120/149 (81%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  282
            M  +  +L HPD++YPL+KL + A+++EK+      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MELMQEILMHPDELYPLVKLMLTAKRVEKKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  283  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKV  462
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +WHF CGTK +KV
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWHFSCGTKAFKV  120

Query  463  LMDQFHHVSTAFLELGKNYQEAIEDITMR  549
            LMDQFHHVSTAFLEL  NYQE I+DIT R
Sbjct  121  LMDQFHHVSTAFLELDTNYQEVIKDITKR  149



>ref|XP_004249733.1| PREDICTED: squalene synthase-like isoform X1 [Solanum lycopersicum]
Length=412

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 120/149 (81%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  282
            MG +  +L HPD++YPLIKL ++ +++E +      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MGFMQEILMHPDELYPLIKLMLSVKRVENKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  283  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKV  462
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +W+F CGTK +KV
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWNFSCGTKAFKV  120

Query  463  LMDQFHHVSTAFLELGKNYQEAIEDITMR  549
            LMDQFHHVSTAFLEL  NYQE I+DIT R
Sbjct  121  LMDQFHHVSTAFLELDTNYQEVIKDITKR  149



>gb|AHI96421.1| squalene synthase [Pinus massoniana]
Length=409

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+GA+LKHP+DV  L+++KIA     KQIP +P   FC+TMLQ+VSRSFA VIQQL  
Sbjct  1    MGSIGALLKHPEDVPALVRMKIAQTHALKQIPSEPDLAFCFTMLQRVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVCIFYLVLR LDTVEDDTSI  + K+PIL  F++HIYD  WHF CG   YK LM+
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIPLDTKLPILKAFYKHIYDPSWHFSCGVNHYKELME  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVST FL LG+ YQEAIE+IT +
Sbjct  121  KFHHVSTTFLRLGRGYQEAIEEITKK  146



>dbj|BAJ87710.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V  L++LK+AA +I +QIPP+ HW F Y MLQ+VSRSFALVIQQL  ELR+A
Sbjct  2    GVLSRPEEVAALVRLKVAAGRIRRQIPPEAHWAFAYDMLQRVSRSFALVIQQLGPELRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  486
            VC+FYLVLRALDTVEDDT I  EVK+PIL DF+RHIY+ +W F CG  DY+VLMD F  V
Sbjct  62   VCVFYLVLRALDTVEDDTGIPNEVKLPILRDFYRHIYNPDWLFSCGANDYRVLMDNFRQV  121

Query  487  STAFLELGKNYQEAIEDITMR  549
            STAFLELG+ YQ+AIE+IT R
Sbjct  122  STAFLELGEGYQKAIEEITRR  142



>gb|ABK24732.1| unknown [Picea sitchensis]
Length=409

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+  +LKHP+DV  L+++KIA     KQIP +P   FC+TMLQ+VSRSFA VIQQL  
Sbjct  1    MGSIRTILKHPEDVPALVRMKIAQTHALKQIPSEPDLAFCFTMLQRVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LR+AVCIFYLVLR LDTVEDDTSI  + K+PIL  F++HIYD  WHF CG KDYK LM+
Sbjct  61   DLRNAVCIFYLVLRGLDTVEDDTSIPLDTKLPILEAFYKHIYDPSWHFSCGVKDYKELME  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +FHHVST FL LG+ YQEAIE+IT R
Sbjct  121  KFHHVSTTFLRLGRGYQEAIEEITKR  146



>emb|CDY45322.1| BnaA03g52950D [Brassica napus]
Length=407

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 114/146 (78%), Gaps = 10/146 (7%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C          
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSC----------  110

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +++    AFLEL K YQEAIE+IT R
Sbjct  111  KWYQGIQAFLELEKGYQEAIEEITKR  136



>ref|XP_003564211.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=402

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V PL+K+  AA +I +QIPPQ HW F Y MLQKVSRSFALVIQQL  +LR
Sbjct  1    MGA-LSRPEEVAPLVKMAAAAWRIRRQIPPQEHWAFAYDMLQKVSRSFALVIQQLGPDLR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFH  480
            +AVCIFYLVLRALDTVEDDT + TEVK+PIL +F+RHIY+ +WHF CG   Y+VLMD F 
Sbjct  60   NAVCIFYLVLRALDTVEDDTGVPTEVKLPILQEFYRHIYNPDWHFSCGRGHYRVLMDNFR  119

Query  481  HVSTAFLELGKNYQEAIEDITMR  549
            HVS AFLEL + YQ AIE+IT R
Sbjct  120  HVSIAFLELDQGYQNAIEEITRR  142



>ref|NP_001059129.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAC84212.1| putative squalene synthase [Oryza sativa Japonica Group]
 dbj|BAF21043.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAG88654.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66758.1| hypothetical protein OsJ_23470 [Oryza sativa Japonica Group]
Length=410

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 118/150 (79%), Gaps = 6/150 (4%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQP----HWGFCYTMLQKVSRSFALVIQ  279
            MG +GA+L    +   L++L+ AA ++ +++        HW F Y+ML +VSRSFA+VIQ
Sbjct  1    MGVVGALL--GPEAEALVRLRAAAWRLRREVAAATDDDEHWAFAYSMLHRVSRSFAIVIQ  58

Query  280  QLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            QL  +LR+AVC+FYLVLRALDTVEDDTSI TE+KVPIL +FHRHIY+R+WHF CGTKD K
Sbjct  59   QLGPDLRNAVCVFYLVLRALDTVEDDTSIPTEIKVPILQEFHRHIYNRDWHFSCGTKDCK  118

Query  460  VLMDQFHHVSTAFLELGKNYQEAIEDITMR  549
            +LMD+FH+V TAFLELG  YQEAIE+IT R
Sbjct  119  ILMDKFHYVLTAFLELGSGYQEAIEEITRR  148



>gb|AEX58673.1| squalene synthase [Huperzia serrata]
Length=420

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L  +L+HP++V  L+K+K  A +++ Q+P  PH  FCY MLQKVSRSFA+VIQQL  
Sbjct  1    MGVLTTVLQHPNEVPALLKMKFMASRLKWQLPSDPHRSFCYEMLQKVSRSFAVVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
             LRDAVC+FYLVLR LDTVEDD SI  + KVPIL  FH  IYD  W F+CG KDYKVLMD
Sbjct  61   NLRDAVCVFYLVLRGLDTVEDDMSIPLDTKVPILKAFHETIYDPAWRFVCGEKDYKVLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QFHHVST FL L K +Q+ I +IT R
Sbjct  121  QFHHVSTTFLNLDKKFQDVIAEITQR  146



>ref|XP_001775898.1| predicted protein [Physcomitrella patens]
 gb|EDQ59263.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +G ++KHPD++ PLIKLKIAA + +K IP  P+  FCY ML +VSRSF++VIQQL  
Sbjct  1    MGIIGTLVKHPDEIPPLIKLKIAAHRAQKAIPKDPNLAFCYRMLTRVSRSFSIVIQQLSP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVC+FYLVLR LDTVEDD +I  ++KVPIL  FH+HIYD  W F CG KDYK LM+
Sbjct  61   ELRDAVCVFYLVLRGLDTVEDDMAIPIDIKVPILKAFHKHIYDPSWKFSCGEKDYKELMN  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +F  VS AFL L + YQ+ I ++T R
Sbjct  121  KFELVSNAFLNLEEGYQKVIAEMTER  146



>ref|XP_001773253.1| predicted protein [Physcomitrella patens]
 gb|EDQ61943.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +  ++KHPD++ PL+KLK+ A + ++ IP  P+  FCY ML +VSRSF++VIQQL  
Sbjct  1    MGLMETLVKHPDEIRPLVKLKVDAMRAQRAIPKDPYLAFCYRMLMRVSRSFSIVIQQLRT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVC+FYLVLR LDT+EDD +I  ++KVPIL  FH HIYD  W F+CG KDYK LM+
Sbjct  61   ELRDAVCVFYLVLRGLDTIEDDMAIPIDIKVPILKSFHEHIYDPSWKFVCGEKDYKELMN  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +F  VS AFL L + YQ  I ++T R
Sbjct  121  KFECVSNAFLNLDEGYQRVIAEMTNR  146



>ref|XP_007042048.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 ref|XP_007042049.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97879.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97880.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
Length=305

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  238  MLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIY  417
            ML KVSRSFALVIQQL  +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILIDFHRHIY
Sbjct  1    MLHKVSRSFALVIQQLDTKLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIDFHRHIY  60

Query  418  DREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMR  549
            +R+WHF CGTK YKVLMD+FHHVSTAFLEL K YQ AIEDIT R
Sbjct  61   NRDWHFSCGTKHYKVLMDEFHHVSTAFLELEKGYQVAIEDITKR  104



>gb|AIW04729.1| squalene synthase [Dryopteris fragrans]
Length=412

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQ-PHWGFCYTMLQKVSRSFALVIQQLP  288
            MG L  +L+HP+++  L+KL+IAA  +   +P       FCY MLQ+VSRSFALVIQQL 
Sbjct  1    MGLLKGVLEHPEEIPALVKLRIAAATLRLHVPAHDADLSFCYLMLQRVSRSFALVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLM  468
             ELRDA+CIFYLVLRALDTVEDD SI+ + K+P+L  FH++I+D  WHF CG +DYKVLM
Sbjct  61   TELRDAICIFYLVLRALDTVEDDMSISVDTKLPVLKSFHKNIHDPTWHFPCGERDYKVLM  120

Query  469  DQFHHVSTAFLELGKNYQEAIED  537
            D+FHHVS AFL+L K YQ AIED
Sbjct  121  DEFHHVSMAFLKLHKRYQVAIED  143



>ref|XP_003559279.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=403

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 109/133 (82%), Gaps = 3/133 (2%)
 Frame = +1

Query  160  LIKLKIAARQIEKQIPPQP---HWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVL  330
            L+KL++AA +++ QIPPQ    HW F Y MLQKVSRSFA VIQQL  +LR+AVCIFYL+L
Sbjct  10   LVKLRVAAGRVKLQIPPQEEEEHWAFAYDMLQKVSRSFAFVIQQLGPDLRNAVCIFYLLL  69

Query  331  RALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELG  510
            RALDTVEDDTSI TEVK+ IL +FHRH+Y+  WH+ CGT +Y+VLMD+F +VSTAFLEL 
Sbjct  70   RALDTVEDDTSIPTEVKLTILQEFHRHVYNPSWHYSCGTGNYRVLMDKFRYVSTAFLELD  129

Query  511  KNYQEAIEDITMR  549
            +  QEAI++IT R
Sbjct  130  QGCQEAIKEITKR  142



>ref|XP_009769885.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=398

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 102/136 (75%), Gaps = 14/136 (10%)
 Frame = +1

Query  175  IAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA-----------VCIFY  321
            +AA+ IEK+ P QPHW FCYT L+ VS   AL+IQQLP +LR +           VC++Y
Sbjct  2    VAAKLIEKRTPLQPHWAFCYTTLRNVS---ALLIQQLPTDLRTSLSLVNFRPTLQVCVYY  58

Query  322  LVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFL  501
            LV RALDTVEDDTS+A EV+VPIL +F+ H YDREWHF CGT  +KVLMDQFHHVSTAFL
Sbjct  59   LVRRALDTVEDDTSLAIEVRVPILRNFYCHFYDREWHFSCGTNAFKVLMDQFHHVSTAFL  118

Query  502  ELGKNYQEAIEDITMR  549
            E  KNYQE I+DIT R
Sbjct  119  EFDKNYQEVIKDITKR  134



>emb|CDM86349.1| unnamed protein product [Triticum aestivum]
Length=346

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V  L++LK+AA +I +QIPPQ HW F Y MLQ+VSRSFALV+QQL  +LR+A
Sbjct  2    GLLSRPEEVPALLRLKLAAGRIRRQIPPQEHWAFAYHMLQRVSRSFALVVQQLGTDLRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  486
            VCIFYLVLRALD VEDDT+I  +VK+PIL DF+RHIY+ +W F CG   Y+VLMD F  V
Sbjct  62   VCIFYLVLRALDIVEDDTAIPNKVKLPILRDFYRHIYNLDWLFSCGENYYRVLMDNFRQV  121

Query  487  STAFLELGK  513
            S AFLELG+
Sbjct  122  SMAFLELGE  130



>gb|EMT03383.1| Squalene synthetase [Aegilops tauschii]
Length=450

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 115/187 (61%), Gaps = 46/187 (25%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V  L++LK+AA +I +QIPPQ HW F Y MLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVPALLRLKLAAGRIRRQIPPQDHWAFAYDMLQRVSRSFALVIQQLGPDLRNA  61

Query  307  V--------------------------------------CIFYLVLRALDTVEDDTSIAT  372
            V                                      C+FYLVLRALDTVEDDT+I  
Sbjct  62   VSTQFSPFPFPSGSPPIRIPEISETFTAADVALVLTLQVCVFYLVLRALDTVEDDTAIPN  121

Query  373  EVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHVSTAFLELGKN--------YQEA  528
            EVK+PIL DF+RHIY+ +W F CG  DY+VLMD F  VSTAFLELG+         YQ+A
Sbjct  122  EVKLPILRDFYRHIYNPDWLFSCGANDYRVLMDNFRQVSTAFLELGEGHSLSIKCKYQKA  181

Query  529  IEDITMR  549
            IE+IT R
Sbjct  182  IEEITRR  188



>ref|XP_003058046.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57997.1| predicted protein [Micromonas pusilla CCMP1545]
Length=454

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 106/146 (73%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  +LKHP D  PL+++K+ A +  K++P +P+  FCY ML KVSRSFA+VIQQLP 
Sbjct  1    MGALTLLLKHPSDFIPLVRVKMMADK-AKKLPKEPNLAFCYDMLNKVSRSFAIVIQQLPH  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            EL+DAVCIFYLVLRALDT+EDD +I  + K P L  FH+ IYD ++ + CG K YK LMD
Sbjct  60   ELQDAVCIFYLVLRALDTIEDDMAIPEKTKCPELEKFHQKIYDPKYVYPCGEKHYKRLMD  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            ++  V+  FL L K YQ+ I DIT R
Sbjct  120  EYTKVTAVFLSLKKEYQDVIADITKR  145



>ref|XP_005851990.1| hypothetical protein CHLNCDRAFT_18492 [Chlorella variabilis]
 gb|EFN59888.1| hypothetical protein CHLNCDRAFT_18492 [Chlorella variabilis]
Length=261

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 100/146 (68%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HPD++ P+  + +AAR+  KQ+P +P   FCY ML +VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLTHPDELVPMASMFMAARR-AKQLPQEPGLAFCYDMLNRVSRSFAIVIQQLPH  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
             LRDAVC+FYLVLRALDTVEDD  +  +VKVP+L  FH   YDR W   CG+ +Y  LM+
Sbjct  60   GLRDAVCVFYLVLRALDTVEDDMGLDPKVKVPLLRCFHEKSYDRSWKMSCGSGEYVRLME  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
             +  V+  F  L K YQ+ I DI  +
Sbjct  120  NYPLVTDVFQGLDKRYQQVIADICKK  145



>ref|XP_001756673.1| predicted protein [Physcomitrella patens]
 gb|EDQ78627.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +GA+LK+P+D++ L+KLK+A+    + IP  P+  FCY ML++VS SF++VI QL  
Sbjct  1    MGIIGAILKNPEDLHHLLKLKMASAAANRAIPSDPNLAFCYQMLRRVSGSFSIVILQLEP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
             LR+AVC+FYLVLR L  VEDD +I  ++KV +L + H+ I+DR++HF CG  DYK+LMD
Sbjct  61   GLRNAVCVFYLVLRGLQAVEDDLTIPYDLKVELLRNLHKKIFDRDFHFPCGNNDYKLLMD  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +F+ V  AFL L   YQE I +IT R
Sbjct  121  KFYLVILAFLGLTTGYQEVITEITER  146



>ref|XP_005651444.1| farnesyl-diphosphate farnesyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26900.1| farnesyl-diphosphate farnesyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=347

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 99/146 (68%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L  +L+HPD++ PL+++  AA++  K +P      FCY ML +VSRSFA+VIQ+LP 
Sbjct  1    MGKLREVLEHPDELIPLVQMAFAAKR-AKVLPKDKSLAFCYDMLNRVSRSFAVVIQRLPT  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVC+FYLVLRALDTVEDD ++    KVP+L  FH  IYDR W   CG   Y  LM 
Sbjct  60   ELRDAVCLFYLVLRALDTVEDDMAVPVATKVPLLRVFHEKIYDRSWKMSCGYGPYVDLMQ  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            Q+  V+ AFL L   YQ+ I DIT R
Sbjct  120  QYSLVTDAFLRLKPMYQKVIADITRR  145



>ref|XP_001417488.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95781.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=456

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+L HP DV PL+++K+ A    K++P  P   +CY +L KVSRSFA+VIQ+L  
Sbjct  1    MGALRAVLSHPGDVAPLVRVKMMA-NAAKRLPKDPDLAYCYDVLNKVSRSFAIVIQRLDA  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVC+FYLVLRALDTVEDD SI  E KVP L+ FH +IYD  +   CG K YK LM 
Sbjct  60   ELRDAVCVFYLVLRALDTVEDDMSIPIERKVPDLLAFHEYIYDANYSADCGEKHYKDLMK  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
             +  V++ FL L K Y+  I DIT R
Sbjct  120  NYPRVTSVFLGLKKEYRTVIADITKR  145



>ref|XP_007512409.1| squalene synthase [Bathycoccus prasinos]
 emb|CCO17009.1| squalene synthase [Bathycoccus prasinos]
Length=462

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 104/147 (71%), Gaps = 2/147 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG++  +L+HP DV+PL+++K  A +  K++P + +  FCY ML KVSRSFA+VIQQL  
Sbjct  1    MGAISVLLRHPFDVFPLLRVKKMADEA-KKLPKEENLAFCYDMLNKVSRSFAIVIQQLDE  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREW-HFLCGTKDYKVLM  468
            ELRDAVCIFYLVLRALDT+EDD +I    KVP L+ FH  IYD E+ H  CG K YK LM
Sbjct  60   ELRDAVCIFYLVLRALDTIEDDMAIDNAEKVPQLLKFHEDIYDPEYKHLTCGEKHYKTLM  119

Query  469  DQFHHVSTAFLELGKNYQEAIEDITMR  549
             ++  V+  FL L K Y++ I DIT R
Sbjct  120  VEYPKVTNVFLRLKKPYKDVIADITRR  146



>ref|XP_008351286.1| PREDICTED: squalene synthase-like [Malus domestica]
Length=112

 Score =   150 bits (380),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  238  MLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIY  417
            MLQKVSRSF L IQQL  E R+ VC+FYLVLRALDTV+DDTSIAT+VKV IL+ FHRHIY
Sbjct  1    MLQKVSRSFVLAIQQLDTEPRNVVCLFYLVLRALDTVKDDTSIATDVKVTILLAFHRHIY  60

Query  418  DREWHFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEA  528
            D  W+F CGT +YKVLMD+FHHVSTAFLELG+    A
Sbjct  61   DPNWYFTCGTDNYKVLMDEFHHVSTAFLELGEGETRA  97



>ref|XP_011395550.1| Squalene synthase [Auxenochlorella protothecoides]
 gb|KFM22694.1| Squalene synthase [Auxenochlorella protothecoides]
Length=458

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 98/146 (67%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HPD++ P+  + +AAR+    +P  P   FCY+ML KVSRSFA+VIQQLP 
Sbjct  1    MGKLGELLSHPDEIIPMAAMYLAARR-AAVLPHDPDLAFCYSMLNKVSRSFAIVIQQLPE  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            +LRDAVC+FYLVLRALDTVEDD +I    KVPIL+ FH   Y+++W   CG   Y  LM+
Sbjct  60   QLRDAVCVFYLVLRALDTVEDDMAIDQAEKVPILLSFHEKTYEKDWSMKCGHGHYVELME  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            Q+  V  AF  L   YQE I DI  R
Sbjct  120  QYPVVCAAFQGLEPQYQEVITDICRR  145



>ref|XP_002501456.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62714.1| predicted protein [Micromonas sp. RCC299]
Length=455

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  +LKHP D+ PL ++K  A Q  K++P +P+  FCY ML  VSRSFA+VIQQLP 
Sbjct  1    MGALSLILKHPGDILPLYRVKCMADQ-AKKLPKEPNLRFCYHMLNLVSRSFAIVIQQLPH  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            EL+DAVC+FYLVLRALDTVEDD SI  + K   L  F + IYD E+ + CG K YKVLMD
Sbjct  60   ELQDAVCVFYLVLRALDTVEDDMSIPDKPKCAELEIFWKKIYDPEYVYPCGEKHYKVLMD  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            ++  V+  FL L K YQ+ I DIT R
Sbjct  120  EYPKVTAVFLSLKKEYQDVIADITKR  145



>ref|XP_006423443.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36683.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=356

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +1

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMDQFHHV  486
            VCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YKVLMDQFHHV
Sbjct  9    VCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYKVLMDQFHHV  68

Query  487  STAFLELGKNYQEAIEDITMR  549
            STAFLELGK YQ+AIEDIT R
Sbjct  69   STAFLELGKGYQDAIEDITKR  89



>ref|XP_009619298.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=405

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 80/100 (80%), Gaps = 11/100 (11%)
 Frame = +1

Query  250  VSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREW  429
            +SRS AL+           VC+FYLVLRALDTVEDDTSIATEVKVPILI FHRHIYD EW
Sbjct  57   ISRSIALL-----------VCVFYLVLRALDTVEDDTSIATEVKVPILIAFHRHIYDHEW  105

Query  430  HFLCGTKDYKVLMDQFHHVSTAFLELGKNYQEAIEDITMR  549
            HF CGT  YK LMD FHHVSTAFLELGKNYQE IEDITMR
Sbjct  106  HFSCGTNAYKDLMDHFHHVSTAFLELGKNYQEVIEDITMR  145



>ref|XP_003078740.1| FDFT_NICBE Farnesyl-diphosphate farnesyltransferase (ISS), partial 
[Ostreococcus tauri]
Length=210

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+LG +L HP DV  L+++ + A +  K++P   +  +CY +L KVSRSFA+VIQQL  
Sbjct  1    MGALGMILTHPGDVPSLLRVAMMANR-AKRLPRDANLAYCYDVLNKVSRSFAIVIQQLDE  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVC+FYL LRALDTVEDD SI  + K+P L DFH +I+D ++   CG K Y+ LM 
Sbjct  60   ELRDAVCVFYLALRALDTVEDDMSIPIDEKLPQLYDFHEYIFDPKYSTECGEKHYRDLMM  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
             +  V++ FL+L K Y++ I DI  R
Sbjct  120  NYPRVTSVFLKLKKPYRDVIADIARR  145



>ref|XP_002946755.1| hypothetical protein VOLCADRAFT_79344 [Volvox carteri f. nagariensis]
 gb|EFJ51981.1| hypothetical protein VOLCADRAFT_79344 [Volvox carteri f. nagariensis]
Length=447

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 94/146 (64%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HPD+  PL+++  AA Q   ++P  P   FCY +L  VSRSFA+VIQQLP 
Sbjct  1    MGKLGEVLSHPDEFLPLVRMARAA-QKATRLPKDPDLAFCYGILNDVSRSFAIVIQQLPN  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
             LRDA+C+FYLVLR LDTVEDD ++    KVP L  FH  IYDR +   CG K YK LM 
Sbjct  60   PLRDAICVFYLVLRGLDTVEDDMALEVSFKVPQLRSFHERIYDRGFTMACGYKHYKRLMA  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QF  V   FL L   +Q+ I DIT R
Sbjct  120  QFGTVVNVFLSLEPAHQKVIADITRR  145



>ref|XP_001703447.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
 gb|EDP06129.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
Length=378

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HP+++ PL+++  AA++  K +P  P   FCY ML  VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLSHPNEIMPLLRMYRAAKRATK-LPKDPDLAFCYGMLNDVSRSFAIVIQQLPN  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
             LRD++C+FYLVLR LDTVEDD ++  + K+P L  FH  IYDR +   CG   YK LM 
Sbjct  60   PLRDSICVFYLVLRGLDTVEDDMALDVDFKLPELRRFHERIYDRGFTMECGYNHYKRLMA  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            QF  V   FL L   +Q  I DIT R
Sbjct  120  QFGVVVNVFLALPPPHQAVIADITRR  145



>emb|CEF97547.1| Squalene/phytoene synthase, partial [Ostreococcus tauri]
Length=397

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+LG +L HP DV  L+++ + A +  K++P   +  +CY +L KVSRSFA+VIQQL  
Sbjct  1    MGALGMILTHPGDVPSLLRVAMMANRA-KRLPRDANLAYCYDVLNKVSRSFAIVIQQLDE  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            ELRDAVC+FYL LRALDTVEDD SI  + K+P L DFH +I+D ++   CG K Y+ LM 
Sbjct  60   ELRDAVCVFYLALRALDTVEDDMSIPIDEKLPQLYDFHEYIFDPKYSTECGEKHYRDLMM  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
             +  V++ FL+L K Y++ I DI  R
Sbjct  120  NYPRVTSVFLKLKKPYRDVIADIARR  145



>ref|XP_002971951.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
 gb|EFJ26868.1| hypothetical protein SELMODRAFT_96714 [Selaginella moellendorffii]
Length=392

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 100/146 (68%), Gaps = 0/146 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG + A+++HP ++  L+++K+AA +     P  PH  +CY +L  VSRSFA+V+Q L  
Sbjct  1    MGMVEALIRHPGELPALLQMKLAAARAAHAFPADPHMAYCYRILLLVSRSFAVVVQHLNQ  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
            E+RDAVCIFY+VLRALDTVEDD SI  E K  +L +F++H+ D  W F+C    Y VLM 
Sbjct  61   EIRDAVCIFYVVLRALDTVEDDMSIPVETKTTVLEEFYKHLEDPSWRFVCKWNFYIVLMK  120

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
             F+H+S AFL+L K YQ  I DIT R
Sbjct  121  NFNHLSLAFLQLSKEYQCVISDITKR  146



>ref|XP_004986173.1| PREDICTED: squalene synthase-like [Setaria italica]
Length=127

 Score =   139 bits (351),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 87/117 (74%), Gaps = 12/117 (10%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIE-L  297
            +GA L  P++V  L+KL++AA Q+++QIPP+ HW F Y+MLQKVSRSFALVIQQL  E L
Sbjct  1    MGA-LSRPEEVVALVKLRVAAGQLKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGTECL  59

Query  298  RDA----------VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFL  438
            R            VCIFYLVLRALDTVEDDTSI T+VKVPIL +F+RHIYD  W  L
Sbjct  60   RGVSKTAVVAIAQVCIFYLVLRALDTVEDDTSIPTDVKVPILQEFYRHIYDPNWVLL  116



>gb|KIZ04121.1| farnesyl-diphosphatefarnesyltransferase [Monoraphidium neglectum]
Length=493

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 94/146 (64%), Gaps = 1/146 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HP+++ PL K+  A++Q  K +P  P   FCY +L  VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLAHPEEIIPLAKMFYASKQACK-LPLDPKLAFCYDILNTVSRSFAVVIQQLPN  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKVLMD  471
             LRDA+C+FYLVLR LDTVEDD +I  + K+P L+ FH +IY   ++  CG   Y  LM 
Sbjct  60   PLRDAICVFYLVLRGLDTVEDDMAIPNDKKIPDLLKFHEYIYQPGFNMQCGYGHYVRLMR  119

Query  472  QFHHVSTAFLELGKNYQEAIEDITMR  549
            +F  V   FL L   +Q  I DIT R
Sbjct  120  EFGTVVDVFLSLDARFQSVIADITRR  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720