BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006I15

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFK40961.1|  unknown                                                 124   2e-30   Lotus japonicus
ref|XP_009611045.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   3e-30   Nicotiana tomentosiformis
ref|XP_009803786.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    124   3e-30   Nicotiana sylvestris
ref|XP_004512162.1|  PREDICTED: cell number regulator 13-like iso...    124   4e-30   
ref|XP_004512157.1|  PREDICTED: cell number regulator 13-like iso...    124   5e-30   
emb|CAN71842.1|  hypothetical protein VITISV_036262                     123   7e-30   Vitis vinifera
ref|NP_001242304.1|  uncharacterized protein LOC100811369               122   8e-30   
ref|XP_007157885.1|  hypothetical protein PHAVU_002G106200g             123   1e-29   Phaseolus vulgaris [French bean]
ref|XP_004287784.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    122   1e-29   Fragaria vesca subsp. vesca
ref|XP_006572883.1|  PREDICTED: uncharacterized protein LOC100811...    122   1e-29   
dbj|BAK32933.1|  mid1-complementing activity 2                          122   2e-29   Nicotiana tabacum [American tobacco]
ref|XP_003612221.1|  hypothetical protein MTR_5g022670                  122   2e-29   Medicago truncatula
ref|XP_008448524.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    120   6e-29   Cucumis melo [Oriental melon]
ref|XP_004146155.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    120   6e-29   Cucumis sativus [cucumbers]
ref|XP_009363461.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    119   2e-28   
ref|XP_009801746.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    119   2e-28   Nicotiana sylvestris
ref|XP_002272810.2|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    119   2e-28   Vitis vinifera
ref|XP_004232512.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    119   2e-28   Solanum lycopersicum
ref|XP_009624357.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    119   2e-28   Nicotiana tomentosiformis
ref|XP_008352422.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    119   2e-28   Malus domestica [apple tree]
ref|XP_006340771.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    119   3e-28   Solanum tuberosum [potatoes]
ref|XP_004159726.1|  PREDICTED: LOW QUALITY PROTEIN: protein MID1...    118   3e-28   
ref|XP_007156188.1|  hypothetical protein PHAVU_003G265800g             118   5e-28   Phaseolus vulgaris [French bean]
gb|KDO71309.1|  hypothetical protein CISIN_1g014734mg                   118   6e-28   Citrus sinensis [apfelsine]
ref|XP_003519857.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    117   6e-28   
ref|XP_006574663.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    117   7e-28   Glycine max [soybeans]
ref|XP_009408216.1|  PREDICTED: cell number regulator 13-like iso...    117   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006574667.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    117   7e-28   
ref|XP_009408218.1|  PREDICTED: cell number regulator 13-like iso...    117   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002531154.1|  conserved hypothetical protein                     115   8e-28   
gb|KDO71305.1|  hypothetical protein CISIN_1g014734mg                   117   9e-28   Citrus sinensis [apfelsine]
ref|XP_009408217.1|  PREDICTED: cell number regulator 13-like iso...    117   9e-28   
ref|XP_006599316.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    116   9e-28   
gb|KDP23985.1|  hypothetical protein JCGZ_25373                         117   1e-27   Jatropha curcas
ref|XP_003629262.1|  Cornifelin                                         117   1e-27   Medicago truncatula
ref|XP_006425392.1|  hypothetical protein CICLE_v10025703mg             117   1e-27   
ref|XP_006466999.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    117   1e-27   Citrus sinensis [apfelsine]
ref|XP_003548830.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    117   1e-27   Glycine max [soybeans]
gb|KHN35538.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   117   1e-27   Glycine soja [wild soybean]
ref|XP_004509394.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    117   2e-27   Cicer arietinum [garbanzo]
ref|XP_006599313.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    116   2e-27   
tpg|DAA43437.1|  TPA: putative cell number regulator 13                 112   2e-27   
ref|XP_006343349.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    116   2e-27   Solanum tuberosum [potatoes]
gb|KHG25004.1|  mid1-complementing activity 1 -like protein             116   2e-27   Gossypium arboreum [tree cotton]
ref|XP_006297774.1|  hypothetical protein CARUB_v10013809mg             116   3e-27   Capsella rubella
gb|KJB17609.1|  hypothetical protein B456_003G007400                    115   3e-27   Gossypium raimondii
ref|XP_008807147.1|  PREDICTED: cell number regulator 13-like           116   3e-27   Phoenix dactylifera
ref|XP_010029652.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    115   3e-27   Eucalyptus grandis [rose gum]
ref|XP_010029651.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    115   3e-27   Eucalyptus grandis [rose gum]
ref|XP_006383064.1|  hypothetical protein POPTR_0005s11200g             115   4e-27   Populus trichocarpa [western balsam poplar]
gb|KCW56602.1|  hypothetical protein EUGRSUZ_I02323                     115   4e-27   Eucalyptus grandis [rose gum]
gb|KJB17606.1|  hypothetical protein B456_003G007400                    115   4e-27   Gossypium raimondii
ref|XP_011043148.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    115   4e-27   Populus euphratica
ref|XP_008242042.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    115   5e-27   Prunus mume [ume]
ref|XP_008242040.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    115   6e-27   Prunus mume [ume]
ref|XP_007202160.1|  hypothetical protein PRUPE_ppa006351mg             115   6e-27   Prunus persica
ref|XP_010531102.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    115   6e-27   
ref|XP_010933353.1|  PREDICTED: cell number regulator 13-like iso...    114   7e-27   
ref|XP_010933352.1|  PREDICTED: cell number regulator 13-like iso...    115   7e-27   Elaeis guineensis
ref|XP_010467574.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    114   9e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010467573.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    114   9e-27   Camelina sativa [gold-of-pleasure]
emb|CDP01861.1|  unnamed protein product                                114   9e-27   Coffea canephora [robusta coffee]
ref|XP_009418750.1|  PREDICTED: cell number regulator 13-like           114   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001049013.1|  Os03g0157300                                       114   1e-26   
emb|CDY30346.1|  BnaA09g09310D                                          114   1e-26   Brassica napus [oilseed rape]
ref|XP_009386557.1|  PREDICTED: cell number regulator 13-like iso...    114   1e-26   
ref|XP_009386556.1|  PREDICTED: cell number regulator 13-like iso...    114   1e-26   
ref|XP_010413502.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    114   1e-26   Camelina sativa [gold-of-pleasure]
gb|EEE65313.1|  hypothetical protein OsJ_20556                          114   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008665504.1|  PREDICTED: cell number regulator 13-like           111   2e-26   
ref|XP_009379353.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    114   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_009386555.1|  PREDICTED: cell number regulator 13-like iso...    114   2e-26   
emb|CDY26830.1|  BnaC09g09570D                                          113   2e-26   Brassica napus [oilseed rape]
ref|XP_009112457.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    113   2e-26   
ref|XP_009112456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    113   2e-26   Brassica rapa
ref|XP_009112455.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    113   2e-26   Brassica rapa
ref|XP_009386559.1|  PREDICTED: cell number regulator 13-like iso...    113   2e-26   
ref|XP_008393931.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    112   5e-26   
gb|KHN36012.1|  Protein MID1-COMPLEMENTING ACTIVITY 1                   112   5e-26   Glycine soja [wild soybean]
ref|XP_011099884.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    112   5e-26   
ref|XP_010920111.1|  PREDICTED: cell number regulator 13-like           112   6e-26   Elaeis guineensis
gb|EYU36803.1|  hypothetical protein MIMGU_mgv1a011010mg                110   7e-26   Erythranthe guttata [common monkey flower]
gb|ACN26521.1|  unknown                                                 112   7e-26   Zea mays [maize]
ref|NP_001182136.1|  cell number regulator 13                           112   7e-26   Zea mays [maize]
ref|XP_002468480.1|  hypothetical protein SORBIDRAFT_01g046630          112   7e-26   Sorghum bicolor [broomcorn]
ref|XP_006409246.1|  hypothetical protein EUTSA_v10023167mg             111   8e-26   
ref|XP_008809426.1|  PREDICTED: cell number regulator 13-like iso...    112   9e-26   
ref|XP_008809428.1|  PREDICTED: cell number regulator 13-like iso...    111   9e-26   
ref|XP_010935125.1|  PREDICTED: cell number regulator 13-like           111   9e-26   Elaeis guineensis
ref|XP_008809427.1|  PREDICTED: cell number regulator 13-like iso...    111   1e-25   
ref|XP_010489416.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    110   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004985646.1|  PREDICTED: cell number regulator 13-like           111   1e-25   Setaria italica
ref|XP_010113309.1|  hypothetical protein L484_026640                   111   1e-25   
ref|XP_010489415.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_008440857.1|  PREDICTED: cell number regulator 13 isoform X2     110   2e-25   Cucumis melo [Oriental melon]
gb|KGN48940.1|  hypothetical protein Csa_6G507150                       110   2e-25   
ref|XP_010489410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006412042.1|  hypothetical protein EUTSA_v10025310mg             110   3e-25   Eutrema salsugineum [saltwater cress]
dbj|BAH20129.1|  AT4G35920                                              110   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195317.2|  protein MID1-complementing activity 1                 110   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004135021.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    110   3e-25   Cucumis sativus [cucumbers]
gb|KJB43289.1|  hypothetical protein B456_007G192000                    110   3e-25   Gossypium raimondii
ref|XP_010446852.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    110   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002867046.1|  hypothetical protein ARALYDRAFT_491044             110   3e-25   
ref|XP_009138395.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    110   3e-25   Brassica rapa
ref|XP_008440854.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    110   3e-25   
emb|CAA18486.1|  putative protein                                       110   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM51833.1|AC105730_7  Unknown protein                               113   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAK32909.1|AF367322_1  AT4g35920/F4B14_190                           110   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432209.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    110   4e-25   Camelina sativa [gold-of-pleasure]
emb|CDX75539.1|  BnaA01g01630D                                          110   4e-25   
emb|CDX69186.1|  BnaC01g02670D                                          110   4e-25   
gb|EYU17580.1|  hypothetical protein MIMGU_mgv1a007522mg                109   4e-25   Erythranthe guttata [common monkey flower]
ref|XP_010266008.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    110   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006282626.1|  hypothetical protein CARUB_v10004901mg             109   4e-25   Capsella rubella
gb|ABR16594.1|  unknown                                                 109   4e-25   Picea sitchensis
ref|XP_011083456.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    109   5e-25   Sesamum indicum [beniseed]
ref|XP_011074700.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    109   5e-25   Sesamum indicum [beniseed]
ref|XP_006846924.1|  hypothetical protein AMTR_s00152p00084120          108   9e-25   Amborella trichopoda
emb|CDY47043.1|  BnaAnng08310D                                          108   9e-25   Brassica napus [oilseed rape]
ref|XP_008806598.1|  PREDICTED: cell number regulator 13-like iso...    108   1e-24   
emb|CDX72565.1|  BnaC07g45870D                                          108   1e-24   
ref|XP_008806599.1|  PREDICTED: cell number regulator 13-like iso...    108   1e-24   
ref|XP_010526810.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    108   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_009148721.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    107   2e-24   Brassica rapa
gb|KHG10652.1|  mid1-complementing activity 1 -like protein             106   4e-24   Gossypium arboreum [tree cotton]
gb|EPS70744.1|  mid1-complementing activity 2                           106   5e-24   Genlisea aurea
ref|XP_007046628.1|  PLAC8 family protein                               106   9e-24   
ref|XP_006649427.1|  PREDICTED: cell number regulator 13-like           105   1e-23   Oryza brachyantha
ref|XP_010266845.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    105   1e-23   Nelumbo nucifera [Indian lotus]
pir||T08859  hypothetical protein A_TM017A05.4 - Arabidopsis thal...    103   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|EMT07324.1|  hypothetical protein F775_31025                         104   3e-23   
ref|NP_001031368.1|  protein MID1-complementing activity 2              103   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031366.1|  protein MID1-complementing activity 2              103   9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179369.2|  protein MID1-complementing activity 2                 103   9e-23   Arabidopsis thaliana [mouse-ear cress]
pir||D84556  hypothetical protein At2g17780 [imported] - Arabidop...    103   9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031367.1|  protein MID1-complementing activity 2              103   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886128.1|  hypothetical protein ARALYDRAFT_480672             103   1e-22   
ref|XP_003558777.1|  PREDICTED: cell number regulator 13                102   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_010680410.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    102   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010680412.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...    102   2e-22   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU30814.1|  hypothetical protein MIMGU_mgv1a007258mg              99.0    3e-21   Erythranthe guttata [common monkey flower]
ref|XP_001767697.1|  predicted protein                                92.8    1e-20   
ref|XP_010692506.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  96.3    3e-20   
ref|XP_001768983.1|  predicted protein                                94.4    1e-19   
ref|XP_009389172.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  93.2    3e-19   
ref|XP_009389171.1|  PREDICTED: protein kinase 2A, chloroplastic-...  92.4    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001769010.1|  predicted protein                                89.4    3e-18   
ref|XP_002978386.1|  hypothetical protein SELMODRAFT_418221           79.0    4e-14   
ref|NP_001068428.2|  Os11g0670100                                     76.6    7e-14   
gb|EAZ08702.1|  hypothetical protein OsI_30969                        76.3    8e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002970226.1|  hypothetical protein SELMODRAFT_93428            78.2    8e-14   
gb|EEE57693.1|  hypothetical protein OsJ_08164                        79.7    1e-13   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95227.1|  retrotransposon protein, putative, unclassified       79.7    1e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80653.1|  hypothetical protein OsI_23047                        75.5    2e-13   Oryza sativa Indica Group [Indian rice]
gb|EEC72317.1|  hypothetical protein OsI_05510                        76.6    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_002437501.1|  hypothetical protein SORBIDRAFT_10g028240        71.2    3e-11   
ref|XP_001785848.1|  predicted protein                                70.1    6e-11   
ref|XP_002520777.1|  conserved hypothetical protein                   69.7    8e-11   
ref|XP_002446043.1|  hypothetical protein SORBIDRAFT_06g000900        64.7    5e-10   
gb|KDP44714.1|  hypothetical protein JCGZ_01214                       65.9    1e-09   Jatropha curcas
ref|XP_008676749.1|  PREDICTED: uncharacterized protein LOC100272...  65.1    3e-09   
ref|XP_008676748.1|  PREDICTED: uncharacterized protein LOC100272...  65.1    3e-09   Zea mays [maize]
ref|XP_010237406.1|  PREDICTED: cell number regulator 13-like         62.8    3e-09   Brachypodium distachyon [annual false brome]
ref|XP_011035883.1|  PREDICTED: cell number regulator 13-like         64.7    4e-09   Populus euphratica
ref|XP_004962550.1|  PREDICTED: proline-rich receptor-like protei...  65.1    4e-09   Setaria italica
ref|XP_010658233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.7    4e-09   Vitis vinifera
ref|XP_004962548.1|  PREDICTED: proline-rich receptor-like protei...  65.1    4e-09   Setaria italica
ref|XP_010658232.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.7    4e-09   Vitis vinifera
ref|XP_010658234.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.7    4e-09   
ref|XP_010658231.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.7    5e-09   Vitis vinifera
ref|XP_006356472.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  64.3    5e-09   Solanum tuberosum [potatoes]
ref|XP_002438909.1|  hypothetical protein SORBIDRAFT_10g028036        60.8    1e-08   
ref|XP_004977713.1|  PREDICTED: probable receptor-like protein ki...  63.5    1e-08   
gb|KDO68875.1|  hypothetical protein CISIN_1g020555mg                 62.8    1e-08   Citrus sinensis [apfelsine]
ref|XP_010318233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.4    2e-08   
ref|XP_004235233.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  62.4    2e-08   Solanum lycopersicum
ref|XP_004979928.1|  PREDICTED: G-type lectin S-receptor-like ser...  62.4    2e-08   
ref|XP_004962551.1|  PREDICTED: proline-rich receptor-like protei...  62.0    3e-08   Setaria italica
ref|XP_009369272.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  58.9    4e-08   
ref|XP_004986952.1|  PREDICTED: G-type lectin S-receptor-like ser...  61.6    4e-08   Setaria italica
ref|XP_002316192.2|  hypothetical protein POPTR_0010s19210g           61.2    5e-08   
ref|NP_001146395.1|  uncharacterized protein LOC100279975             59.3    6e-08   Zea mays [maize]
ref|XP_006486524.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  60.8    6e-08   
ref|XP_008648918.1|  PREDICTED: putative cysteine-rich receptor-l...  61.2    8e-08   Zea mays [maize]
ref|XP_008648917.1|  PREDICTED: putative cysteine-rich receptor-l...  61.2    8e-08   Zea mays [maize]
ref|XP_008648920.1|  PREDICTED: putative cysteine-rich receptor-l...  60.8    8e-08   Zea mays [maize]
ref|XP_008648919.1|  PREDICTED: putative cysteine-rich receptor-l...  60.8    8e-08   Zea mays [maize]
ref|XP_006435802.1|  hypothetical protein CICLE_v10031760mg           60.5    9e-08   
ref|NP_001058414.2|  Os06g0689600                                     57.8    1e-07   
gb|ADE76255.1|  unknown                                               58.9    1e-07   Picea sitchensis
gb|EMS60707.1|  Receptor-like serine/threonine-protein kinase SD1-8   60.5    1e-07   Triticum urartu
gb|EEC81215.1|  hypothetical protein OsI_24255                        60.1    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010087526.1|  hypothetical protein L484_006931                 59.7    2e-07   Morus notabilis
ref|XP_004966167.1|  PREDICTED: cysteine-rich receptor-like prote...  59.7    2e-07   Setaria italica
ref|XP_008363765.1|  PREDICTED: LOW QUALITY PROTEIN: protein MID1...  59.3    2e-07   
dbj|BAD45624.1|  receptor protein kinase-like                         59.3    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010227385.1|  PREDICTED: putative cysteine-rich receptor-l...  59.3    3e-07   Brachypodium distachyon [annual false brome]
gb|ABA98611.1|  Protein kinase domain containing protein              59.3    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010227386.1|  PREDICTED: putative cysteine-rich receptor-l...  59.3    3e-07   
dbj|BAD54275.1|  hypothetical protein                                 56.2    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95138.1|  Protein kinase domain containing protein              59.3    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001142910.1|  uncharacterized protein LOC100275341             57.4    3e-07   
ref|XP_004979962.1|  PREDICTED: cysteine-rich receptor-like prote...  58.9    4e-07   
gb|EEE52535.1|  hypothetical protein OsJ_34758                        58.2    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002439055.1|  hypothetical protein SORBIDRAFT_10g030680        58.5    4e-07   
ref|XP_004979961.1|  PREDICTED: cysteine-rich receptor-like prote...  58.5    5e-07   
dbj|BAJ90976.1|  predicted protein                                    58.5    5e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97098.1|  predicted protein                                    58.5    5e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA95204.1|  hypothetical protein LOC_Os11g44520                   58.2    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449963.1|  hypothetical protein SORBIDRAFT_05g026280        56.6    5e-07   Sorghum bicolor [broomcorn]
ref|XP_004966168.1|  PREDICTED: putative cysteine-rich receptor-l...  58.2    7e-07   Setaria italica
ref|XP_004979929.1|  PREDICTED: cell number regulator 13-like         56.2    7e-07   Setaria italica
gb|EEE52534.1|  hypothetical protein OsJ_34757                        53.9    9e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81213.1|  hypothetical protein OsI_24251                        57.4    1e-06   Oryza sativa Indica Group [Indian rice]
gb|EMT22570.1|  Putative serine/threonine-protein kinase-like pro...  57.4    1e-06   
ref|XP_006663098.1|  PREDICTED: putative serine/threonine-protein...  57.4    1e-06   
gb|EAY99718.1|  hypothetical protein OsI_21701                        57.4    1e-06   Oryza sativa Indica Group [Indian rice]
dbj|BAJ88144.1|  predicted protein                                    57.4    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001056829.1|  Os06g0151700                                     57.4    1e-06   
dbj|BAD45621.1|  receptor protein kinase-like                         57.4    1e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CDP13977.1|  unnamed protein product                              57.0    1e-06   Coffea canephora [robusta coffee]
dbj|BAJ94356.1|  predicted protein                                    56.6    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT23150.1|  hypothetical protein F775_17508                       54.3    2e-06   
ref|XP_004979334.1|  PREDICTED: putative serine/threonine-protein...  56.2    3e-06   Setaria italica
gb|EMS46805.1|  Putative serine/threonine-protein kinase-like pro...  56.6    3e-06   Triticum urartu
gb|ADB85257.1|  putative retrotransposon protein                      56.6    3e-06   Phyllostachys edulis [kikko-chiku]
ref|XP_007008883.1|  PLAC8 family protein                             55.5    4e-06   
gb|ABA95208.1|  Protein kinase domain containing protein, expressed   56.2    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EMT11112.1|  Putative serine/threonine-protein kinase-like pro...  55.5    4e-06   
gb|EMT06234.1|  hypothetical protein F775_14004                       53.5    5e-06   
ref|NP_001066816.1|  Os12g0499200                                     55.1    5e-06   
gb|EAY92100.1|  hypothetical protein OsI_13806                        55.1    7e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_004984958.1|  PREDICTED: putative serine/threonine-protein...  55.1    7e-06   Setaria italica
gb|EEC76280.1|  hypothetical protein OsI_13781                        55.1    7e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001068421.1|  Os11g0666200                                     54.7    8e-06   
gb|EMT18704.1|  Putative serine/threonine-protein kinase-like pro...  54.7    9e-06   
ref|XP_006575552.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  54.3    1e-05   Glycine max [soybeans]
gb|EEE52537.1|  hypothetical protein OsJ_34760                        52.8    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003518431.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  53.9    2e-05   Glycine max [soybeans]
dbj|BAJ94547.1|  predicted protein                                    53.5    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA95276.1|  Protein kinase domain containing protein, expressed   53.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68569.1|  hypothetical protein OsI_36900                        53.1    2e-05   Oryza sativa Indica Group [Indian rice]
gb|EEE52504.1|  hypothetical protein OsJ_34707                        53.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71170.1|  hypothetical protein OsI_03036                        51.2    3e-05   Oryza sativa Indica Group [Indian rice]
gb|EEC72318.1|  hypothetical protein OsI_05511                        52.8    4e-05   Oryza sativa Indica Group [Indian rice]
gb|EAY92077.1|  hypothetical protein OsI_13782                        52.4    5e-05   Oryza sativa Indica Group [Indian rice]
gb|EMS49964.1|  hypothetical protein TRIUR3_26988                     50.4    5e-05   Triticum urartu
ref|NP_001068433.1|  Os11g0672300                                     51.6    5e-05   
dbj|BAK02708.1|  predicted protein                                    50.4    6e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003577260.1|  PREDICTED: putative serine/threonine-protein...  52.0    6e-05   Brachypodium distachyon [annual false brome]
gb|EEC68589.1|  hypothetical protein OsI_36937                        51.6    1e-04   Oryza sativa Indica Group [Indian rice]
dbj|BAD05279.1|  receptor kinase-like                                 49.7    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010239007.1|  PREDICTED: uncharacterized protein LOC100829732  50.8    2e-04   
ref|XP_008234071.1|  PREDICTED: protein MID1-COMPLEMENTING ACTIVI...  50.4    2e-04   
ref|XP_007219349.1|  hypothetical protein PRUPE_ppa019431mg           50.4    2e-04   
ref|XP_006657274.1|  PREDICTED: putative cysteine-rich receptor-l...  50.4    2e-04   
gb|EAZ42543.1|  hypothetical protein OsJ_27109                        50.4    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95159.1|  hypothetical protein LOC_Os11g44460                   47.8    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ36550.1|  hypothetical protein OsJ_20890                        46.6    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMT22573.1|  Putative serine/threonine-protein kinase-like pro...  50.1    4e-04   
ref|XP_010236930.1|  PREDICTED: cell number regulator 13-like         48.1    6e-04   
ref|XP_002442644.1|  hypothetical protein SORBIDRAFT_08g000420        48.9    7e-04   Sorghum bicolor [broomcorn]



>gb|AFK40961.1| unknown [Lotus japonicus]
Length=386

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+++GD AN+AQLTG+DA+KLIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDHMGDFANIAQLTGVDAVKLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_009611045.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009611046.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE+ G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEHFGEIANVAQLTGIDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>ref|XP_009803786.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009803787.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE+ G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEHFGEIANVAQLTGIDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>ref|XP_004512162.1| PREDICTED: cell number regulator 13-like isoform X6 [Cicer arietinum]
Length=387

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWEN+GD ANVAQLTG+DA+KLI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWENMGDFANVAQLTGVDAVKLIAMIAKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_004512157.1| PREDICTED: cell number regulator 13-like isoform X1 [Cicer arietinum]
 ref|XP_004512158.1| PREDICTED: cell number regulator 13-like isoform X2 [Cicer arietinum]
 ref|XP_004512159.1| PREDICTED: cell number regulator 13-like isoform X3 [Cicer arietinum]
 ref|XP_004512160.1| PREDICTED: cell number regulator 13-like isoform X4 [Cicer arietinum]
 ref|XP_004512161.1| PREDICTED: cell number regulator 13-like isoform X5 [Cicer arietinum]
Length=417

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWEN+GD ANVAQLTG+DA+KLI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWENMGDFANVAQLTGVDAVKLIAMIAKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>emb|CAN71842.1| hypothetical protein VITISV_036262 [Vitis vinifera]
Length=425

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +3

Query  339  GVKMASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLE  518
            G+KMA+WE+ G++ANVAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLE
Sbjct  95   GLKMATWEHFGEIANVAQLTGVDAVRLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLE  154

Query  519  QLKITELK  542
            QLKI+ELK
Sbjct  155  QLKISELK  162



>ref|NP_001242304.1| uncharacterized protein LOC100811369 [Glycine max]
 gb|ACU17641.1| unknown [Glycine max]
Length=372

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+ +G+LANVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDQMGELANVAQLTGVDAVRLIGMIVRAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_007157885.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157886.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157887.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 ref|XP_007157888.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29879.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29880.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29881.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
 gb|ESW29882.1| hypothetical protein PHAVU_002G106200g [Phaseolus vulgaris]
Length=416

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+ +G+LANVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDQMGELANVAQLTGVDAVRLIGMIVRAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_004287784.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW++ GD+ANVAQLTG+DA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDHFGDIANVAQLTGLDAVKLIGMIVKAAATARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_006572883.1| PREDICTED: uncharacterized protein LOC100811369 isoform X1 [Glycine 
max]
Length=415

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+ +G+LANVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDQMGELANVAQLTGVDAVRLIGMIVRAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>dbj|BAK32933.1| mid1-complementing activity 2 [Nicotiana tabacum]
Length=419

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE+ G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIG+LLEQLK
Sbjct  1    MASWEHFGEIANVAQLTGIDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGSLLEQLK  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>ref|XP_003612221.1| hypothetical protein MTR_5g022670 [Medicago truncatula]
 gb|AES95179.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=416

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+++GD AN+AQLTG+DA+KLIGMIVKAASTA+MHKKNCRQFA HLKLIGNLLEQLK
Sbjct  1    MASWDHMGDFANIAQLTGVDAVKLIGMIVKAASTARMHKKNCRQFAMHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_008448524.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Cucumis melo]
Length=418

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M+SWE LG++ANVAQLTGIDA++LI MIVK+ASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MSSWETLGEIANVAQLTGIDAVRLISMIVKSASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_004146155.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
 gb|KGN55644.1| hypothetical protein Csa_3G002640 [Cucumis sativus]
Length=418

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M+SWE LG++ANVAQLTGIDA++LI MIVK+ASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MSSWETLGEIANVAQLTGIDAVRLISMIVKSASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_009363461.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Pyrus x bretschneideri]
Length=415

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 65/65 (100%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW++LG++ANVAQLTG+DA++LIG+IVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDHLGEIANVAQLTGLDAVRLIGLIVKAANTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_009801746.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
 ref|XP_009801747.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
sylvestris]
Length=419

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+ G++AN AQL G+DA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHFGEVANFAQLAGLDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>ref|XP_002272810.2| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Vitis vinifera]
Length=420

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+ G++ANVAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHFGEIANVAQLTGVDAVRLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_004232512.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
 ref|XP_010316435.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Solanum lycopersicum]
Length=418

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MAS ++ GD+AN+AQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASLDHFGDIANIAQLTGIDAVRLIGMIVKAAATARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>ref|XP_009624357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009624358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nicotiana 
tomentosiformis]
 dbj|BAK32932.1| mid1-complementing activity 1 [Nicotiana tabacum]
Length=419

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+ G++AN AQL G+DA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHFGEVANFAQLAGLDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>ref|XP_008352422.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
 ref|XP_008352423.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Malus 
domestica]
Length=415

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 64/65 (98%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+ LG++ANVAQLTG+DA++LIG+IVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWDQLGEIANVAQLTGLDAVRLIGLIVKAANTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_006340771.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006340772.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
Length=418

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MAS ++ GD+AN+AQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASLDHFGDVANIAQLTGIDAVRLIGMIVKAAATARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>ref|XP_004159726.1| PREDICTED: LOW QUALITY PROTEIN: protein MID1-COMPLEMENTING ACTIVITY 
1-like [Cucumis sativus]
Length=418

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M+SWE LG++ANVAQLTGIDA++LI MIVK+ASTA+MH KNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MSSWETLGEIANVAQLTGIDAVRLISMIVKSASTARMHXKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_007156188.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 ref|XP_007156189.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28182.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
 gb|ESW28183.1| hypothetical protein PHAVU_003G265800g [Phaseolus vulgaris]
Length=415

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE  G++ANVAQLTGIDA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>gb|KDO71309.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=409

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+ G++ANVAQL G DA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_003519857.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
 gb|KHN00454.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=416

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE  G++ANVAQLTGIDA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  4    SSWEYFGEIANVAQLTGIDAVKLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  63

Query  531  TELK  542
            +ELK
Sbjct  64   SELK  67



>ref|XP_006574663.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006574664.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006574665.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
 ref|XP_006574666.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=418

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE  G++ANVAQLTGIDA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  4    SSWEYFGEIANVAQLTGIDAVKLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  63

Query  531  TELK  542
            +ELK
Sbjct  64   SELK  67



>ref|XP_009408216.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=415

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE LG+LA VAQLTG+DA++LIG+IV+AA+TA+MH+KNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEQLGELATVAQLTGVDAVRLIGLIVQAATTARMHRKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_006574667.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X6 [Glycine max]
 ref|XP_006574668.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X7 [Glycine max]
Length=378

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE  G++ANVAQLTGIDA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  4    SSWEYFGEIANVAQLTGIDAVKLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  63

Query  531  TELK  542
            +ELK
Sbjct  64   SELK  67



>ref|XP_009408218.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE LG+LA VAQLTG+DA++LIG+IV+AA+TA+MH+KNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEQLGELATVAQLTGVDAVRLIGLIVQAATTARMHRKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_002531154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31239.1| conserved hypothetical protein [Ricinus communis]
Length=283

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M+SW++ G++ANVAQLTG+DA++LIGMI KAASTA+MHKKNC+QFAQHLKLIGNLLEQLK
Sbjct  1    MSSWDHFGEIANVAQLTGLDAVRLIGMIGKAASTARMHKKNCKQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>gb|KDO71305.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71306.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71307.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
 gb|KDO71308.1| hypothetical protein CISIN_1g014734mg [Citrus sinensis]
Length=419

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+ G++ANVAQL G DA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGMIVKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_009408217.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE LG+LA VAQLTG+DA++LIG+IV+AA+TA+MH+KNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEQLGELATVAQLTGVDAVRLIGLIVQAATTARMHRKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_006599316.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X5 [Glycine max]
Length=335

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE  G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>gb|KDP23985.1| hypothetical protein JCGZ_25373 [Jatropha curcas]
Length=415

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+NLG+LA VAQLTG+DA++LI MI KAA+TA+MHKKNC+QFAQHLKLIGNLLEQLK
Sbjct  1    MASWDNLGELATVAQLTGVDAVRLIAMIAKAATTARMHKKNCKQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_003629262.1| Cornifelin [Medicago truncatula]
 gb|AET03738.1| MID1-complementing activity-like protein [Medicago truncatula]
Length=424

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE  G++ANVAQLTG+DA+KLIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEQFGEIANVAQLTGLDAVKLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_006425392.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425393.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425394.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425395.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 ref|XP_006425396.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38632.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38633.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38634.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38635.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
 gb|ESR38636.1| hypothetical protein CICLE_v10025703mg [Citrus clementina]
Length=419

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+ G++ANVAQL G DA++LIG+IVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGLIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_006466999.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467000.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Citrus sinensis]
Length=419

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+ G++ANVAQL G DA++LIG+IVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MANWEHFGEIANVAQLAGFDAVRLIGLIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_003548830.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
Length=415

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE  G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>gb|KHN35538.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=415

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE  G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_004509394.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004509396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Cicer arietinum]
Length=424

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE+ G++ANVAQLTG+DA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEHFGEIANVAQLTGLDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_006599313.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
 ref|XP_006599314.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Glycine max]
 ref|XP_006599315.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Glycine max]
Length=432

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE  G++ANVAQLTGIDA++LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLL+QLKI
Sbjct  3    SSWEYFGEIANVAQLTGIDAVRLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLDQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>tpg|DAA43437.1| TPA: putative cell number regulator 13 [Zea mays]
Length=163

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  528  ITELK  542
            ++EL+
Sbjct  61   VSELR  65



>ref|XP_006343349.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343350.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006343351.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Solanum tuberosum]
Length=419

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+ G++AN AQL G+DA+KLIG+IVKAASTA+MHKKNCRQFAQHLKLIGNLLEQL+
Sbjct  1    MATWEHFGEIANGAQLAGLDAVKLIGLIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLR  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>gb|KHG25004.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=418

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE+ G++ANVAQL G DA++LI MIVKAASTA+MHKK+CRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEHFGEIANVAQLAGFDAVRLIAMIVKAASTARMHKKSCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_006297774.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
 gb|EOA30672.1| hypothetical protein CARUB_v10013809mg [Capsella rubella]
Length=417

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SWE LGD A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  4    SWEQLGDFASVAQLTGVDAVKLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLRIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>gb|KJB17609.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=378

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE+ G++ANVAQL G DA++LI MIVKAASTA+MHKK+CRQFAQHLKLIGNLLEQL+
Sbjct  1    MASWEHFGEIANVAQLAGFDAVRLIAMIVKAASTARMHKKSCRQFAQHLKLIGNLLEQLR  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_008807147.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
 ref|XP_008807148.1| PREDICTED: cell number regulator 13-like [Phoenix dactylifera]
Length=421

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SW+ LG+++NVAQLTG+DA++LIGMIVKAASTA+MHKKNCR FAQHLKLIGNLLEQLKI
Sbjct  3    SSWDQLGEISNVAQLTGLDAVRLIGMIVKAASTARMHKKNCRHFAQHLKLIGNLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_010029652.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Eucalyptus grandis]
Length=417

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE  G++ANVAQLTG+DA +LIGMIV+AA+TA+MHK+NCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEAFGEVANVAQLTGLDATRLIGMIVQAANTARMHKRNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_010029651.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Eucalyptus grandis]
Length=418

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE  G++ANVAQLTG+DA +LIGMIV+AA+TA+MHK+NCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEAFGEVANVAQLTGLDATRLIGMIVQAANTARMHKRNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_006383064.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
 gb|ERP60861.1| hypothetical protein POPTR_0005s11200g [Populus trichocarpa]
Length=419

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+LG++ANV QLTGIDA++LI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHLGEVANVVQLTGIDAVRLIAMIGKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>gb|KCW56602.1| hypothetical protein EUGRSUZ_I02323 [Eucalyptus grandis]
Length=472

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE  G++ANVAQLTG+DA +LIGMIV+AA+TA+MHK+NCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEAFGEVANVAQLTGLDATRLIGMIVQAANTARMHKRNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>gb|KJB17606.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17607.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
 gb|KJB17608.1| hypothetical protein B456_003G007400 [Gossypium raimondii]
Length=418

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE+ G++ANVAQL G DA++LI MIVKAASTA+MHKK+CRQFAQHLKLIGNLLEQL+
Sbjct  1    MASWEHFGEIANVAQLAGFDAVRLIAMIVKAASTARMHKKSCRQFAQHLKLIGNLLEQLR  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_011043148.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
 ref|XP_011043149.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Populus euphratica]
Length=419

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE+LG++ANV QLTGIDA++LI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MATWEHLGEVANVVQLTGIDAVRLIAMIGKAATTARMHKKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_008242042.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Prunus 
mume]
Length=385

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SW++ G++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFA HLKLIGNLLEQLKI
Sbjct  3    SSWDHFGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRQFALHLKLIGNLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_008242040.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
 ref|XP_008242041.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Prunus 
mume]
Length=416

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SW++ G++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFA HLKLIGNLLEQLKI
Sbjct  3    SSWDHFGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRQFALHLKLIGNLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_007202160.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
 gb|EMJ03359.1| hypothetical protein PRUPE_ppa006351mg [Prunus persica]
Length=416

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SW++ G++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFA HLKLIGNLLEQLKI
Sbjct  3    SSWDHFGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRQFALHLKLIGNLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_010531102.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531103.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531104.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531105.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010531106.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=416

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW++LGD+A+VAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDHLGDIASVAQLTGLDAVRLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            ELK
Sbjct  64   ELK  66



>ref|XP_010933353.1| PREDICTED: cell number regulator 13-like isoform X2 [Elaeis guineensis]
Length=402

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SW+ LG++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCR FAQHLKLIGNLLEQL+I
Sbjct  3    SSWDQLGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRLFAQHLKLIGNLLEQLRI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_010933352.1| PREDICTED: cell number regulator 13-like isoform X1 [Elaeis guineensis]
Length=421

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SW+ LG++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCR FAQHLKLIGNLLEQL+I
Sbjct  3    SSWDQLGEIANVAQLTGLDAVRLIGMIVKAASTARMHKKNCRLFAQHLKLIGNLLEQLRI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_010467574.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SWE LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWEQLGEIASVAQLTGVDAVKLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  534  ELK  542
            E+K
Sbjct  62   EMK  64



>ref|XP_010467573.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=420

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SWE LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWEQLGEIASVAQLTGVDAVKLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  534  ELK  542
            E+K
Sbjct  62   EMK  64



>emb|CDP01861.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M++WE+ G++ANVAQLTG+DA++LIGMIV+AA+TA++HKKNCRQFA HLKLIGNLLEQLK
Sbjct  1    MSTWEHFGEIANVAQLTGVDAVRLIGMIVQAANTARLHKKNCRQFAMHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_009418750.1| PREDICTED: cell number regulator 13-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE LG+L+ VAQLTG+DA +LIG+IV+AA+TA+MH+KNCRQFAQHLKLIGNLLEQLK
Sbjct  1    MASWEQLGELSTVAQLTGLDAGRLIGLIVQAATTARMHRKNCRQFAQHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|NP_001049013.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|ABF94063.1| Protein of unknown function, DUF614 containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10927.1| Os03g0157300 [Oryza sativa Japonica Group]
 gb|EEC74547.1| hypothetical protein OsI_10083 [Oryza sativa Indica Group]
 dbj|BAJ40168.1| mid1-complementing activity 1 [Oryza sativa Japonica Group]
Length=418

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWENLGD+A V QLTG+DA++LI MIVKAASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWENLGDVATVVQLTGLDAVRLISMIVKAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  528  ITELK  542
            ++ELK
Sbjct  61   VSELK  65



>emb|CDY30346.1| BnaA09g09310D [Brassica napus]
Length=389

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDALKLIGMIVTAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_009386557.1| PREDICTED: cell number regulator 13-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE +GD+ANV QLTG+DA++LIGMIVKAAS A+MHKKNCR+FAQHLKLIG+LLEQLKI
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHKKNCRRFAQHLKLIGSLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_009386556.1| PREDICTED: cell number regulator 13-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE +GD+ANV QLTG+DA++LIGMIVKAAS A+MHKKNCR+FAQHLKLIG+LLEQLKI
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHKKNCRRFAQHLKLIGSLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_010413502.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413510.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
 ref|XP_010413517.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like [Camelina 
sativa]
Length=419

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  61

Query  534  ELK  542
            E+K
Sbjct  62   EMK  64



>gb|EEE65313.1| hypothetical protein OsJ_20556 [Oryza sativa Japonica Group]
Length=458

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWENLGD+A V QLTG+DA++LI MIVKAASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWENLGDVATVVQLTGLDAVRLISMIVKAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  528  ITELK  542
            ++ELK
Sbjct  61   VSELK  65



>ref|XP_008665504.1| PREDICTED: cell number regulator 13-like [Zea mays]
 ref|XP_008665505.1| PREDICTED: cell number regulator 13-like [Zea mays]
Length=224

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  528  ITELK  542
            ++EL+
Sbjct  61   VSELR  65



>ref|XP_009379353.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379354.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379355.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379356.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379357.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379358.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009379359.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
Length=412

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +3

Query  363  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            + G+LANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLKI+ELK
Sbjct  3    SFGELANVAQLTGVDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLKISELK  62



>ref|XP_009386555.1| PREDICTED: cell number regulator 13-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE +GD+ANV QLTG+DA++LIGMIVKAAS A+MHKKNCR+FAQHLKLIG+LLEQLKI
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHKKNCRRFAQHLKLIGSLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>emb|CDY26830.1| BnaC09g09570D [Brassica napus]
Length=391

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVTAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_009112457.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Brassica rapa]
Length=376

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVAAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_009112456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Brassica rapa]
Length=388

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVAAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_009112455.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Brassica rapa]
Length=389

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDQLGEIASVAQLTGVDAVKLIGMIVAAANTARMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_009386559.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386560.1| PREDICTED: cell number regulator 13-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE +GD+ANV QLTG+DA++LIGMIVKAAS A+MHKKNCR+FAQHLKLIG+LLEQLKI
Sbjct  3    SSWEYMGDMANVVQLTGLDAVRLIGMIVKAASVARMHKKNCRRFAQHLKLIGSLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_008393931.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393938.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393943.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393951.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
 ref|XP_008393959.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Malus domestica]
Length=408

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +3

Query  363  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            + G++ANVAQLTG+DA++LIGMIVKAASTA+MHKKNCRQFAQHLKLIGNLLEQLKI+ELK
Sbjct  3    SFGEMANVAQLTGVDAVRLIGMIVKAASTARMHKKNCRQFAQHLKLIGNLLEQLKISELK  62



>gb|KHN36012.1| Protein MID1-COMPLEMENTING ACTIVITY 1 [Glycine soja]
Length=409

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            +G+LANVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFAQHLKLIGNLLEQLKI+ELK
Sbjct  1    MGELANVAQLTGVDAVRLIGMIVRAASTARMHKKNCRQFAQHLKLIGNLLEQLKISELK  59



>ref|XP_011099884.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099885.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099886.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
 ref|XP_011099887.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Sesamum indicum]
Length=416

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M++WE+ G++ANVAQL G+DA  LIGMIVKAA+TA+MHKKNCRQFAQHLKLIGNLLE L+
Sbjct  1    MSTWEHFGEIANVAQLAGVDAASLIGMIVKAANTARMHKKNCRQFAQHLKLIGNLLESLR  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_010920111.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010920112.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=414

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SW+ +G+++NVAQLTG+DA++LIGMIVKAASTA+MHK+NCR FA+HLKLIGNLLEQLKI
Sbjct  3    SSWDQMGEISNVAQLTGLDAVRLIGMIVKAASTARMHKRNCRHFAKHLKLIGNLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>gb|EYU36803.1| hypothetical protein MIMGU_mgv1a011010mg [Erythranthe guttata]
Length=295

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M SWE  G++ANV QL+G++A+ LIG+IVKAASTA+MHK+NCRQFAQH+K+IGNLLEQLK
Sbjct  1    MGSWEQFGEIANVVQLSGLNAISLIGLIVKAASTARMHKQNCRQFAQHVKMIGNLLEQLK  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>gb|ACN26521.1| unknown [Zea mays]
 tpg|DAA43436.1| TPA: putative cell number regulator 13 [Zea mays]
Length=428

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  528  ITELK  542
            ++EL+
Sbjct  61   VSELR  65



>ref|NP_001182136.1| cell number regulator 13 [Zea mays]
 sp|B6SJQ0.1|CNR13_MAIZE RecName: Full=Cell number regulator 13; AltName: Full=ZmCNR13 
[Zea mays]
 gb|ACG25083.1| domain of unknown function DUF614 containing protein [Zea mays]
 gb|ADI48426.1| cell number regulator 13 [Zea mays]
Length=428

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  528  ITELK  542
            ++EL+
Sbjct  61   VSELR  65



>ref|XP_002468480.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
 gb|EER95478.1| hypothetical protein SORBIDRAFT_01g046630 [Sorghum bicolor]
Length=420

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+NLG+L+N+AQLTG+DA+KLI +IV+AASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  528  ITELK  542
            ++EL+
Sbjct  61   VSELR  65



>ref|XP_006409246.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
 gb|ESQ50699.1| hypothetical protein EUTSA_v10023167mg, partial [Eutrema salsugineum]
Length=373

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLLEQLK++
Sbjct  4    SWDQLGEIASVAQLTGVDAVRLIGMIVTAANTARMHKKNCRQFAQHLKLIGNLLEQLKVS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_008809426.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=421

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +S++ LG++ANVAQLTG+DA++LIGMIVKAA+TA+MHKKNCR+FAQHLKLIGNLLEQL+I
Sbjct  3    SSFDQLGEIANVAQLTGLDAVRLIGMIVKAAATARMHKKNCRKFAQHLKLIGNLLEQLRI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_008809428.1| PREDICTED: cell number regulator 13-like isoform X3 [Phoenix 
dactylifera]
Length=397

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +S++ LG++ANVAQLTG+DA++LIGMIVKAA+TA+MHKKNCR+FAQHLKLIGNLLEQL+I
Sbjct  3    SSFDQLGEIANVAQLTGLDAVRLIGMIVKAAATARMHKKNCRKFAQHLKLIGNLLEQLRI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_010935125.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
 ref|XP_010935126.1| PREDICTED: cell number regulator 13-like [Elaeis guineensis]
Length=420

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+ LG+L+ VAQLTG+DA++LIG+IV+AA+TA+MHKKNCR FA HLKLIGNLLEQLK
Sbjct  1    MASWDQLGELSTVAQLTGLDAVRLIGLIVRAATTARMHKKNCRHFAHHLKLIGNLLEQLK  60

Query  528  ITELK  542
            ++ELK
Sbjct  61   VSELK  65



>ref|XP_008809427.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=420

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +S++ LG++ANVAQLTG+DA++LIGMIVKAA+TA+MHKKNCR+FAQHLKLIGNLLEQL+I
Sbjct  3    SSFDQLGEIANVAQLTGLDAVRLIGMIVKAAATARMHKKNCRKFAQHLKLIGNLLEQLRI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_010489416.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X3 [Camelina sativa]
Length=315

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+ HKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARTHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  534  ELK  542
            E+K
Sbjct  62   EMK  64



>ref|XP_004985646.1| PREDICTED: cell number regulator 13-like [Setaria italica]
Length=418

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+NLG+L+N+AQLTG+DA+KLI +IVKAASTA+MHK NCR+FA+HLKLIG LLEQL+
Sbjct  1    MASWDNLGELSNIAQLTGLDAVKLISLIVKAASTARMHKSNCRRFARHLKLIGGLLEQLR  60

Query  528  ITELK  542
            ++EL+
Sbjct  61   VSELR  65



>ref|XP_010113309.1| hypothetical protein L484_026640 [Morus notabilis]
 gb|EXC35316.1| hypothetical protein L484_026640 [Morus notabilis]
Length=397

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 62/66 (94%), Gaps = 1/66 (2%)
 Frame = +3

Query  348  MAS-WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  524
            MAS WE+ G++AN+AQL G+DA++LI +IVKAASTA+MHKKNCRQF+QHLKLIGNLLEQL
Sbjct  1    MASQWEHFGEIANIAQLAGLDAIRLIALIVKAASTARMHKKNCRQFSQHLKLIGNLLEQL  60

Query  525  KITELK  542
            KI+ELK
Sbjct  61   KISELK  66



>ref|XP_010489415.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Camelina sativa]
Length=420

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+ HKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARTHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  534  ELK  542
            E+K
Sbjct  62   EMK  64



>ref|XP_008440857.1| PREDICTED: cell number regulator 13 isoform X2 [Cucumis melo]
Length=336

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M+SW++LGD+A+VAQLTGI+A++LI MIVKAA+TA+MHKKNC+QFAQHLKLIGNLL+QLK
Sbjct  1    MSSWDSLGDVASVAQLTGINAVQLISMIVKAANTARMHKKNCKQFAQHLKLIGNLLDQLK  60

Query  528  ITEL  539
            I+EL
Sbjct  61   ISEL  64



>gb|KGN48940.1| hypothetical protein Csa_6G507150 [Cucumis sativus]
Length=336

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M+SW++LGD+A VAQLTGI+A++LI MIVKAA+TA+MHKKNC+QFAQHLKLIGNLL+QLK
Sbjct  1    MSSWDSLGDVAGVAQLTGINAVQLISMIVKAANTARMHKKNCKQFAQHLKLIGNLLDQLK  60

Query  528  ITELK  542
            I+E+K
Sbjct  61   ISEMK  65



>ref|XP_010489410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489413.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010489414.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X1 [Camelina sativa]
Length=421

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIGMIV AA+TA+ HKKNCRQFAQHLKLIGNLLEQL+I+
Sbjct  2    SWDQLGEIASVAQLTGVDAVKLIGMIVSAANTARTHKKNCRQFAQHLKLIGNLLEQLRIS  61

Query  534  ELK  542
            E+K
Sbjct  62   EMK  64



>ref|XP_006412042.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412043.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412044.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 ref|XP_006412045.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53495.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53496.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53497.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
 gb|ESQ53498.1| hypothetical protein EUTSA_v10025310mg [Eutrema salsugineum]
Length=418

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>dbj|BAH20129.1| AT4G35920 [Arabidopsis thaliana]
Length=421

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|NP_195317.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849503.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 ref|NP_849504.2| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 sp|Q8L7E9.1|MCAC1_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 1 [Arabidopsis 
thaliana]
 gb|AAM96959.1| putative protein [Arabidopsis thaliana]
 gb|AAO30093.1| putative protein [Arabidopsis thaliana]
 dbj|BAF46389.1| Mca1 [Arabidopsis thaliana]
 dbj|BAH19557.1| AT4G35920 [Arabidopsis thaliana]
 gb|AEE86589.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86590.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
 gb|AEE86591.1| protein MID1-complementing activity 1 [Arabidopsis thaliana]
Length=421

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_004135021.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
 ref|XP_004158901.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Cucumis 
sativus]
Length=416

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M+SW++LGD+A VAQLTGI+A++LI MIVKAA+TA+MHKKNC+QFAQHLKLIGNLL+QLK
Sbjct  1    MSSWDSLGDVAGVAQLTGINAVQLISMIVKAANTARMHKKNCKQFAQHLKLIGNLLDQLK  60

Query  528  ITELK  542
            I+E+K
Sbjct  61   ISEMK  65



>gb|KJB43289.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43290.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
 gb|KJB43291.1| hypothetical protein B456_007G192000 [Gossypium raimondii]
Length=416

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 1/66 (2%)
 Frame = +3

Query  348  MAS-WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  524
            MAS WE+ G++ANVAQL G DA++LI MI KAASTA+MHKKNCRQFAQHLKLIGNLLEQL
Sbjct  1    MASVWEHFGEVANVAQLAGFDAVRLIAMIGKAASTARMHKKNCRQFAQHLKLIGNLLEQL  60

Query  525  KITELK  542
            KI+ELK
Sbjct  61   KISELK  66



>ref|XP_010446852.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446853.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010446856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_002867046.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43305.1| hypothetical protein ARALYDRAFT_491044 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_009138395.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
 ref|XP_009138396.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Brassica 
rapa]
Length=416

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA+MHKKNCRQFAQHL+LIGNLLEQLK++
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTARMHKKNCRQFAQHLELIGNLLEQLKLS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_008440854.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440855.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440856.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Cucumis 
melo]
Length=415

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M+SW++LGD+A+VAQLTGI+A++LI MIVKAA+TA+MHKKNC+QFAQHLKLIGNLL+QLK
Sbjct  1    MSSWDSLGDVASVAQLTGINAVQLISMIVKAANTARMHKKNCKQFAQHLKLIGNLLDQLK  60

Query  528  ITEL  539
            I+EL
Sbjct  61   ISEL  64



>emb|CAA18486.1| putative protein [Arabidopsis thaliana]
 emb|CAA21478.1| putative protein [Arabidopsis thaliana]
 emb|CAB81501.1| putative protein [Arabidopsis thaliana]
Length=447

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>gb|AAM51833.1|AC105730_7 Unknown protein [Oryza sativa Japonica Group]
Length=1202

 Score =   113 bits (282),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 50/65 (77%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWENLGD+A V QLTG+DA++LI MIVKAASTA++HK+NCR+FAQHLKLIG LLEQL+
Sbjct  1    MASWENLGDVATVVQLTGLDAVRLISMIVKAASTARLHKRNCRRFAQHLKLIGGLLEQLR  60

Query  528  ITELK  542
            ++ELK
Sbjct  61   VSELK  65



>gb|AAK32909.1|AF367322_1 AT4g35920/F4B14_190 [Arabidopsis thaliana]
 gb|AAM91434.1| AT4g35920/F4B14_190 [Arabidopsis thaliana]
Length=440

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_010432209.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010432210.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437400.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
 ref|XP_010437401.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Camelina sativa]
Length=421

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>emb|CDX75539.1| BnaA01g01630D [Brassica napus]
Length=419

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>emb|CDX69186.1| BnaC01g02670D [Brassica napus]
Length=420

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>gb|EYU17580.1| hypothetical protein MIMGU_mgv1a007522mg [Erythranthe guttata]
Length=404

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE  G++AN+ QL+G++A  LIG+IVKAA+TA+MHKKNCRQFAQH+KLIGNLL+QLK
Sbjct  1    MASWEQFGEIANIVQLSGLNAAALIGLIVKAANTARMHKKNCRQFAQHVKLIGNLLDQLK  60

Query  528  ITELK  542
            ITELK
Sbjct  61   ITELK  65



>ref|XP_010266008.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266009.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
 ref|XP_010266010.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=420

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            ++W++LG++ NVAQLTG+DA++LIGMIV+AASTA+MHKKNCRQFA HLKLIGNLL+QLKI
Sbjct  3    SAWDHLGEIGNVAQLTGLDAVRLIGMIVQAASTARMHKKNCRQFALHLKLIGNLLQQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_006282626.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 ref|XP_006282627.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15524.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
 gb|EOA15525.1| hypothetical protein CARUB_v10004901mg [Capsella rubella]
Length=421

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>gb|ABR16594.1| unknown [Picea sitchensis]
Length=418

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  536
            WEN+GDLANV QLTG++A+ LI +IVKAAS A+MHKKNCRQFAQHLKLIGNLLEQLK TE
Sbjct  7    WENVGDLANVTQLTGLNAVSLIALIVKAASNARMHKKNCRQFAQHLKLIGNLLEQLKATE  66

Query  537  LK  542
            LK
Sbjct  67   LK  68



>ref|XP_011083456.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=405

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASWE+ G++ANV QLTG++A+ LIG+IVKAA+TA+MH+KNCRQFAQH+K+IGNLLEQLK
Sbjct  1    MASWEHFGEVANVIQLTGLNAVALIGLIVKAANTARMHRKNCRQFAQHVKMIGNLLEQLK  60

Query  528  ITELK  542
            I+E+K
Sbjct  61   ISEMK  65



>ref|XP_011074700.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Sesamum 
indicum]
Length=403

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+WE  G++ANV QLTG++A+ LIG+IVKAASTA+MHK+NCRQFAQH+K+IGNLLEQLK
Sbjct  1    MAAWEQFGEIANVVQLTGLNAVSLIGLIVKAASTARMHKQNCRQFAQHVKMIGNLLEQLK  60

Query  528  ITELK  542
            I+E++
Sbjct  61   ISEMR  65



>ref|XP_006846924.1| hypothetical protein AMTR_s00152p00084120 [Amborella trichopoda]
 gb|ERN08505.1| hypothetical protein AMTR_s00152p00084120 [Amborella trichopoda]
Length=421

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            A+W+ LG++A VAQLTG+DA+KLI MI +AA+TA+MHKKNCRQFAQHLKLIGNLL+QL+I
Sbjct  3    ATWDQLGEIATVAQLTGLDAVKLIAMIARAATTARMHKKNCRQFAQHLKLIGNLLDQLRI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>emb|CDY47043.1| BnaAnng08310D [Brassica napus]
Length=416

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLK++
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKLS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_008806598.1| PREDICTED: cell number regulator 13-like isoform X1 [Phoenix 
dactylifera]
Length=420

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+ LG+L+ V QLTG+DA++LIG+IV+  +TA+MHKKNCRQFAQHLKLIGNLL+QLK
Sbjct  1    MASWDQLGELSTVVQLTGLDAVRLIGLIVQTTATARMHKKNCRQFAQHLKLIGNLLQQLK  60

Query  528  ITELK  542
            ++ELK
Sbjct  61   VSELK  65



>emb|CDX72565.1| BnaC07g45870D [Brassica napus]
Length=414

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKKNCRQFAQHLKLIGNLLEQLK++
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKNCRQFAQHLKLIGNLLEQLKLS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>ref|XP_008806599.1| PREDICTED: cell number regulator 13-like isoform X2 [Phoenix 
dactylifera]
Length=418

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+ LG+L+ V QLTG+DA++LIG+IV+  +TA+MHKKNCRQFAQHLKLIGNLL+QLK
Sbjct  1    MASWDQLGELSTVVQLTGLDAVRLIGLIVQTTATARMHKKNCRQFAQHLKLIGNLLQQLK  60

Query  528  ITELK  542
            ++ELK
Sbjct  61   VSELK  65



>ref|XP_010526810.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
 ref|XP_010526811.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Tarenaya 
hassleriana]
Length=409

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW++LG++++VAQLTG+DA++LIGMIV AA+TA+MHKKNCRQFAQHLKLIGNLL QLKI+
Sbjct  4    SWDHLGEISSVAQLTGLDAVRLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLGQLKIS  63

Query  534  ELK  542
            ELK
Sbjct  64   ELK  66



>ref|XP_009148721.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
 ref|XP_009148775.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 [Brassica rapa]
Length=419

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTG+DA+KLIG+IVKAA+TA MHKK CRQFAQHLKLIGNLLEQLKI+
Sbjct  4    SWDGLGEIASVAQLTGLDAVKLIGLIVKAANTAWMHKKTCRQFAQHLKLIGNLLEQLKIS  63

Query  534  ELK  542
            E+K
Sbjct  64   EMK  66



>gb|KHG10652.1| mid1-complementing activity 1 -like protein [Gossypium arboreum]
Length=332

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +3

Query  348  MAS-WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  524
            MAS WE+ G++ANVAQL G DA++LI MI KAASTA+MHKKNCRQFA HLKLIGNLLEQL
Sbjct  1    MASAWEHFGEVANVAQLAGFDAVRLIAMIGKAASTARMHKKNCRQFALHLKLIGNLLEQL  60

Query  525  KITELK  542
            KI+ELK
Sbjct  61   KISELK  66



>gb|EPS70744.1| mid1-complementing activity 2 [Genlisea aurea]
Length=376

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MASW+  G+ ANV QL G++A+ LIG+IVKAA+TA+MHK+NCRQFAQHLKLIGNLLEQL+
Sbjct  1    MASWDQFGEAANVIQLAGLNAVALIGLIVKAANTARMHKRNCRQFAQHLKLIGNLLEQLR  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_007046628.1| PLAC8 family protein [Theobroma cacao]
 gb|EOX90785.1| PLAC8 family protein [Theobroma cacao]
Length=421

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SWE++G++A+V QL G DA +LI MI KAA+TA+MHKKNCRQFAQHLKLIGNLLEQLKI
Sbjct  3    SSWEHIGEVASVVQLAGFDAGRLIAMIAKAANTARMHKKNCRQFAQHLKLIGNLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>ref|XP_006649427.1| PREDICTED: cell number regulator 13-like [Oryza brachyantha]
Length=419

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 2/67 (3%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAA--STAKMHKKNCRQFAQHLKLIGNLLEQ  521
            MASWENLG++A V QLTG+DA +LI MIVKAA  STA++HK+NCR+FAQHLKLIG LLEQ
Sbjct  1    MASWENLGEVATVVQLTGLDAGRLISMIVKAAAASTARLHKRNCRRFAQHLKLIGGLLEQ  60

Query  522  LKITELK  542
            L+++ELK
Sbjct  61   LRVSELK  67



>ref|XP_010266845.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Nelumbo 
nucifera]
Length=409

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            ++W+++G++ NVAQL G+DA++LIGMIV AASTA+MHKKNC+QFA HLKLIGNLLEQLKI
Sbjct  3    SAWDHIGEIGNVAQLAGMDAVRLIGMIVHAASTARMHKKNCKQFALHLKLIGNLLEQLKI  62

Query  531  TELK  542
            +ELK
Sbjct  63   SELK  66



>pir||T08859 hypothetical protein A_TM017A05.4 - Arabidopsis thaliana
Length=276

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  534  EL  539
            E+
Sbjct  64   EM  65



>gb|EMT07324.1| hypothetical protein F775_31025 [Aegilops tauschii]
Length=395

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  363  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            N+GDLAN+AQLTG+DA++LIG+IVKAA+TA+MHK NCR+FAQHLKLIG LLEQL+++ELK
Sbjct  3    NVGDLANIAQLTGLDAVRLIGLIVKAAATARMHKSNCRRFAQHLKLIGGLLEQLRVSELK  62



>ref|NP_001031368.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06685.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=314

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  534  EL  539
            E+
Sbjct  64   EM  65



>ref|NP_001031366.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06683.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=414

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  534  EL  539
            E+
Sbjct  64   EM  65



>ref|NP_179369.2| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 sp|Q3EBY6.1|MCAC2_ARATH RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 2 [Arabidopsis 
thaliana]
 dbj|BAF46390.1| Mca2 [Arabidopsis thaliana]
 gb|AEC06682.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=416

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  534  EL  539
            E+
Sbjct  64   EM  65



>pir||D84556 hypothetical protein At2g17780 [imported] - Arabidopsis thaliana
Length=417

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  534  EL  539
            E+
Sbjct  64   EM  65



>ref|NP_001031367.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
 gb|AEC06684.1| protein MID1-complementing activity 2 [Arabidopsis thaliana]
Length=410

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  534  EL  539
            E+
Sbjct  64   EM  65



>ref|XP_002886128.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62387.1| hypothetical protein ARALYDRAFT_480672 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
            SW+ LG++A+VAQLTGIDA+KLIGMIV AA+TA+MHKKNCRQFA HLKLI NLLEQ+K +
Sbjct  4    SWDQLGEIASVAQLTGIDALKLIGMIVNAANTARMHKKNCRQFAHHLKLIRNLLEQIKNS  63

Query  534  EL  539
            E+
Sbjct  64   EM  65



>ref|XP_003558777.1| PREDICTED: cell number regulator 13 [Brachypodium distachyon]
Length=412

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +3

Query  363  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            +LGD+ANVAQ+TG+DA+++I +IVKAASTA+MHK+NCR+FAQHLKLIG LLEQL+++ELK
Sbjct  3    SLGDVANVAQVTGLDAVRIIALIVKAASTARMHKRNCRRFAQHLKLIGGLLEQLRVSELK  62



>ref|XP_010680410.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680411.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=410

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  360  ENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +++ D+A +AQLTG+DA+KLIG+IVKAA+TA+MH+KNCRQFA HLKLIGNLLEQLKI+EL
Sbjct  2    DHMEDVATIAQLTGLDAVKLIGLIVKAANTARMHRKNCRQFANHLKLIGNLLEQLKISEL  61

Query  540  K  542
            K
Sbjct  62   K  62



>ref|XP_010680412.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=396

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  360  ENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +++ D+A +AQLTG+DA+KLIG+IVKAA+TA+MH+KNCRQFA HLKLIGNLLEQLKI+EL
Sbjct  2    DHMEDVATIAQLTGLDAVKLIGLIVKAANTARMHRKNCRQFANHLKLIGNLLEQLKISEL  61

Query  540  K  542
            K
Sbjct  62   K  62



>gb|EYU30814.1| hypothetical protein MIMGU_mgv1a007258mg [Erythranthe guttata]
Length=413

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  363  NLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            + G++ANVAQL G+DA  LIGMIVKAA+TA+MHKKNCRQFA HLKLIGNLLE L+I+ELK
Sbjct  3    HFGEMANVAQLAGMDAASLIGMIVKAATTARMHKKNCRQFALHLKLIGNLLESLRISELK  62



>ref|XP_001767697.1| predicted protein [Physcomitrella patens]
 gb|EDQ67448.1| predicted protein, partial [Physcomitrella patens]
Length=110

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            LGD+ANV QLTGI+A++LI MIV+AA+ A+MHKKNCRQFA HLKLI  LLEQL IT+LK
Sbjct  1    LGDVANVGQLTGINAVQLISMIVQAANNARMHKKNCRQFAHHLKLISKLLEQLNITDLK  59



>ref|XP_010692506.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692507.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692508.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Beta vulgaris 
subsp. vulgaris]
Length=406

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M++W+ L ++ N+AQLTG++A+ LIG+IV  A+ A++HKKNCR+FA HLKLIGNLLEQLK
Sbjct  1    MSNWDTLNEVGNLAQLTGVNAVGLIGLIVDTANRARLHKKNCRKFAHHLKLIGNLLEQLK  60

Query  528  ITELK  542
            I+ELK
Sbjct  61   ISELK  65



>ref|XP_001768983.1| predicted protein [Physcomitrella patens]
 gb|EDQ66181.1| predicted protein [Physcomitrella patens]
Length=415

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  354  SWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKIT  533
             W  LGD+A+  QL GI+A++LI MIVKAA+ A+MHKKNCRQFAQHLKLI NLLEQL +T
Sbjct  2    PWLALGDVASFGQLAGINAVQLIAMIVKAANNARMHKKNCRQFAQHLKLIANLLEQLNLT  61

Query  534  ELK  542
            +LK
Sbjct  62   DLK  64



>ref|XP_009389172.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=366

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            ++W  +GD+A+V QL G+DA+ LI MI+K AS A+MH+KNCRQFA  LKL+GNLLEQL+I
Sbjct  3    STWGPVGDVASVMQLVGVDAVSLIRMIIKVASDARMHRKNCRQFAHQLKLVGNLLEQLRI  62

Query  531  TELK  542
            +EL+
Sbjct  63   SELR  66



>ref|XP_009389171.1| PREDICTED: protein kinase 2A, chloroplastic-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=597

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            ++W  +GD+A+V QL G+DA+ LI MI+K AS A+MH+KNCRQFA  LKL+GNLLEQL+I
Sbjct  3    STWGPVGDVASVMQLVGVDAVSLIRMIIKVASDARMHRKNCRQFAHQLKLVGNLLEQLRI  62

Query  531  TELK  542
            +EL+
Sbjct  63   SELR  66



>ref|XP_001769010.1| predicted protein [Physcomitrella patens]
 gb|EDQ66208.1| predicted protein [Physcomitrella patens]
Length=247

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            +GD+ANV QL GI+A++LI +IV+AA+ A+MHKKNCRQFA HLKLI NLLEQL +++LK
Sbjct  15   IGDVANVGQLAGINAVQLIAIIVQAANNARMHKKNCRQFAHHLKLISNLLEQLNMSDLK  73



>ref|XP_002978386.1| hypothetical protein SELMODRAFT_418221 [Selaginella moellendorffii]
 gb|EFJ20372.1| hypothetical protein SELMODRAFT_418221 [Selaginella moellendorffii]
Length=380

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            +GD+A VAQ+ G+D++KLI  +  AA  A+MHKKNCR FAQHLKLIGNLLE+L+++ELK
Sbjct  5    VGDVATVAQIAGLDSLKLIAAVAAAAKNARMHKKNCRNFAQHLKLIGNLLEKLRLSELK  63



>ref|NP_001068428.2| Os11g0670100 [Oryza sativa Japonica Group]
 dbj|BAF28791.2| Os11g0670100 [Oryza sativa Japonica Group]
Length=205

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNRETCQKLARHVKMIGDLLQRLQ  60

Query  528  ITEL  539
             TEL
Sbjct  61   STEL  64



>gb|EAZ08702.1| hypothetical protein OsI_30969 [Oryza sativa Indica Group]
Length=200

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +3

Query  351  ASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKI  530
            +SW+ LG  A+V Q+TG+DA  L+ MIV+AA TA+ ++  CRQ AQH++++G LL +L+I
Sbjct  5    SSWDRLGQAASVMQVTGVDAFGLVAMIVQAAHTARRNRDLCRQLAQHVQIVGGLLRKLQI  64

Query  531  TELK  542
             EL+
Sbjct  65   PELR  68



>ref|XP_002970226.1| hypothetical protein SELMODRAFT_93428 [Selaginella moellendorffii]
 gb|EFJ28356.1| hypothetical protein SELMODRAFT_93428 [Selaginella moellendorffii]
Length=395

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            +GD+A VAQ+ G+D++KLI  +  AA  A+MHKKNCR FAQHLKLIGNLLE+L+++EL+
Sbjct  5    VGDVATVAQIAGLDSLKLIAAVAAAAKNARMHKKNCRNFAQHLKLIGNLLEKLRLSELR  63



>gb|EEE57693.1| hypothetical protein OsJ_08164 [Oryza sativa Japonica Group]
Length=1467

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNRETCQKLARHVKMIGDLLQRLQ  60

Query  528  ITEL  539
             TEL
Sbjct  61   STEL  64



>gb|ABA95227.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=2776

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNRETCQKLARHVKMIGDLLQRLQ  60

Query  528  ITEL  539
             TEL
Sbjct  61   STEL  64



>gb|EEC80653.1| hypothetical protein OsI_23047 [Oryza sativa Indica Group]
Length=279

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNQETCQKLARHVKMIGDLLQRLQ  60

Query  528  ITEL  539
             TEL
Sbjct  61   STEL  64



>gb|EEC72317.1| hypothetical protein OsI_05510 [Oryza sativa Indica Group]
Length=435

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG +AN+AQL G+DA  LI MIV+AA TAK +++ C++ A+H+K+IG+LL++L+
Sbjct  1    MALWNGLGQVANIAQLAGVDAYGLIKMIVEAAQTAKRNRETCQKLARHVKMIGDLLQRLQ  60

Query  528  ITEL  539
             TEL
Sbjct  61   STEL  64



>ref|XP_002437501.1| hypothetical protein SORBIDRAFT_10g028240 [Sorghum bicolor]
 gb|EER88868.1| hypothetical protein SORBIDRAFT_10g028240 [Sorghum bicolor]
Length=535

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  536
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G LL +L++ E
Sbjct  30   WTVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVGGLLRELEVAE  89

Query  537  L  539
            L
Sbjct  90   L  90



>ref|XP_001785848.1| predicted protein [Physcomitrella patens]
 gb|EDQ49335.1| predicted protein, partial [Physcomitrella patens]
Length=399

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLK  497
            +GD+ANV QL GI+A++LI MIVKAA  A+MHKKNC+ FAQHLK
Sbjct  1    MGDVANVGQLVGINAVQLIAMIVKAAKNARMHKKNCQNFAQHLK  44



>ref|XP_002520777.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41486.1| conserved hypothetical protein [Ricinus communis]
Length=393

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +A++AQ+ G+DA  L  MI+ AA  A  H+KNC Q A+H+KLIGNLLE+LK T+L
Sbjct  1    MASIAQVAGVDATGLANMIISAARNATTHRKNCEQLAEHVKLIGNLLEKLKSTDL  55



>ref|XP_002446043.1| hypothetical protein SORBIDRAFT_06g000900 [Sorghum bicolor]
 gb|EES10371.1| hypothetical protein SORBIDRAFT_06g000900 [Sorghum bicolor]
Length=146

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +3

Query  348  MAS-WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  524
            MAS W+ LG  A+V QLTG+DA  ++ MI++AA TA+ ++  C+Q A+ ++++  LLE+L
Sbjct  1    MASFWDMLGKAASVMQLTGVDAFGMVSMIIQAARTARRNRDLCQQLAKKVEIVSGLLEEL  60

Query  525  KITELK  542
             I EL+
Sbjct  61   NIPELR  66



>gb|KDP44714.1| hypothetical protein JCGZ_01214 [Jatropha curcas]
Length=381

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
             ++AQ+TG+DA+ L  MI+ AA  A  H++NC Q A+H+KLI NLLE+LK ++L
Sbjct  3    TSIAQVTGVDALGLANMIISAARNATTHRRNCEQLAEHVKLISNLLEKLKSSDL  56



>ref|XP_008676749.1| PREDICTED: uncharacterized protein LOC100272597 isoform X2 [Zea 
mays]
Length=508

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  +G +A++AQL G+DA  LI MIV+AA T K +++ C+  A+  ++IG+LL QL+
Sbjct  1    MALWNGIGQVASIAQLAGVDAYGLISMIVEAAKTVKRNRETCQLLARRARMIGDLLHQLE  60

Query  528  ITEL  539
             T+L
Sbjct  61   RTQL  64



>ref|XP_008676748.1| PREDICTED: uncharacterized protein LOC100272597 isoform X1 [Zea 
mays]
Length=510

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  +G +A++AQL G+DA  LI MIV+AA T K +++ C+  A+  ++IG+LL QL+
Sbjct  1    MALWNGIGQVASIAQLAGVDAYGLISMIVEAAKTVKRNRETCQLLARRARMIGDLLHQLE  60

Query  528  ITEL  539
             T+L
Sbjct  61   RTQL  64



>ref|XP_010237406.1| PREDICTED: cell number regulator 13-like [Brachypodium distachyon]
 ref|XP_010237407.1| PREDICTED: cell number regulator 13-like [Brachypodium distachyon]
Length=206

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA+W  +   A+VAQL G+DA  LI MIV+A  T + +K+ C++ A+ +K+IG+LL+QL 
Sbjct  1    MATWNGVSQAASVAQLAGVDAYGLIKMIVEAVQTVRRNKETCQKLARRVKMIGDLLQQLH  60

Query  528  ITEL  539
              +L
Sbjct  61   EAQL  64



>ref|XP_011035883.1| PREDICTED: cell number regulator 13-like [Populus euphratica]
Length=388

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +AN+AQ+ G+D   L  MI+ +A  A  HKKNC Q A+H+K+I NLLE++K T+L
Sbjct  1    MANLAQVAGVDTSGLANMIISSARNATAHKKNCEQLAEHVKIISNLLEKIKSTDL  55



>ref|XP_004962550.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
isoform X3 [Setaria italica]
Length=556

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG +A VAQLTG+DA  LI MI++A  T   +K++CR  A+   +IG+LL++L+
Sbjct  1    MALWNGLGQVATVAQLTGVDASGLIAMILEAVRTVSRNKEDCRHLARRAMMIGDLLQKLQ  60



>ref|XP_010658233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X3 [Vitis vinifera]
Length=446

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  369  GDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
             ++ +VAQ  G+DA+ +IGM+  AA  A  H++NC + + H ++IGNLLE+L  TEL+
Sbjct  67   SEMEDVAQAAGVDALSVIGMVAAAARKANTHRRNCEKISNHARMIGNLLEKLNATELR  124



>ref|XP_004962548.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
isoform X1 [Setaria italica]
 ref|XP_004962549.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
isoform X2 [Setaria italica]
Length=558

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG +A VAQLTG+DA  LI MI++A  T   +K++CR  A+   +IG+LL++L+
Sbjct  1    MALWNGLGQVATVAQLTGVDASGLIAMILEAVRTVSRNKEDCRHLARRAMMIGDLLQKLQ  60



>ref|XP_010658232.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Vitis vinifera]
Length=450

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  369  GDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
             ++ +VAQ  G+DA+ +IGM+  AA  A  H++NC + + H ++IGNLLE+L  TEL+
Sbjct  67   SEMEDVAQAAGVDALSVIGMVAAAARKANTHRRNCEKISNHARMIGNLLEKLNATELR  124



>ref|XP_010658234.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X4 [Vitis vinifera]
Length=429

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  369  GDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
             ++ +VAQ  G+DA+ +IGM+  AA  A  H++NC + + H ++IGNLLE+L  TEL+
Sbjct  67   SEMEDVAQAAGVDALSVIGMVAAAARKANTHRRNCEKISNHARMIGNLLEKLNATELR  124



>ref|XP_010658231.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Vitis vinifera]
Length=453

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  369  GDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITELK  542
             ++ +VAQ  G+DA+ +IGM+  AA  A  H++NC + + H ++IGNLLE+L  TEL+
Sbjct  67   SEMEDVAQAAGVDALSVIGMVAAAARKANTHRRNCEKISNHARMIGNLLEKLNATELR  124



>ref|XP_006356472.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum tuberosum]
Length=389

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            + ++AQ+ G++A+ +I +I+ A+  A  HK+NC Q A+H++LIGNLLE+LK T+L
Sbjct  1    MEDIAQVAGVNALGVINLIIAASKNATTHKRNCEQLAEHVRLIGNLLEKLKSTDL  55



>ref|XP_002438909.1| hypothetical protein SORBIDRAFT_10g028036 [Sorghum bicolor]
 gb|EER90276.1| hypothetical protein SORBIDRAFT_10g028036 [Sorghum bicolor]
Length=151

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGN  509
            W  LG  +NV QL GIDA+ L+ M+V+AA  A+ H+  CR+ AQH++L+G 
Sbjct  19   WTVLGQASNVVQLVGIDALGLVSMVVQAALAARRHRDACRRLAQHVELVGG  69



>ref|XP_004977713.1| PREDICTED: probable receptor-like protein kinase At5g59700-like 
[Setaria italica]
Length=621

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +3

Query  348  MAS-WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  524
            MAS W+ LG +  V QLTG+DA  ++ MIV+AA TA+ ++  C+Q A+ ++++  LLE+L
Sbjct  1    MASFWDVLGKVTGVMQLTGVDAFGMVSMIVQAARTARRNRDLCQQLAKKVEIVSGLLEEL  60

Query  525  KITELK  542
            +I EL+
Sbjct  61   QIPELR  66



>gb|KDO68875.1| hypothetical protein CISIN_1g020555mg [Citrus sinensis]
Length=324

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = +3

Query  375  LANVA--QLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +AN+A   +TG+DA+ L+  I+ +A  A  H++NC Q A+H+K+IGNLLE+LK T+L
Sbjct  1    MANLAVQAVTGVDAVSLVNTIISSARKAAAHRRNCEQLAEHVKMIGNLLEKLKSTDL  57



>ref|XP_010318233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Solanum lycopersicum]
Length=377

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            + + AQ+ G++A+ +I +I+ A+  A  HK+NC Q A+H+++IGNLLE+LK T+L
Sbjct  1    MEDFAQVAGVNALGVINLIIAASKNATTHKRNCEQLAEHVRMIGNLLEKLKSTDL  55



>ref|XP_004235233.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Solanum lycopersicum]
Length=390

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            + + AQ+ G++A+ +I +I+ A+  A  HK+NC Q A+H+++IGNLLE+LK T+L
Sbjct  1    MEDFAQVAGVNALGVINLIIAASKNATTHKRNCEQLAEHVRMIGNLLEKLKSTDL  55



>ref|XP_004979928.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-13-like [Setaria italica]
Length=507

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  +  LA+VAQL G+DA  LI MI +AA T K +++ C+  A+  ++IG+LL+QL+
Sbjct  1    MALWNGVSQLASVAQLAGVDAYGLISMIAEAARTVKRNRETCQLLARRARMIGDLLQQLE  60

Query  528  ITEL  539
             T L
Sbjct  61   RTRL  64



>ref|XP_004962551.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
isoform X4 [Setaria italica]
Length=424

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG +A VAQLTG+DA  LI MI++A  T   +K++CR  A+   +IG+LL++L+
Sbjct  1    MALWNGLGQVATVAQLTGVDASGLIAMILEAVRTVSRNKEDCRHLARRAMMIGDLLQKLQ  60



>ref|XP_009369272.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Pyrus 
x bretschneideri]
Length=141

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            ++ A+  G+DA+ L   I   A +A+ H+ NC+QFA+H++++GNLLE++K T+ 
Sbjct  4    SDFAEAPGLDAVSLTTTIASTAQSARTHRHNCQQFAEHVRMVGNLLEKMKSTDF  57



>ref|XP_004986952.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61500-like [Setaria italica]
Length=473

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            W+ L  +++VAQLTG+DA  LI  IV+ A+TA+ ++K CR+ A+ ++ IG+LL  L+
Sbjct  2    WDGLEKVSSVAQLTGVDAFVLITTIVRVAATARRNRKTCRELAEQVERIGDLLRSLE  58



>ref|XP_002316192.2| hypothetical protein POPTR_0010s19210g, partial [Populus trichocarpa]
 gb|EEF02363.2| hypothetical protein POPTR_0010s19210g, partial [Populus trichocarpa]
Length=396

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  372  DLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            ++AN+AQ+ G+    L  MI+ +A  A  HKKNC Q A+H+K+I NLLE++K T+L
Sbjct  5    NMANLAQVAGVHTSGLANMIISSARNATAHKKNCEQLAEHVKIISNLLEKIKSTDL  60



>ref|NP_001146395.1| uncharacterized protein LOC100279975 [Zea mays]
 gb|ACL53879.1| unknown [Zea mays]
Length=194

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            +G +A VAQL G+DA  LI MI +AA TA+ ++  CRQ A+ +++IG+LL +L+
Sbjct  4    VGQVATVAQLVGVDAFSLITMIAEAAQTARRNRAVCRQLARRVEMIGSLLRRLR  57



>ref|XP_006486524.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like [Citrus 
sinensis]
Length=342

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +3

Query  375  LANVA--QLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +AN+A   + G+DA+ L+  I+ +A  A  H++NC Q A+H+K+IGNLLE+LK T+L
Sbjct  1    MANLAVQAVAGVDAVSLVNTIISSARKAAAHRRNCEQLAEHVKMIGNLLEKLKSTDL  57



>ref|XP_008648918.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 isoform X2 [Zea mays]
Length=576

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G
Sbjct  8    WAVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVG  57



>ref|XP_008648917.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 isoform X1 [Zea mays]
Length=577

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G
Sbjct  8    WAVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVG  57



>ref|XP_008648920.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 isoform X4 [Zea mays]
 gb|AFW75924.1| putative protein kinase superfamily protein [Zea mays]
Length=567

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G
Sbjct  8    WAVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVG  57



>ref|XP_008648919.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 isoform X3 [Zea mays]
Length=568

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+ AQH++++G
Sbjct  8    WAVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLAQHVEVVG  57



>ref|XP_006435802.1| hypothetical protein CICLE_v10031760mg [Citrus clementina]
 gb|ESR49042.1| hypothetical protein CICLE_v10031760mg [Citrus clementina]
Length=393

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +3

Query  375  LANVA--QLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +AN+A   + G+DA+ L+  I+ +A  A  H++NC Q A+H+K+IGNLLE+LK T+L
Sbjct  1    MANLAVQAVAGVDAVSLVNTIISSARKAAAHRRNCEQLAEHVKMIGNLLEKLKSTDL  57



>ref|NP_001058414.2| Os06g0689600 [Oryza sativa Japonica Group]
 dbj|BAF20328.2| Os06g0689600 [Oryza sativa Japonica Group]
Length=149

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGN  509
            W  LG  +NVAQL G+DA+ L+ M+ +AA  A+ H+  CR+  QH +L+G 
Sbjct  7    WGVLGQASNVAQLVGVDALGLVSMVAQAALAARRHRDACRRLGQHAELVGG  57



>gb|ADE76255.1| unknown [Picea sitchensis]
Length=247

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  MHKKNCRQFAQHLKLIGNLLEQLKITELK  542
            MHKKNCRQFA HLK+IGNLLEQLK++ELK
Sbjct  1    MHKKNCRQFAHHLKMIGNLLEQLKVSELK  29



>gb|EMS60707.1| Receptor-like serine/threonine-protein kinase SD1-8 [Triticum 
urartu]
Length=610

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +3

Query  339  GVKMASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLE  518
            G  MA W  +   A +AQL G+DA+ LI  IV+AA T + +K+ C++  Q ++LI  LL 
Sbjct  69   GADMAQWNGMEQAATIAQLVGVDALGLISTIVQAAQTVQRNKETCQELVQDVQLINGLLR  128

Query  519  QLKITEL  539
             L+  E+
Sbjct  129  MLQNPEM  135



>gb|EEC81215.1| hypothetical protein OsI_24255 [Oryza sativa Indica Group]
Length=480

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGN  509
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+  QH++L+G 
Sbjct  7    WGVLGQASNVAQLVGVDALGLVSMVVQAALAARCHRDACRRLGQHVELVGG  57



>ref|XP_010087526.1| hypothetical protein L484_006931 [Morus notabilis]
 gb|EXB29257.1| hypothetical protein L484_006931 [Morus notabilis]
Length=388

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +G  +      G DA+ L  MI  +A TA  H++NC Q A+H ++IGNLLE+LK T+L
Sbjct  1    MGTFSQPYYAAGTDAVTLTSMIAASARTAATHRRNCEQLAEHARVIGNLLEKLKATDL  58



>ref|XP_004966167.1| PREDICTED: cysteine-rich receptor-like protein kinase 19-like 
[Setaria italica]
Length=569

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L  M+V+AA  A+ H+  CR+ AQH++++G
Sbjct  13   WTVLGQASNVAQLVGVDALGLASMVVQAALAARRHRDACRRLAQHVEIVG  62



>ref|XP_008363765.1| PREDICTED: LOW QUALITY PROTEIN: protein MID1-COMPLEMENTING ACTIVITY 
1-like [Malus domestica]
Length=392

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  378  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            ++ A+  G+DA+ L   IV  A +A+ H+ NC+Q A+H++++GNLLE++K T+L
Sbjct  4    SDFAEAPGLDAVGLTSTIVSTAQSARTHRHNCQQLAEHVRMVGNLLEKMKSTDL  57



>dbj|BAD45624.1| receptor protein kinase-like [Oryza sativa Japonica Group]
Length=541

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  CR+  QH++L+G
Sbjct  92   WGVLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACRRLGQHVELVG  141



>ref|XP_010227385.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
20 isoform X1 [Brachypodium distachyon]
Length=569

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  C + AQH++L+G
Sbjct  13   WGTLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACVRLAQHVELVG  62



>gb|ABA98611.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ20573.1| hypothetical protein OsJ_36182 [Oryza sativa Japonica Group]
Length=522

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI MIV+AA TA+ +KK C Q A+   +I  LL  L+
Sbjct  1    MALWSGLGQAATVAQLVGADVGSLISMIVQAAVTAQHNKKECEQLARRAFMIAELLPHLR  60

Query  528  ITEL  539
              E+
Sbjct  61   DPEV  64



>ref|XP_010227386.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
20 isoform X2 [Brachypodium distachyon]
Length=567

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L+ M+V+AA  A+ H+  C + AQH++L+G
Sbjct  13   WGTLGQASNVAQLVGVDALGLVSMVVQAALAARRHRDACVRLAQHVELVG  62



>dbj|BAD54275.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ37269.1| hypothetical protein OsJ_21607 [Oryza sativa Japonica Group]
Length=138

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M  W ++  +A VAQ+ G+DA  LI M+ + A   + +K  CRQ A+H++ +G LL  ++
Sbjct  1    MPIWSSVDPVATVAQIAGVDAYGLISMVTERAEKVRRNKYECRQLAEHVETVGGLLHHVE  60



>gb|ABA95138.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ19206.1| hypothetical protein OsJ_34746 [Oryza sativa Japonica Group]
Length=543

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  I  LL+ L+
Sbjct  1    MALWSGLGQAATVAQLVGADVGGLISMIMQAAMTAQQNKKECEQLARRVFTIAELLQHLQ  60

Query  528  ITEL  539
              +L
Sbjct  61   DPDL  64



>ref|NP_001142910.1| uncharacterized protein LOC100275341 [Zea mays]
 gb|ACG27492.1| hypothetical protein [Zea mays]
Length=227

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            ++A+L G+DA+KL+ MIV+AA T + +KK CRQ   H+++I +LLE+L+
Sbjct  2    DIAKLAGVDAVKLVVMIVRAAQTVRRNKKTCRQLVHHVQIIDDLLEKLQ  50



>ref|XP_004979962.1| PREDICTED: cysteine-rich receptor-like protein kinase 15-like 
isoform X2 [Setaria italica]
Length=441

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  381  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            ++A+L G+DA+KL+ MIV+A+ T + +KK C+Q  QH+++IG+LL++L+ +E+
Sbjct  2    DIAKLAGVDAIKLVVMIVQASQTVRHNKKTCQQLVQHVQIIGDLLKKLQASEM  54



>gb|EEE52535.1| hypothetical protein OsJ_34758 [Oryza sativa Japonica Group]
Length=279

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G+D   L+ MI+ AA TA+ +K+ C Q A+ + +IG LL  L+
Sbjct  1    MALWGGLGQTATVAQLVGVDVGGLVSMIMHAALTARQNKRECEQLARRVFMIGELLPHLQ  60



>ref|XP_002439055.1| hypothetical protein SORBIDRAFT_10g030680 [Sorghum bicolor]
 gb|EER90422.1| hypothetical protein SORBIDRAFT_10g030680 [Sorghum bicolor]
Length=471

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  381  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            N AQ+TG+DA+ LI +IV+AA TA+ +KK CR+  + +K IG+LL  L+
Sbjct  7    NAAQVTGVDALSLIALIVRAAETARRNKKTCRELVEQVKQIGDLLRSLE  55



>ref|XP_004979961.1| PREDICTED: cysteine-rich receptor-like protein kinase 15-like 
isoform X1 [Setaria italica]
Length=496

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  381  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            ++A+L G+DA+KL+ MIV+A+ T + +KK C+Q  QH+++IG+LL++L+ +E+
Sbjct  2    DIAKLAGVDAIKLVVMIVQASQTVRHNKKTCQQLVQHVQIIGDLLKKLQASEM  54



>dbj|BAJ90976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=600

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = +3

Query  333  LIGVKMASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNL  512
            L  V MA W  LG  A VAQL G D   LI MIV+AA TA+ +K  C Q A+ + +I  L
Sbjct  39   LHSVAMALWTGLGQAATVAQLVGADVGGLISMIVQAAITARQNKSECEQLARRVLMIAQL  98

Query  513  LEQLKITE  536
            L  ++  E
Sbjct  99   LPHVQEPE  106



>dbj|BAJ97098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  IGVKMASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLL  515
            + V MA W  LG  A VAQL G D   LI MIV+AA TA+ ++  C Q A+ + +I  LL
Sbjct  47   LAVAMALWTGLGQAATVAQLVGADVGGLISMIVQAAMTARQNRSECEQLARRVLMIAQLL  106

Query  516  EQLKITE  536
              ++  E
Sbjct  107  PHVQEPE  113



>gb|ABA95204.1| hypothetical protein LOC_Os11g44520 [Oryza sativa Japonica Group]
Length=308

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G+D   L+ MI+ AA TA+ +K+ C Q A+ + +IG LL  L+
Sbjct  1    MALWGGLGQTATVAQLVGVDVGGLVSMIMHAALTARQNKRECEQLARRVFMIGELLPHLQ  60



>ref|XP_002449963.1| hypothetical protein SORBIDRAFT_05g026280 [Sorghum bicolor]
 gb|EES08951.1| hypothetical protein SORBIDRAFT_05g026280 [Sorghum bicolor]
Length=186

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            +G +A VAQL G+DA  LI MI +AA T + ++  CRQ A+ +++IG LL +L+
Sbjct  4    VGQVATVAQLVGVDAFSLITMIAEAAQTVRRNRAVCRQLARRVEMIGGLLRRLQ  57



>ref|XP_004966168.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23-like [Setaria italica]
Length=566

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NV QL G+DA+ L+ M+V+A+  A+ H+  CR+ AQH++++G
Sbjct  11   WTVLGQASNVVQLVGVDALGLVSMVVQASLAARRHRDACRRLAQHVEIVG  60



>ref|XP_004979929.1| PREDICTED: cell number regulator 13-like [Setaria italica]
Length=194

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            +G +A VAQL G+DA  LI MI  AA T + ++  CRQ A+ +++IG LL +L+
Sbjct  4    VGQVATVAQLVGLDAYSLITMIADAARTVRRNRATCRQLARRVEMIGGLLRRLQ  57



>gb|EEE52534.1| hypothetical protein OsJ_34757 [Oryza sativa Japonica Group]
Length=81

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  536
            W  +G  A VAQL G D  +LI MI++AA  A+ +KK C Q A+ + +I  LL  L+  E
Sbjct  2    WSGMGQAATVAQLVGADVGRLISMIMQAALPAQRNKKECEQLARRVFMIAELLPHLQDPE  61

Query  537  L  539
            +
Sbjct  62   V  62



>gb|EEC81213.1| hypothetical protein OsI_24251 [Oryza sativa Indica Group]
Length=536

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L+ M+ +AA  A+ H+  CR+  QH++L+G
Sbjct  7    WGVLGQASNVAQLVGVDALGLVSMVAQAALAARRHQDACRRLGQHVELVG  56



>gb|EMT22570.1| Putative serine/threonine-protein kinase-like protein CCR3 [Aegilops 
tauschii]
Length=583

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI MIV+AA TA+ ++  C Q A+ L +I  LL  ++
Sbjct  1    MALWTGLGQAATVAQLVGADVGGLISMIVQAALTARQNRSECEQLARRLLMIAQLLPHVQ  60

Query  528  ITE  536
              E
Sbjct  61   EPE  63



>ref|XP_006663098.1| PREDICTED: putative serine/threonine-protein kinase-like protein 
CCR3-like isoform X1 [Oryza brachyantha]
Length=492

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  I  LL+ L+
Sbjct  1    MALWGGLGQAATVAQLVGADVGGLISMIIRAALTAQQNKKECEQLARRVFTIAELLQHLQ  60

Query  528  ITEL  539
              E+
Sbjct  61   DPEV  64



>gb|EAY99718.1| hypothetical protein OsI_21701 [Oryza sativa Indica Group]
Length=532

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI  I++AA+TA+ +K+ C Q A+ + +I +LL  L+
Sbjct  1    MAVWGGLGQAATVAQLVGADVGGLISSIIQAAATARQNKRECDQLARRVVMIADLLPHLQ  60

Query  528  ITEL  539
              E+
Sbjct  61   DPEV  64



>dbj|BAJ88144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  ++VAQL G+DA+ L+ M+V+AA  A+ H+  C + AQH++L+G
Sbjct  13   WAALGQASSVAQLVGVDALGLVSMVVQAALAARRHRDACVRLAQHVELVG  62



>ref|NP_001056829.1| Os06g0151700 [Oryza sativa Japonica Group]
 dbj|BAD69328.1| cytokinin-regulated kinase-like [Oryza sativa Japonica Group]
 dbj|BAD69064.1| cytokinin-regulated kinase-like [Oryza sativa Japonica Group]
 dbj|BAF18743.1| Os06g0151700 [Oryza sativa Japonica Group]
 gb|EAZ35850.1| hypothetical protein OsJ_20148 [Oryza sativa Japonica Group]
Length=532

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI  I++AA+TA+ +K+ C Q A+ + +I +LL  L+
Sbjct  1    MAVWGGLGQAATVAQLVGADVGGLISSIIQAAATARQNKRECDQLARRVVMIADLLPHLQ  60

Query  528  ITEL  539
              E+
Sbjct  61   DPEV  64



>dbj|BAD45621.1| receptor protein kinase-like [Oryza sativa Japonica Group]
Length=567

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  +NVAQL G+DA+ L+ M+ +AA  A+ H+  CR+  QH +L+G
Sbjct  7    WGVLGQASNVAQLVGVDALGLVSMVAQAALAARRHRDACRRLGQHAELVG  56



>emb|CDP13977.1| unnamed protein product [Coffea canephora]
Length=378

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  396  TGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            T  DAM LI +I  AA  A  HK NC+Q A H+++IGNLLE+LK T+L
Sbjct  8    TRADAMGLINLITTAARNAITHKNNCQQLADHVRMIGNLLEKLKSTDL  55



>dbj|BAJ94356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI MIV+AA TA+ ++  C Q A+ + +I  LL  ++
Sbjct  1    MALWTGLGQAATVAQLVGADVGGLISMIVQAAMTARQNRSECEQLARRVLMIAQLLPHVQ  60

Query  528  ITE  536
              E
Sbjct  61   EPE  63



>gb|EMT23150.1| hypothetical protein F775_17508 [Aegilops tauschii]
Length=173

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  384  VAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +AQL G+DA  LI MIV+AA T + +++ C+  A+ +K+IG+LL+QL+ T+L
Sbjct  1    MAQLAGVDAYGLITMIVEAARTVRRNRETCQLLARRVKMIGDLLQQLESTQL  52



>ref|XP_004979334.1| PREDICTED: putative serine/threonine-protein kinase-like protein 
CCR3-like [Setaria italica]
Length=519

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  536
            W  LG  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  +G LL+ L+  E
Sbjct  2    WTVLGQAATVAQLVGADVGGLISMIIQAAVTAQQNKKECEQLARRVFTVGELLQHLQDPE  61

Query  537  L  539
            +
Sbjct  62   V  62



>gb|EMS46805.1| Putative serine/threonine-protein kinase-like protein CCR3 [Triticum 
urartu]
Length=727

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI MIV+AA TA+ +K  C Q A+ + +I  LL  ++
Sbjct  1    MALWTGLGQAATVAQLVGADVGGLISMIVQAAMTARQNKSECEQLARRVLMIAQLLPHVQ  60

Query  528  ITE  536
              E
Sbjct  61   EPE  63



>gb|ADB85257.1| putative retrotransposon protein [Phyllostachys edulis]
Length=2039

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIG  506
            W  LG  ++V QL G+DA+ L+ M+V+AA  A+ H+  C + AQH++++G
Sbjct  282  WNTLGQASSVVQLVGVDALGLVSMVVQAALAARRHRDACMRLAQHVEIVG  331



>ref|XP_007008883.1| PLAC8 family protein [Theobroma cacao]
 gb|EOY17693.1| PLAC8 family protein [Theobroma cacao]
Length=385

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  396  TGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
             G++++ L  +I+ +A  A MH+ NC Q A+H+KLIGNLLE+LK T L
Sbjct  3    PGLNSLGLTTLILSSARNASMHRNNCEQLAEHVKLIGNLLEKLKSTNL  50



>gb|ABA95208.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ19224.1| hypothetical protein OsJ_34764 [Oryza sativa Japonica Group]
Length=993

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  536
            WE +  +A +AQLTG+DA+ LI  IV+AA     +K+ C++  Q ++LI +LL  L+  E
Sbjct  435  WEGMDRMATIAQLTGVDALGLISTIVQAAQAVCRNKETCQELVQEIQLIRDLLRMLQDPE  494

Query  537  L  539
            +
Sbjct  495  M  495


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG    VAQL G D   LI +I+KAA TA+ +K+ C Q A+ + +I  LL  L+
Sbjct  1    MALWGGLGQATTVAQLVGADVGGLISVIMKAALTAQQNKE-CEQLARRVFMIAELLPHLQ  59

Query  528  ITEL  539
              E+
Sbjct  60   DPEV  63



>gb|EMT11112.1| Putative serine/threonine-protein kinase-like protein CCR3 [Aegilops 
tauschii]
Length=339

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI M ++AA TA+ +KK C Q A+ + LI  LL Q++
Sbjct  1    MALWTGLGQAATVAQLVGADIGGLISMFMQAALTARQNKKECEQLARRVLLIAQLLPQVQ  60

Query  528  ITE  536
              E
Sbjct  61   DRE  63



>gb|EMT06234.1| hypothetical protein F775_14004 [Aegilops tauschii]
Length=174

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI MIV+AA TA+ ++  C Q  + + +I  LL  ++
Sbjct  1    MALWTGLGQAATVAQLVGTDVGGLISMIVQAALTARQNRSECEQLVRRVLMIAQLLPHVQ  60

Query  528  ITE  536
              E
Sbjct  61   EQE  63



>ref|NP_001066816.1| Os12g0499200 [Oryza sativa Japonica Group]
 gb|ABA98609.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29835.1| Os12g0499200 [Oryza sativa Japonica Group]
 gb|EAZ20572.1| hypothetical protein OsJ_36181 [Oryza sativa Japonica Group]
Length=353

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG+ A  AQL G+D   LI  I++AA+TA+ +KK C Q A  + +I  +L Q++
Sbjct  1    MALWSGLGEAATAAQLVGVDLGGLISNIIQAAATARQNKKECEQLAGRVSMIDEILSQMQ  60

Query  528  ITE  536
             ++
Sbjct  61   ESD  63



>gb|EAY92100.1| hypothetical protein OsI_13806 [Oryza sativa Indica Group]
Length=539

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  I  LL+ L+
Sbjct  1    MALWGGLGQAATVAQLVGADIGGLITMIMQAAMTAQQNKKECEQLARRIFTIAELLQHLQ  60

Query  528  ITEL  539
              E+
Sbjct  61   DPEV  64



>ref|XP_004984958.1| PREDICTED: putative serine/threonine-protein kinase-like protein 
CCR3-like [Setaria italica]
Length=459

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  536
            W  L + A VAQLTG+DA+ LI  I +AA TA+ ++++C   A+ + ++  LL  L+  E
Sbjct  2    WGGLANAATVAQLTGVDALGLISKIRQAARTARQNRRDCEHLARRVDMLAELLPSLRDPE  61



>gb|EEC76280.1| hypothetical protein OsI_13781 [Oryza sativa Indica Group]
Length=476

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +3

Query  357  WENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITE  536
            W  LG  A VAQL G D   LI +I++AA TA+ +KK C Q A+ + +I  LL  L+  E
Sbjct  2    WSGLGQAATVAQLVGADVGSLISVIMQAAMTARQNKKECEQLARRVFMIAELLPHLQDPE  61

Query  537  L  539
            +
Sbjct  62   V  62



>ref|NP_001068421.1| Os11g0666200 [Oryza sativa Japonica Group]
 gb|ABA95156.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28784.1| Os11g0666200 [Oryza sativa Japonica Group]
 gb|EAZ19221.1| hypothetical protein OsJ_34761 [Oryza sativa Japonica Group]
Length=537

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  I  LL+ L+
Sbjct  1    MALWGGLGQAATVAQLVGADIGGLITMIMQAAMTAQQNKKECEQLARRVFTIAELLQHLQ  60

Query  528  ITEL  539
              E+
Sbjct  61   DPEV  64



>gb|EMT18704.1| Putative serine/threonine-protein kinase-like protein CCR3 [Aegilops 
tauschii]
Length=560

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLL  515
            M  W  L D+A VAQL G D   LI +I+ AA TA+ +++ CRQ A+ + +I  LL
Sbjct  1    MTLWSELSDVATVAQLVGADVAGLISVIMLAAETARQNRRECRQLARRVLIISRLL  56



>ref|XP_006575552.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X2 [Glycine max]
Length=384

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            + N+AQ+ G++AM +   ++ AA  A+ H++NC + A  +++I NLLE LK TE+
Sbjct  1    MENLAQVAGLNAMSVTNTVITAAHNARAHRRNCERMAAQVRMIWNLLEALKSTEV  55



>gb|EEE52537.1| hypothetical protein OsJ_34760 [Oryza sativa Japonica Group]
Length=202

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            +A W+  G  A VAQL G D   LI MI++AA TA+ +KK C Q A+ +  I  LL+ L+
Sbjct  32   IALWDVTGHAATVAQLVGADVGGLISMIMQAAMTAQQNKKECEQLARRVFTIAELLQHLQ  91

Query  528  ITEL  539
              E+
Sbjct  92   DPEV  95



>ref|XP_003518431.1| PREDICTED: protein MID1-COMPLEMENTING ACTIVITY 1-like isoform 
X1 [Glycine max]
Length=403

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  375  LANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            + N+AQ+ G++AM +   ++ AA  A+ H++NC + A  +++I NLLE LK TE+
Sbjct  1    MENLAQVAGLNAMSVTNTVITAAHNARAHRRNCERMAAQVRMIWNLLEALKSTEV  55



>dbj|BAJ94547.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A +AQL G D   LI MIV+AA TA+ ++  C Q A+ + +I  LL  ++
Sbjct  8    MAVWTGLGQAATLAQLVGADVGGLISMIVQAALTARQNRSECEQLARRVLMIAQLLPHVE  67

Query  528  ITE  536
              E
Sbjct  68   EPE  70



>gb|ABA95276.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=483

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MAS E +   AN+AQLTG+DA+ LI MIV+AA  A+ +K+ C + A+ ++ +G+LL  L+
Sbjct  1    MAS-EAVSMAANIAQLTGVDALGLITMIVEAAKAARRNKRTCLELARLVEQVGDLLRALQ  59



>gb|EEC68569.1| hypothetical protein OsI_36900 [Oryza sativa Indica Group]
Length=373

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  378  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            AN+AQLTG+DA+ LI MIV+AA  A+ +K+ C + A+ ++ +G+LL  L+
Sbjct  10   ANIAQLTGVDALGLITMIVEAAKAARRNKRTCLELARLVEQVGDLLRALQ  59



>gb|EEE52504.1| hypothetical protein OsJ_34707 [Oryza sativa Japonica Group]
Length=483

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MAS E +   AN+AQLTG+DA+ LI MIV+AA  A+ +K+ C + A+ ++ +G+LL  L+
Sbjct  1    MAS-EAVSMAANIAQLTGVDALGLITMIVEAAKAARRNKRTCLELARLVEQVGDLLRALQ  59



>gb|EEC71170.1| hypothetical protein OsI_03036 [Oryza sativa Indica Group]
 gb|EEE52505.1| hypothetical protein OsJ_34708 [Oryza sativa Japonica Group]
Length=152

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  378  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  524
            + +AQ  G+DA  LI MI +AA T + ++  C Q A+ LK+IG+LL+QL
Sbjct  8    STIAQFAGVDAYGLIKMIAEAAQTVRRNRATCLQLARRLKMIGDLLKQL  56



>gb|EEC72318.1| hypothetical protein OsI_05511 [Oryza sativa Indica Group]
Length=455

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  381  NVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            ++A L G+DA+KL+ MIV+AA   + +KK C+Q   H++++G+LL++L+ +E+
Sbjct  2    DLAHLAGLDAVKLVRMIVQAAQKVRHNKKICQQLVHHVQIVGDLLKKLQTSEM  54



>gb|EAY92077.1| hypothetical protein OsI_13782 [Oryza sativa Indica Group]
Length=509

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            MA W  LG  A VAQL G D   +I  I++AA+ A+ +KK C Q A+ + +I +LL  L+
Sbjct  1    MALWGGLGQAATVAQLVGADVGGVISKIIQAAAMAQQNKKECDQLARRVLMIADLLPHLQ  60

Query  528  ITEL  539
              E+
Sbjct  61   DPEV  64



>gb|EMS49964.1| hypothetical protein TRIUR3_26988 [Triticum urartu]
Length=157

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  366  LGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLKITEL  539
            +G  A VAQ  G+DA  +I MI  AA T + ++  C Q A+  K+IG+LL QL   +L
Sbjct  4    VGQAAMVAQFAGVDAYGIIKMIADAAQTVRRNRATCLQLARRAKMIGDLLHQLHAAQL  61



>ref|NP_001068433.1| Os11g0672300 [Oryza sativa Japonica Group]
 gb|ABA95277.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABA95278.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28796.1| Os11g0672300 [Oryza sativa Japonica Group]
 dbj|BAG89898.1| unnamed protein product [Oryza sativa Japonica Group]
Length=214

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  378  ANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQL  524
            + +AQ  G+DA  LI MI +AA T + ++  C Q A+ LK+IG+LL+QL
Sbjct  8    STIAQFAGVDAYGLIKMIAEAAQTVRRNRATCLQLARRLKMIGDLLKQL  56



>dbj|BAK02708.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  348  MASWENLGDLANVAQLTGIDAMKLIGMIVKAASTAKMHKKNCRQFAQHLKLIGNLLEQLK  527
            M  W  L ++A VAQL G D   LI  I +AA TA+ +++ C+Q A+ + +I  LL  ++
Sbjct  4    MTLWSELSEVATVAQLVGADVGGLISRITQAAETARQNRRECQQLARRVLIISRLLPLVE  63

Query  528  ITE  536
              E
Sbjct  64   DPE  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645