BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006H22

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAL89713.1|AF483213_1  actin                                         317   1e-107   Maurandya barclayana
gb|AEQ75505.1|  actin                                                   315   1e-106   Davidia involucrata
gb|ADN37689.1|  actin                                                   313   4e-106   Asarum europaeum
dbj|BAM48917.1|  actin                                                  315   6e-106   Eriobotrya japonica [loquat]
ref|XP_011091473.1|  PREDICTED: actin-11                                320   7e-106   Sesamum indicum [beniseed]
gb|AHJ78382.1|  actin                                                   315   1e-105   Cydonia oblonga [wen po]
gb|ACV71031.1|  truncated beta-actin                                    313   1e-105   Agropyron cristatum [crested wheatgrass]
dbj|BAF68888.1|  actin 4                                                316   1e-105   Torenia fournieri [bluewings]
dbj|BAF68887.1|  actin 3                                                316   1e-105   Torenia fournieri [bluewings]
sp|P93584.1|ACT9_SOLTU  RecName: Full=Actin-82                          318   1e-105   Solanum tuberosum [potatoes]
gb|AIY35293.1|  actin                                                   317   2e-105   Arachis hypogaea [goober]
ref|XP_004241231.1|  PREDICTED: actin-82                                319   2e-105   Solanum lycopersicum
gb|EMT21476.1|  Actin-1                                                 318   2e-105   
gb|AIY27746.1|  actin                                                   314   2e-105   Betula luminifera [liang ye hua]
gb|ADL59374.2|  actin 4                                                 318   2e-105   Ipomoea nil [qian niu]
gb|ACD31684.1|  beta actin                                              312   2e-105   Medicago sativa [alfalfa]
gb|ACL80038.1|  actin                                                   312   3e-105   Puccinellia tenuiflora
gb|ABV44412.1|  actin                                                   315   3e-105   Nelumbo nucifera [Indian lotus]
sp|P81228.1|ACT5_SOLTU  RecName: Full=Actin-66                          317   3e-105   Solanum tuberosum [potatoes]
ref|XP_008458877.1|  PREDICTED: actin-82-like isoform X1                317   3e-105   
dbj|BAK06400.1|  predicted protein                                      318   3e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAZ74664.1|  actin                                                   314   3e-105   Cucumis sativus [cucumbers]
sp|P93371.1|ACT5_TOBAC  RecName: Full=Actin-93                          317   4e-105   Nicotiana tabacum [American tobacco]
gb|KGN50545.1|  hypothetical protein Csa_5G182010                       314   4e-105   Cucumis sativus [cucumbers]
gb|ABY66084.1|  actin                                                   313   4e-105   Dimocarpus longan [longan]
gb|AED89636.1|  actin 2                                                 313   5e-105   Rubus plicatus
gb|ABK96176.1|  unknown                                                 315   5e-105   Populus trichocarpa [western balsam poplar]
gb|AAB40075.1|  actin                                                   316   5e-105   Glycine max [soybeans]
gb|ACZ72941.1|  actin                                                   311   5e-105   Corchorus capsularis [jute]
ref|XP_010690498.1|  PREDICTED: actin-1                                 318   5e-105   Beta vulgaris subsp. vulgaris [field beet]
gb|AGC31654.1|  actin 1                                                 313   5e-105   Prunus maritima [beach plum]
gb|AHC72438.1|  actin                                                   311   6e-105   Halogeton glomeratus
dbj|BAF96593.1|  actin                                                  314   6e-105   Rosa hybrid cultivar
dbj|BAC07538.1|  actin                                                  310   6e-105   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|ACT78692.1|  actin                                                   311   6e-105   Thalictrum thalictroides [rue-anemone]
gb|AFJ93198.1|  actin                                                   310   7e-105   Eremosparton songoricum
gb|AEY77415.1|  actin                                                   313   7e-105   Cirsium setosum
ref|XP_009397437.1|  PREDICTED: actin-like                              317   7e-105   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP00088.1|  unnamed protein product                                317   8e-105   Coffea canephora [robusta coffee]
gb|AED89634.1|  actin 1                                                 313   8e-105   Rubus plicatus
ref|XP_006350765.1|  PREDICTED: actin-like                              317   8e-105   Solanum tuberosum [potatoes]
gb|ADP89573.1|  actin-like protein                                      311   8e-105   Oncidium hybrid cultivar
gb|AHA91827.1|  actin-4                                                 315   8e-105   Rosa hybrid cultivar
ref|XP_004250955.1|  PREDICTED: actin-97-like                           317   8e-105   
ref|XP_009409104.1|  PREDICTED: actin-like                              317   9e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009802880.1|  PREDICTED: actin-like                              317   9e-105   Nicotiana sylvestris
ref|XP_008382817.1|  PREDICTED: actin                                   317   9e-105   Malus domestica [apple tree]
gb|ACZ56138.1|  beta-actin                                              310   1e-104   Microula sikkimensis
gb|ACF75872.1|  beta-actin                                              310   1e-104   Pericallis cruenta
gb|AED89637.1|  actin 2                                                 312   1e-104   Rubus idaeus [European raspberry]
gb|ACL78791.1|  actin                                                   311   1e-104   Solanum lycopersicum
gb|AFK48206.1|  unknown                                                 312   1e-104   Lotus japonicus
gb|AAF40438.1|AF234528_2  actin 1                                       317   1e-104   Avena nuda
gb|EPS60057.1|  hypothetical protein M569_14747                         317   1e-104   Genlisea aurea
gb|ACL50999.1|  actin                                                   310   1e-104   Artemisia sphaerocephala
dbj|BAF45152.1|  actin                                                  312   1e-104   Scoparia dulcis [escobilla]
gb|ABK21898.1|  unknown                                                 312   1e-104   Picea sitchensis
gb|EPS69960.1|  actin-97                                                317   1e-104   Genlisea aurea
ref|XP_010520033.1|  PREDICTED: actin-1-like                            317   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_010534357.1|  PREDICTED: actin-1-like                            317   1e-104   Tarenaya hassleriana [spider flower]
sp|Q96484.1|ACT3_SOLLC  RecName: Full=Actin-52                          315   1e-104   Solanum lycopersicum
gb|ACU27913.1|  actin                                                   312   1e-104   Glycine max [soybeans]
gb|ACU27917.1|  actin                                                   312   1e-104   Malus domestica [apple tree]
ref|XP_010685773.1|  PREDICTED: actin-66                                317   2e-104   Beta vulgaris subsp. vulgaris [field beet]
emb|CAE51207.1|  putative actin                                         312   2e-104   Lolium multiflorum
ref|XP_009621805.1|  PREDICTED: actin-like                              317   2e-104   Nicotiana tomentosiformis
gb|AAG43040.1|  actin                                                   310   2e-104   Lolium perenne [perennial ryegrass]
dbj|BAC55931.1|  actin 1                                                310   2e-104   Matricaria chamomilla
gb|AFW82906.1|  putative actin family protein                           311   2e-104   
gb|AGC31655.1|  actin 2                                                 311   2e-104   Prunus maritima [beach plum]
ref|XP_011080749.1|  PREDICTED: actin-1-like                            316   2e-104   Sesamum indicum [beniseed]
ref|XP_007016434.1|  Actin 3 isoform 3                                  314   2e-104   
gb|ACU27906.1|  actin                                                   311   2e-104   Vicia faba [broad bean]
ref|XP_009625006.1|  PREDICTED: actin-like                              316   2e-104   Nicotiana tomentosiformis
gb|AGI78241.1|  actin 7                                                 313   2e-104   Caragana korshinskii
gb|ABI51282.1|  actin                                                   311   2e-104   Hibiscus cannabinus [bimli-jute]
gb|ADN37687.1|  actin                                                   309   2e-104   Houttuynia cordata [chameleon-plant]
gb|ACJ05350.1|  actin                                                   311   2e-104   Camellia sinensis [black tea]
emb|CDP12785.1|  unnamed protein product                                316   2e-104   Coffea canephora [robusta coffee]
gb|AAC49651.1|  actin                                                   316   2e-104   Striga asiatica [witchweed]
gb|ACU27915.1|  actin                                                   311   2e-104   Castanea sativa
gb|AEV59655.1|  actin                                                   311   2e-104   Oxytropis arctobia
gb|ACU27905.1|  actin                                                   311   2e-104   Capsicum annuum
gb|ACU80552.1|  putative actin protein                                  311   2e-104   Jatropha curcas
gb|ADN37688.1|  actin                                                   309   2e-104   Berberis julianae
ref|XP_006351346.1|  PREDICTED: actin-58-like                           316   2e-104   Solanum tuberosum [potatoes]
gb|AAL89712.1|AF483212_1  actin                                         309   2e-104   Alonsoa meridionalis
gb|ADK98519.1|  actin                                                   309   3e-104   Leymus chinensis
dbj|BAI59710.1|  actin                                                  312   3e-104   Lobelia erinus
ref|XP_004239790.1|  PREDICTED: actin-58                                316   3e-104   Solanum lycopersicum
ref|XP_003560589.1|  PREDICTED: actin-1                                 316   3e-104   Brachypodium distachyon [annual false brome]
ref|XP_011078821.1|  PREDICTED: actin                                   316   3e-104   Sesamum indicum [beniseed]
gb|AEE98359.1|  actin                                                   312   3e-104   Deschampsia antarctica
dbj|BAF36000.1|  actin                                                  312   3e-104   Rosa hybrid cultivar
sp|P81229.1|ACT8_SOLTU  RecName: Full=Actin-79                          314   3e-104   Solanum tuberosum [potatoes]
gb|KDO70920.1|  hypothetical protein CISIN_1g017089mg                   314   3e-104   Citrus sinensis [apfelsine]
ref|XP_007009346.1|  Actin-11 isoform 1                                 315   3e-104   Theobroma cacao [chocolate]
dbj|BAN13564.1|  actin                                                  312   3e-104   Chrysanthemum seticuspe f. boreale
gb|KHN24335.1|  Actin-97                                                314   4e-104   Glycine soja [wild soybean]
dbj|BAA21108.1|  actin                                                  310   4e-104   Gossypium hirsutum [American cotton]
gb|KDO67622.1|  hypothetical protein CISIN_1g017081mg                   315   4e-104   Citrus sinensis [apfelsine]
gb|AED89635.1|  actin 1                                                 311   4e-104   Rubus idaeus [European raspberry]
ref|XP_009787806.1|  PREDICTED: actin-like                              315   4e-104   Nicotiana sylvestris
gb|ABG49391.1|  actin 1                                                 315   4e-104   Torenia fournieri [bluewings]
gb|ACU27911.1|  actin                                                   311   4e-104   Rubus idaeus [European raspberry]
gb|AEV59660.1|  actin                                                   311   5e-104   Oxytropis maydelliana
dbj|BAD93480.1|  putative actin                                         308   5e-104   Tricyrtis hirta
ref|XP_007009347.1|  Actin-11 isoform 2                                 315   5e-104   
ref|XP_009388742.1|  PREDICTED: actin-like                              315   5e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003622020.1|  Actin                                              315   5e-104   
gb|AAZ74666.1|  actin                                                   311   5e-104   Cucumis sativus [cucumbers]
dbj|BAH23584.1|  actin                                                  311   5e-104   Morus alba
gb|ACU27919.1|  actin                                                   311   5e-104   Triticum aestivum [Canadian hard winter wheat]
gb|ACU27904.1|  actin                                                   310   5e-104   Solanum tuberosum [potatoes]
gb|KDP44962.1|  hypothetical protein JCGZ_01462                         315   5e-104   Jatropha curcas
ref|XP_010524532.1|  PREDICTED: actin-1-like                            315   6e-104   Tarenaya hassleriana [spider flower]
ref|XP_006345961.1|  PREDICTED: actin-58-like                           315   6e-104   Solanum tuberosum [potatoes]
ref|XP_006297921.1|  hypothetical protein CARUB_v10013962mg             315   6e-104   Capsella rubella
ref|XP_004156708.1|  PREDICTED: actin-97-like                           315   6e-104   
gb|AGK45317.1|  actin                                                   313   6e-104   Aloe arborescens
gb|AEV59659.1|  actin                                                   310   6e-104   Oxytropis campestris subsp. johannensis
dbj|BAJ85474.1|  predicted protein                                      315   6e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADK11998.1|  putative actin protein                                  315   6e-104   Salvia miltiorrhiza [Chinese salvia]
sp|P30167.1|ACT3_SOLTU  RecName: Full=Actin-58                          315   6e-104   Solanum tuberosum [potatoes]
ref|XP_004142758.1|  PREDICTED: actin-1-like                            315   6e-104   
ref|XP_003525105.1|  PREDICTED: actin-7-like                            315   7e-104   
ref|XP_003575839.1|  PREDICTED: actin-1-like                            315   7e-104   Brachypodium distachyon [annual false brome]
sp|P93372.1|ACT4_TOBAC  RecName: Full=Actin-66                          313   7e-104   Nicotiana tabacum [American tobacco]
gb|AIM48894.1|  actin                                                   313   7e-104   Cinnamomum camphora
ref|XP_009773924.1|  PREDICTED: actin                                   315   7e-104   Nicotiana sylvestris
emb|CDP10143.1|  unnamed protein product                                315   7e-104   Coffea canephora [robusta coffee]
gb|AEL88913.1|  actin                                                   311   7e-104   Halodule beaudettei
ref|NP_001276160.1|  actin-11-like                                      315   7e-104   
gb|AFC98748.1|  actin                                                   309   7e-104   Halocnemum strobilaceum
ref|XP_010520278.1|  PREDICTED: actin-like                              315   7e-104   Tarenaya hassleriana [spider flower]
gb|KJB76652.1|  hypothetical protein B456_012G100700                    315   7e-104   Gossypium raimondii
sp|P30172.1|ACT12_SOLTU  RecName: Full=Actin-100                        314   7e-104   Solanum tuberosum [potatoes]
gb|AFP43693.1|  actin 1                                                 310   7e-104   Eriobotrya japonica [loquat]
ref|XP_002882767.1|  actin-11                                           315   8e-104   
gb|AIM48891.1|  actin                                                   313   8e-104   Cinnamomum camphora
gb|KJB76651.1|  hypothetical protein B456_012G100700                    315   8e-104   Gossypium raimondii
gb|KJB76649.1|  hypothetical protein B456_012G100700                    314   9e-104   Gossypium raimondii
gb|AIM48892.1|  actin                                                   313   9e-104   Cinnamomum camphora
dbj|BAI39620.1|  beta actin                                             311   9e-104   Bruguiera gymnorhiza [Burma mangrove]
gb|AEL88911.1|  actin                                                   311   9e-104   Halodule beaudettei
dbj|BAD93481.1|  putative actin                                         308   9e-104   Tricyrtis hirta
gb|KJB76650.1|  hypothetical protein B456_012G100700                    314   9e-104   Gossypium raimondii
ref|XP_008345452.1|  PREDICTED: actin                                   314   9e-104   
gb|EAY79170.1|  hypothetical protein OsI_34279                          311   9e-104   Oryza sativa Indica Group [Indian rice]
gb|ACB40932.1|  actin 1                                                 310   1e-103   Artemisia annua [sweet Annie]
ref|XP_003622019.1|  Actin                                              314   1e-103   Medicago truncatula
dbj|BAK18562.1|  actin                                                  313   1e-103   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_011099798.1|  PREDICTED: actin-1-like                            314   1e-103   Sesamum indicum [beniseed]
gb|AFK41203.1|  unknown                                                 314   1e-103   Medicago truncatula
dbj|BAL14664.1|  actin                                                  314   1e-103   Chrysanthemum seticuspe f. boreale
gb|KHF98940.1|  hypothetical protein F383_05741                         314   1e-103   Gossypium arboreum [tree cotton]
gb|AGW21693.1|  actin 1                                                 308   1e-103   Beta vulgaris [beet]
gb|EYU33199.1|  hypothetical protein MIMGU_mgv1a008335mg                314   1e-103   Erythranthe guttata [common monkey flower]
ref|XP_008241048.1|  PREDICTED: actin                                   314   1e-103   Prunus mume [ume]
ref|XP_010528400.1|  PREDICTED: actin-1                                 314   1e-103   Tarenaya hassleriana [spider flower]
gb|AAV83798.1|  putative actin 2                                        314   1e-103   Chorispora bungeana
ref|XP_010553283.1|  PREDICTED: actin                                   314   1e-103   Tarenaya hassleriana [spider flower]
ref|XP_007027035.1|  Actin 3                                            314   1e-103   Theobroma cacao [chocolate]
ref|XP_010554872.1|  PREDICTED: actin-1                                 314   1e-103   Tarenaya hassleriana [spider flower]
emb|CDP09045.1|  unnamed protein product                                314   1e-103   Coffea canephora [robusta coffee]
ref|XP_008458880.1|  PREDICTED: actin-82-like isoform X3                315   1e-103   
gb|AEY82383.1|  actin                                                   311   1e-103   Chrysanthemum lavandulifolium
gb|AGZ90152.1|  actin 11                                                314   1e-103   Litsea cubeba [may chang]
gb|AAC49652.1|  actin                                                   314   1e-103   Striga asiatica [witchweed]
gb|EPS69959.1|  actin                                                   314   1e-103   Genlisea aurea
ref|XP_002530711.1|  actin, putative                                    314   1e-103   Ricinus communis
ref|XP_006351818.1|  PREDICTED: actin-101-like                          314   1e-103   Solanum tuberosum [potatoes]
sp|P30171.1|ACT11_SOLTU  RecName: Full=Actin-97                         314   2e-103   Solanum tuberosum [potatoes]
ref|NP_187818.1|  actin-11                                              314   2e-103   Arabidopsis thaliana [mouse-ear cress]
sp|P30173.1|ACT13_SOLTU  RecName: Full=Actin-101                        314   2e-103   Solanum tuberosum [potatoes]
ref|XP_007016432.1|  Actin-11 isoform 1                                 314   2e-103   Theobroma cacao [chocolate]
ref|XP_004236747.1|  PREDICTED: actin-97                                314   2e-103   
gb|AFO53510.1|  actin                                                   313   2e-103   Freesia hybrid cultivar
ref|XP_004960554.1|  PREDICTED: actin-97-like                           314   2e-103   Setaria italica
ref|XP_002283590.1|  PREDICTED: actin-1                                 314   2e-103   Vitis vinifera
gb|AGA61748.1|  actin                                                   311   2e-103   Rhus chinensis
ref|XP_010922421.1|  PREDICTED: actin-100-like isoform X2               312   2e-103   
ref|XP_009618901.1|  PREDICTED: actin                                   314   2e-103   Nicotiana tomentosiformis
ref|XP_007205365.1|  hypothetical protein PRUPE_ppa007214mg             314   2e-103   Prunus persica
ref|NP_001051086.1|  Os03g0718100                                       314   2e-103   
gb|AFZ78523.1|  actin                                                   314   2e-103   Populus tomentosa [Chinese white poplar]
gb|ABU68265.1|  actin                                                   311   2e-103   Prunus salicina [Japanese plum]
ref|NP_001275087.1|  actin-like                                         314   2e-103   Solanum tuberosum [potatoes]
gb|KHN27489.1|  Actin-97                                                312   2e-103   Glycine soja [wild soybean]
ref|XP_008354115.1|  PREDICTED: actin-1                                 314   2e-103   
ref|XP_004230564.1|  PREDICTED: actin-101                               313   2e-103   
gb|AAZ74665.1|  actin                                                   310   2e-103   Cucumis sativus [cucumbers]
ref|XP_010557948.1|  PREDICTED: actin-1-like                            313   2e-103   Tarenaya hassleriana [spider flower]
gb|AID66748.1|  actin protein                                           310   2e-103   Robinia pseudoacacia [black locust]
ref|XP_010498525.1|  PREDICTED: actin-11                                313   2e-103   Camelina sativa [gold-of-pleasure]
gb|KHG29811.1|  Actin                                                   313   2e-103   Gossypium arboreum [tree cotton]
gb|AFO68183.1|  actin                                                   310   2e-103   Anthurium andraeanum [flamingo-lily]
gb|AFU25697.1|  actin                                                   312   2e-103   Freesia hybrid cultivar
gb|ACJ05348.1|  actin                                                   308   2e-103   Camellia sinensis [black tea]
gb|AAB40078.1|  actin                                                   312   2e-103   Glycine max [soybeans]
gb|AEV59658.1|  actin                                                   310   2e-103   Oxytropis arctobia
gb|ABP01541.1|  actin                                                   309   2e-103   Phalaris canariensis
gb|AEV59661.1|  actin                                                   310   2e-103   Oxytropis splendens
gb|AEV59656.1|  actin                                                   310   2e-103   Oxytropis maydelliana
gb|AAX07755.1|  actin                                                   307   2e-103   Carica papaya [mamon]
gb|AEF58501.1|  actin                                                   313   2e-103   Platycodon grandiflorus [balloon-flower]
ref|XP_008363858.1|  PREDICTED: LOW QUALITY PROTEIN: actin-like         313   2e-103   Malus domestica [apple tree]
ref|XP_010682856.1|  PREDICTED: actin-11                                313   2e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001054419.1|  Os05g0106600                                       313   2e-103   
ref|XP_010111138.1|  hypothetical protein L484_010751                   313   2e-103   Morus notabilis
gb|ADK20401.1|  actin                                                   313   2e-103   Citrus maxima [buntan]
ref|XP_009381444.1|  PREDICTED: actin-like                              313   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010106464.1|  hypothetical protein L484_025221                   313   3e-103   Morus notabilis
ref|XP_002308365.1|  actin family protein                               313   3e-103   Populus trichocarpa [western balsam poplar]
ref|XP_008355144.1|  PREDICTED: actin                                   313   3e-103   Malus domestica [apple tree]
ref|XP_004302738.1|  PREDICTED: actin                                   313   3e-103   Fragaria vesca subsp. vesca
ref|NP_001239660.1|  uncharacterized protein LOC100781831               313   3e-103   Glycine max [soybeans]
gb|AAB18643.1|  actin                                                   310   3e-103   Pisum sativum [garden pea]
ref|XP_004492148.1|  PREDICTED: actin-11-like                           313   3e-103   Cicer arietinum [garbanzo]
gb|EYU20691.1|  hypothetical protein MIMGU_mgv1a008334mg                313   3e-103   Erythranthe guttata [common monkey flower]
ref|XP_010111359.1|  hypothetical protein L484_028016                   313   3e-103   Morus notabilis
gb|ADY38689.1|  actin                                                   313   3e-103   Camellia sinensis [black tea]
gb|ABR22550.1|  actin                                                   310   3e-103   Storeatula sp. CCMP1868
gb|KHN13906.1|  Actin-11                                                313   3e-103   Glycine soja [wild soybean]
ref|XP_008385127.1|  PREDICTED: actin                                   313   3e-103   Malus domestica [apple tree]
ref|XP_007028993.1|  Actin-11                                           313   3e-103   
ref|XP_007204362.1|  hypothetical protein PRUPE_ppa007228mg             313   3e-103   Prunus persica
ref|XP_004304361.1|  PREDICTED: actin-like                              313   3e-103   Fragaria vesca subsp. vesca
gb|AFK40690.1|  unknown                                                 313   3e-103   Lotus japonicus
gb|KJB76087.1|  hypothetical protein B456_012G070300                    313   3e-103   Gossypium raimondii
gb|AAB40077.1|  actin                                                   311   3e-103   Glycine max [soybeans]
ref|XP_009759480.1|  PREDICTED: actin-101                               313   3e-103   Nicotiana sylvestris
ref|XP_006429882.1|  hypothetical protein CICLE_v10011974mg             313   3e-103   Citrus clementina [clementine]
ref|XP_006846523.1|  hypothetical protein AMTR_s00018p00188200          313   3e-103   Amborella trichopoda
gb|AFD62269.1|  actin 2                                                 313   3e-103   Annona cherimola [cherimoya]
ref|XP_004142070.1|  PREDICTED: actin-like                              313   3e-103   
dbj|BAD93483.1|  putative actin                                         307   3e-103   Agapanthus praecox subsp. orientalis
ref|XP_010265918.1|  PREDICTED: actin                                   313   3e-103   Nelumbo nucifera [Indian lotus]
ref|XP_009341422.1|  PREDICTED: actin-like                              313   3e-103   Pyrus x bretschneideri [bai li]
gb|AEL88498.1|  actin                                                   310   3e-103   Syringodium filiforme
ref|XP_004136568.1|  PREDICTED: actin-like                              313   3e-103   Cucumis sativus [cucumbers]
gb|AEI27257.1|  actin                                                   310   3e-103   Halodule beaudettei
dbj|BAD93482.1|  putative actin                                         306   3e-103   Agapanthus praecox subsp. orientalis
gb|AEI27262.1|  actin                                                   310   3e-103   Halodule beaudettei
gb|KJB18789.1|  hypothetical protein B456_003G069800                    311   3e-103   Gossypium raimondii
ref|XP_006855625.1|  hypothetical protein AMTR_s00044p00088410          314   3e-103   
sp|Q96482.1|ACT1_SOLLC  RecName: Full=Actin-41                          311   3e-103   Solanum lycopersicum
gb|AHL58686.1|  actin                                                   306   3e-103   Thinopyrum elongatum [tall wheatgrass]
gb|AFN53639.1|  putative actin-97 protein                               313   3e-103   Linum usitatissimum
gb|AEO45960.1|  actin 4                                                 313   3e-103   Mangifera indica
ref|XP_007041601.1|  Actin 7 isoform 1                                  313   3e-103   Theobroma cacao [chocolate]
ref|XP_002279672.1|  PREDICTED: actin-66                                313   4e-103   Vitis vinifera
ref|XP_008795328.1|  PREDICTED: actin-1                                 313   4e-103   Phoenix dactylifera
gb|ABR22545.1|  actin                                                   309   4e-103   Chroomonas mesostigmatica
ref|XP_006854536.1|  hypothetical protein AMTR_s00030p00045700          313   4e-103   Amborella trichopoda
gb|AAB40085.1|  actin                                                   311   4e-103   Glycine max [soybeans]
gb|ADB27919.1|  actin                                                   310   4e-103   Hevea brasiliensis [jebe]
ref|XP_010257475.1|  PREDICTED: actin                                   313   4e-103   Nelumbo nucifera [Indian lotus]
gb|AFR36919.1|  actin                                                   311   4e-103   Adonis aestivalis [summer pheasant's eye]
gb|ADP09679.1|  actin isoform PEAc14-1                                  313   4e-103   Pisum sativum [garden pea]
gb|AEL88500.1|  actin                                                   310   4e-103   Syringodium filiforme
gb|EEE62039.1|  hypothetical protein OsJ_16821                          313   4e-103   Oryza sativa Japonica Group [Japonica rice]
gb|AIM48893.1|  actin                                                   311   4e-103   Cinnamomum camphora
ref|XP_004981971.1|  PREDICTED: actin-1-like isoform X2                 313   4e-103   
dbj|BAO04185.1|  actin                                                  310   4e-103   Delphinium grandiflorum
ref|XP_010936865.1|  PREDICTED: actin                                   313   4e-103   Elaeis guineensis
ref|XP_010905701.1|  PREDICTED: actin-101-like                          313   4e-103   Elaeis guineensis
gb|KHF99778.1|  Actin                                                   313   4e-103   Gossypium arboreum [tree cotton]
ref|XP_010067406.1|  PREDICTED: actin-1-like                            313   4e-103   Eucalyptus grandis [rose gum]
gb|EPS68331.1|  hypothetical protein M569_06438                         313   4e-103   Genlisea aurea
dbj|BAD27408.1|  actin                                                  313   4e-103   Nicotiana tabacum [American tobacco]
ref|XP_008776351.1|  PREDICTED: actin-101                               313   4e-103   Phoenix dactylifera
gb|ADW83714.1|  actin 2                                                 311   4e-103   Musa acuminata AAA Group [Cavendish banana]
ref|XP_008798327.1|  PREDICTED: actin                                   313   4e-103   Phoenix dactylifera
ref|XP_006435988.1|  hypothetical protein CICLE_v10031847mg             313   4e-103   Citrus clementina [clementine]
gb|KJB36724.1|  hypothetical protein B456_006G173100                    313   4e-103   Gossypium raimondii
ref|XP_010030965.1|  PREDICTED: actin                                   313   4e-103   Eucalyptus grandis [rose gum]
gb|KHG15514.1|  Actin                                                   313   4e-103   Gossypium arboreum [tree cotton]
gb|ABS57000.1|  actin                                                   306   4e-103   Zygophyllum xanthoxylon
ref|XP_008781400.1|  PREDICTED: actin-101-like                          313   4e-103   
ref|NP_001150462.1|  LOC100284092                                       313   4e-103   
ref|XP_002265476.1|  PREDICTED: actin-101                               313   5e-103   
ref|XP_010260924.1|  PREDICTED: actin-101-like                          313   5e-103   
gb|ABR17342.1|  unknown                                                 313   5e-103   
gb|AEV59657.1|  actin                                                   308   5e-103   
ref|XP_010912406.1|  PREDICTED: actin-101-like                          313   5e-103   
ref|XP_009600120.1|  PREDICTED: actin-like                              313   5e-103   
gb|ADA70361.1|  actin                                                   313   5e-103   
tpg|DAA51049.1|  TPA: putative actin family protein                     313   5e-103   
gb|KJB76085.1|  hypothetical protein B456_012G070300                    313   5e-103   
ref|XP_007150869.1|  hypothetical protein PHAVU_004G001000g             313   5e-103   
gb|ACU27908.1|  actin                                                   308   5e-103   
gb|KHG27347.1|  Actin                                                   312   5e-103   
gb|ADR32360.1|  b-actin                                                 306   5e-103   
gb|AIW52352.1|  actin                                                   307   6e-103   
gb|KEH24717.1|  actin-97                                                312   6e-103   
ref|XP_006407369.1|  hypothetical protein EUTSA_v10020950mg             312   6e-103   
ref|XP_007218136.1|  hypothetical protein PRUPE_ppa007236mg             312   6e-103   
gb|ACU27909.1|  actin                                                   308   6e-103   
gb|AHA92092.1|  actin                                                   308   6e-103   
ref|XP_009631892.1|  PREDICTED: actin-101                               312   6e-103   
emb|CDY08455.1|  BnaA05g26910D                                          312   6e-103   
ref|XP_009381010.1|  PREDICTED: actin-like                              312   6e-103   
gb|AIY35296.1|  actin                                                   310   6e-103   
gb|ADI78958.1|  actin-like protein 1                                    308   6e-103   
gb|ABU87582.1|  actin                                                   306   6e-103   
ref|XP_009146643.1|  PREDICTED: actin-11                                312   6e-103   
ref|XP_004489182.1|  PREDICTED: actin-like                              312   6e-103   
gb|AEL88499.1|  actin                                                   309   6e-103   
gb|ABK55729.1|  actin                                                   305   6e-103   
gb|AEL88497.1|  actin                                                   309   6e-103   
dbj|BAB63635.1|  putative actin                                         312   6e-103   
ref|XP_004294508.1|  PREDICTED: actin-1                                 312   6e-103   
gb|KJB16973.1|  hypothetical protein B456_002G257900                    312   7e-103   
emb|CDY01102.1|  BnaC05g40980D                                          312   7e-103   
gb|KHG29096.1|  Actin                                                   312   7e-103   
ref|XP_006379593.1|  actin family protein                               312   7e-103   
gb|KHG18648.1|  Actin-58                                                312   7e-103   
ref|XP_006400969.1|  hypothetical protein EUTSA_v10013840mg             312   7e-103   
dbj|BAH98157.1|  actin                                                  310   7e-103   
gb|AHF27461.1|  actin                                                   308   7e-103   
ref|XP_002316289.1|  actin family protein                               312   7e-103   
ref|XP_008788993.1|  PREDICTED: actin-101-like                          312   7e-103   
sp|O81221.1|ACT_GOSHI  RecName: Full=Actin                              312   7e-103   
gb|AAK82991.1|AF285176_1  actin                                         312   7e-103   
gb|AIY35295.1|  actin                                                   310   7e-103   
ref|XP_010036489.1|  PREDICTED: actin                                   312   8e-103   
ref|XP_009410069.1|  PREDICTED: actin                                   312   8e-103   
gb|ACH69153.1|  actin                                                   312   8e-103   
gb|ACP19073.1|  actin 2                                                 312   8e-103   
ref|XP_004147692.1|  PREDICTED: actin-97-like                           312   8e-103   
gb|ADW83713.1|  actin 1                                                 312   8e-103   
gb|AHF27460.1|  actin                                                   308   8e-103   
gb|AAW56956.1|  actin                                                   309   8e-103   
ref|XP_009416898.1|  PREDICTED: actin-3                                 312   8e-103   
gb|AHY35167.1|  beta-actin                                              309   8e-103   
gb|AIR74902.1|  beta-actin                                              312   8e-103   
ref|XP_010909197.1|  PREDICTED: actin-like                              312   8e-103   
ref|XP_011029076.1|  PREDICTED: actin-97-like                           312   8e-103   
ref|XP_010937718.1|  PREDICTED: actin-3                                 312   8e-103   
ref|XP_009383456.1|  PREDICTED: actin-7-like                            312   8e-103   
ref|XP_009353688.1|  PREDICTED: actin                                   312   9e-103   
gb|AAY00138.1|  actin                                                   307   9e-103   
emb|CDP06619.1|  unnamed protein product                                312   9e-103   
ref|XP_010427034.1|  PREDICTED: actin-1-like                            309   9e-103   
gb|ADU52545.1|  actin 2                                                 312   9e-103   
gb|AHE76166.1|  actin                                                   311   9e-103   
gb|AFC88820.1|  actin 5-like protein                                    306   1e-102   
ref|XP_010535499.1|  PREDICTED: actin-11                                312   1e-102   
ref|XP_011075140.1|  PREDICTED: actin-97                                312   1e-102   
sp|P93585.1|ACT4_SOLTU  RecName: Full=Actin-65                          310   1e-102   
ref|XP_006424815.1|  hypothetical protein CICLE_v10028665mg             312   1e-102   
ref|XP_007205366.1|  hypothetical protein PRUPE_ppa007219mg             312   1e-102   
gb|ACJ84552.1|  unknown                                                 312   1e-102   
gb|AEI27264.1|  actin                                                   308   1e-102   
ref|XP_010932520.1|  PREDICTED: actin-like                              312   1e-102   
gb|AIX10767.1|  actin                                                   309   1e-102   
gb|ADK89202.1|  actin                                                   306   1e-102   
gb|AIQ78385.1|  actin-7-like protein                                    308   1e-102   
sp|P93587.1|ACT1_SOLTU  RecName: Full=Actin-42                          310   1e-102   
ref|XP_006432485.1|  hypothetical protein CICLE_v10001518mg             311   1e-102   
gb|ADI78957.1|  actin                                                   307   1e-102   
gb|KHF97889.1|  hypothetical protein F383_16333                         311   1e-102   
gb|ACA04814.1|  actin                                                   308   1e-102   
gb|AEL88910.1|  actin                                                   308   1e-102   
gb|KDP24628.1|  hypothetical protein JCGZ_25544                         311   1e-102   
gb|AHY94895.1|  actin                                                   311   1e-102   
gb|ACV04873.1|  actin 2                                                 311   1e-102   
ref|XP_008787899.1|  PREDICTED: actin-like                              311   1e-102   
ref|XP_002981586.1|  hypothetical protein SELMODRAFT_233752             311   1e-102   
gb|ABG78035.1|  actin                                                   310   1e-102   
ref|XP_009390755.1|  PREDICTED: actin-7                                 311   1e-102   
gb|ADV91594.1|  actin                                                   311   1e-102   
gb|KHG17291.1|  hypothetical protein F383_20779                         311   1e-102   
gb|AFJ04513.1|  actin7a                                                 311   1e-102   
gb|AFD62804.1|  actin                                                   310   1e-102   
gb|AAB40076.1|  actin                                                   310   1e-102   
ref|XP_004307518.1|  PREDICTED: actin-97-like                           311   1e-102   
gb|AFW75045.1|  putative actin family protein                           311   1e-102   
ref|XP_010922415.1|  PREDICTED: actin-101-like isoform X1               311   1e-102   
ref|XP_009591335.1|  PREDICTED: actin-97                                311   1e-102   
ref|XP_003523242.1|  PREDICTED: actin-7-like isoform X1                 311   1e-102   
gb|ADX97327.1|  actin 7                                                 311   1e-102   
gb|AEO13836.1|  actin                                                   311   1e-102   
gb|ABS11262.1|  actin                                                   311   1e-102   
ref|XP_006858216.1|  hypothetical protein AMTR_s00062p00184900          311   1e-102   
ref|XP_009406076.1|  PREDICTED: actin-3                                 311   1e-102   
gb|KDO72871.1|  hypothetical protein CISIN_1g017125mg                   311   1e-102   
ref|XP_010541399.1|  PREDICTED: actin-12-like                           311   1e-102   
ref|XP_007150318.1|  hypothetical protein PHAVU_005G143500g             311   1e-102   
ref|XP_006418890.1|  hypothetical protein EUTSA_v10002572mg             311   1e-102   
gb|EMT32547.1|  hypothetical protein F775_43941                         317   1e-102   
ref|XP_003547359.1|  PREDICTED: actin-like isoform X1                   311   1e-102   
ref|NP_001130463.1|  putative actin family protein isoform 1            311   1e-102   
sp|Q05214.1|ACT1_TOBAC  RecName: Full=Actin                             311   1e-102   
gb|AFU25698.1|  actin                                                   310   2e-102   
ref|XP_011004377.1|  PREDICTED: actin-7-like isoform X2                 310   2e-102   
gb|AEB71791.1|  actin                                                   310   2e-102   
ref|XP_011089811.1|  PREDICTED: actin-like                              311   2e-102   
dbj|BAA89214.1|  actin isoform B                                        311   2e-102   
ref|XP_009412537.1|  PREDICTED: actin-3-like                            311   2e-102   
ref|XP_008654246.1|  PREDICTED: putative actin family protein iso...    311   2e-102   
gb|AFW75038.1|  putative actin family protein                           311   2e-102   
ref|XP_006282193.1|  hypothetical protein CARUB_v10028459mg             311   2e-102   
gb|AAG31475.1|AF284837_1  actin                                         306   2e-102   
gb|AFW82911.1|  putative actin family protein isoform 1                 311   2e-102   
gb|ACL98077.1|  actin                                                   305   2e-102   
ref|XP_008788057.1|  PREDICTED: actin-3-like                            311   2e-102   
ref|XP_007162325.1|  hypothetical protein PHAVU_001G142500g             311   2e-102   
ref|NP_190236.1|  actin-12                                              311   2e-102   
gb|AET80375.1|  actin 4                                                 310   2e-102   
gb|AEV59654.1|  actin                                                   306   2e-102   
gb|AET80376.1|  actin 5                                                 310   2e-102   
ref|NP_001239953.1|  uncharacterized protein LOC100798523               311   2e-102   
ref|XP_009150245.1|  PREDICTED: actin-12                                311   2e-102   
ref|XP_002530851.1|  actin, putative                                    306   2e-102   
ref|XP_009413409.1|  PREDICTED: actin-7                                 311   2e-102   
gb|ACR46928.1|  actin                                                   308   2e-102   
ref|XP_009420081.1|  PREDICTED: actin-2                                 311   2e-102   
gb|ACR46926.1|  actin                                                   307   2e-102   
gb|ACU27907.1|  actin                                                   306   2e-102   
gb|ACU27921.1|  actin                                                   306   2e-102   
gb|AAF03692.1|AF172094_1  actin                                         311   2e-102   
gb|ADN88106.1|  actin 1                                                 311   2e-102   
ref|XP_009407474.1|  PREDICTED: actin-7-like                            311   2e-102   
ref|XP_008794560.1|  PREDICTED: actin-101-like                          311   2e-102   
dbj|BAK52268.1|  beta actin                                             308   2e-102   
ref|XP_003569118.1|  PREDICTED: actin-97                                311   2e-102   
gb|ABX25963.1|  actin                                                   307   2e-102   
gb|AJB28504.1|  actin V1                                                310   2e-102   
gb|AEN19691.1|  actin                                                   310   2e-102   
sp|P93376.1|ACT6_TOBAC  RecName: Full=Actin-103                         310   2e-102   
emb|CDY38066.1|  BnaC03g75050D                                          311   2e-102   
ref|XP_006661942.1|  PREDICTED: actin-2-like isoform X1                 311   2e-102   
ref|XP_009416124.1|  PREDICTED: actin-7-like                            311   2e-102   
gb|AAC23632.2|  actin 3                                                 309   2e-102   
gb|AEN19690.1|  actin                                                   310   2e-102   
gb|ACU27916.1|  actin                                                   306   2e-102   
ref|XP_006429073.1|  hypothetical protein CICLE_v10011973mg             311   2e-102   
gb|KJB76088.1|  hypothetical protein B456_012G070300                    313   2e-102   
gb|ACA04815.1|  actin                                                   306   2e-102   
ref|XP_009403146.1|  PREDICTED: actin                                   311   2e-102   
ref|XP_009393674.1|  PREDICTED: actin-like                              311   2e-102   
gb|AHE76165.1|  actin                                                   311   3e-102   
gb|AGZ90151.1|  actin 7                                                 311   3e-102   
gb|ADU52548.1|  actin 2                                                 311   3e-102   
gb|KHG24741.1|  Actin-7 -like protein                                   310   3e-102   
gb|KJB20092.1|  hypothetical protein B456_003G132400                    311   3e-102   
gb|ACR46927.1|  actin                                                   307   3e-102   
dbj|BAI39619.1|  beta actin                                             308   3e-102   
gb|ACU27920.1|  actin                                                   306   3e-102   
dbj|BAN45712.1|  putative actin                                         310   3e-102   
ref|XP_004309498.1|  PREDICTED: actin-7-like                            311   3e-102   
gb|KHG13435.1|  Actin-7 -like protein                                   310   3e-102   
gb|AFK39354.1|  unknown                                                 311   3e-102   
gb|ACU27910.1|  actin                                                   306   3e-102   
ref|XP_006348992.1|  PREDICTED: actin-58-like                           311   3e-102   
gb|AFZ78526.1|  actin                                                   310   3e-102   
ref|XP_009599876.1|  PREDICTED: actin-7-like                            310   3e-102   
dbj|BAJ85914.1|  predicted protein                                      310   3e-102   
gb|AAP73455.1|  actin                                                   310   3e-102   
gb|KJB75201.1|  hypothetical protein B456_012G030500                    310   3e-102   
gb|AAP73457.1|  actin                                                   310   3e-102   
gb|ACT98686.1|  actin                                                   310   3e-102   
gb|EYU41721.1|  hypothetical protein MIMGU_mgv1a008324mg                310   3e-102   
ref|XP_004173826.1|  PREDICTED: actin-7-like                            310   3e-102   
ref|XP_010027698.1|  PREDICTED: actin-7                                 310   3e-102   
gb|AAB40105.1|  actin                                                   309   3e-102   
ref|XP_004306592.1|  PREDICTED: actin-7                                 310   3e-102   
ref|XP_003562930.1|  PREDICTED: actin-3                                 310   3e-102   
gb|AEP31940.1|  actin                                                   310   3e-102   
gb|AEK70331.1|  actin                                                   310   3e-102   
gb|ABG49392.1|  actin 2                                                 310   3e-102   
gb|AAB62881.1|  actin 2                                                 309   3e-102   
gb|AAN40685.1|  actin                                                   310   4e-102   
gb|AAB40084.1|  actin                                                   309   4e-102   
gb|KHF99045.1|  Actin-7 -like protein                                   310   4e-102   
ref|XP_003602546.1|  Actin                                              310   4e-102   
gb|AHE76167.1|  actin                                                   310   4e-102   
gb|EMT00396.1|  Actin-3                                                 310   4e-102   
gb|EYU39941.1|  hypothetical protein MIMGU_mgv1a008854mg                310   4e-102   
gb|ACL97684.1|  actin 1                                                 310   4e-102   
gb|AIC33035.1|  actin 1                                                 310   4e-102   
ref|XP_002282516.1|  PREDICTED: actin-7                                 310   4e-102   
dbj|BAP28463.1|  actin                                                  303   4e-102   
ref|XP_006371012.1|  hypothetical protein POPTR_0019s02630g             310   4e-102   
gb|ABA99628.1|  Actin-1, putative, expressed                            310   4e-102   
gb|AFY23984.1|  actin                                                   308   4e-102   
ref|XP_003574188.1|  PREDICTED: actin-2                                 310   4e-102   
ref|XP_009388633.1|  PREDICTED: actin-101                               310   4e-102   
gb|ADV17460.1|  actin                                                   310   4e-102   
emb|CDY48688.1|  BnaC02g10000D                                          309   4e-102   
ref|XP_010251047.1|  PREDICTED: actin-3                                 310   4e-102   
ref|XP_002298710.1|  actin family protein                               310   4e-102   
gb|AAD41039.1|AF112538_1  actin                                         310   4e-102   
gb|AAN08622.1|  actin                                                   310   4e-102   
gb|AGA63729.1|  actin                                                   310   4e-102   
gb|AFY23980.1|  actin                                                   307   4e-102   
gb|AAU43212.1|  actin                                                   306   4e-102   
ref|XP_006595018.1|  PREDICTED: actin-like isoform X1                   310   4e-102   



>gb|AAL89713.1|AF483213_1 actin [Asarina barclaiana]
Length=181

 Score =   317 bits (812),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGY+FTTSAEREIVRDMKEK
Sbjct  7    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYTFTTSAEREIVRDMKEK  66

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+K+SSSVEKS+ELPDGQVITIGNERFRCPEVLFQPS+IGME+AG+H
Sbjct  67   LAYIALDYEQELETAKSSSSVEKSFELPDGQVITIGNERFRCPEVLFQPSMIGMESAGVH  126

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  127  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  177



>gb|AEQ75505.1| actin, partial [Davidia involucrata]
Length=190

 Score =   315 bits (807),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  2    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  61

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVL+QPS+IGMEAAGIH
Sbjct  62   LAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLYQPSMIGMEAAGIH  121

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  122  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  172



>gb|ADN37689.1| actin [Asarum europaeum]
Length=181

 Score =   313 bits (803),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  6    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTTAEREIVRDMKEK  65

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  66   LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  125

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  126  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  176



>dbj|BAM48917.1| actin, partial [Eriobotrya japonica]
Length=235

 Score =   315 bits (807),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  64   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  123

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  124  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  183

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  184  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  234



>ref|XP_011091473.1| PREDICTED: actin-11 [Sesamum indicum]
 ref|XP_011091474.1| PREDICTED: actin-11 [Sesamum indicum]
Length=377

 Score =   320 bits (820),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGY+LPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYSLPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSSSVEKSYELPDGQVITIGNERFRCPEVLFQPS+IGMEAAG+H
Sbjct  218  LSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGNERFRCPEVLFQPSMIGMEAAGVH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMK  328



>gb|AHJ78382.1| actin, partial [Cydonia oblonga]
Length=249

 Score =   315 bits (806),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  69   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  128

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  129  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  188

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  189  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  239



>gb|ACV71031.1| truncated beta-actin [Agropyron cristatum]
Length=201

 Score =   313 bits (802),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  18   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDVKEK  77

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDY+QE+ETSKTSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS IGMEAAGIH
Sbjct  78   LSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGSERFRCPEVLFQPSFIGMEAAGIH  137

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  138  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  188



>dbj|BAF68888.1| actin 4 [Torenia fournieri]
Length=290

 Score =   316 bits (810),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  71   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDIKEK  130

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  131  LAYIALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  190

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  191  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  241



>dbj|BAF68887.1| actin 3, partial [Torenia fournieri]
Length=290

 Score =   316 bits (810),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  71   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDIKEK  130

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  131  LAYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  190

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  191  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  241



>sp|P93584.1|ACT9_SOLTU RecName: Full=Actin-82, partial [Solanum tuberosum]
 gb|AAB40096.1| actin, partial [Solanum tuberosum]
Length=336

 Score =   318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  138  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQEL+TSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  198  LSYIALDYEQELDTSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFNGIADRMSKEITALAPSSMK  308



>gb|AIY35293.1| actin, partial [Arachis hypogaea]
Length=323

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  127  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDMKEK  186

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  187  LSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  246

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  247  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  297



>ref|XP_004241231.1| PREDICTED: actin-82 [Solanum lycopersicum]
Length=377

 Score =   319 bits (817),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQEL+TS T+SSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELDTSNTNSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  328



>gb|EMT21476.1| Actin-1 [Aegilops tauschii]
Length=343

 Score =   318 bits (814),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  124  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  183

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDY+QE+ETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  184  LSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  243

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK
Sbjct  244  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  294



>gb|AIY27746.1| actin, partial [Betula luminifera]
Length=240

 Score =   314 bits (804),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  21   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  80

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  81   LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  140

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  141  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  191



>gb|ADL59374.2| actin 4 [Ipomoea nil]
 gb|AFD62801.1| actin 4 [Ipomoea purpurea]
Length=376

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  157  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  216

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  217  LAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSLVGMEAAGIH  276

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  277  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  327



>gb|ACD31684.1| beta actin [Medicago sativa]
Length=199

 Score =   312 bits (799),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDVKEK  60

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEA GIH
Sbjct  61   LSYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAPGIH  120

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  121  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  171



>gb|ACL80038.1| actin, partial [Puccinellia tenuiflora]
Length=199

 Score =   312 bits (799),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  11   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEK  70

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDY+QE+ETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  71   LSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  130

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  131  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  181



>gb|ABV44412.1| actin, partial [Nelumbo nucifera]
Length=277

 Score =   315 bits (806),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  79   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  138

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  139  LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  198

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  199  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  249



>sp|P81228.1|ACT5_SOLTU RecName: Full=Actin-66, partial [Solanum tuberosum]
 gb|AAB40098.1| actin, partial [Solanum tuberosum]
Length=336

 Score =   317 bits (812),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  138  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  198  LSYIALDYEQEIETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  308



>ref|XP_008458877.1| PREDICTED: actin-82-like isoform X1 [Cucumis melo]
Length=345

 Score =   317 bits (812),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  113  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDMKEK  172

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  173  LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  232

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF+GIADRMSKEI+ALAPSSMK
Sbjct  233  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFSGIADRMSKEISALAPSSMK  283



>dbj|BAK06400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDY+QE+ETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  328



>gb|AAZ74664.1| actin [Cucumis sativus]
Length=261

 Score =   314 bits (804),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  74   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  133

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  134  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  193

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  194  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  244



>sp|P93371.1|ACT5_TOBAC RecName: Full=Actin-93, partial [Nicotiana tabacum]
 gb|AAB40086.1| actin, partial [Nicotiana tabacum]
Length=336

 Score =   317 bits (811),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  138  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSS+EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  198  LAYIALDYEQELETAKTSSSMEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  308



>gb|KGN50545.1| hypothetical protein Csa_5G182010 [Cucumis sativus]
Length=257

 Score =   314 bits (804),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  38   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDMKEK  97

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  98   LAYIALDYEQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  157

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEI+ALAPSSMK
Sbjct  158  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMK  208



>gb|ABY66084.1| actin [Dimocarpus longan]
Length=242

 Score =   313 bits (802),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD L+KILTERGYSFTT+AEREIVRDMKEK
Sbjct  23   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALIKILTERGYSFTTTAEREIVRDMKEK  82

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELE +K+SS++EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  83   LAYVALDYEQELEAAKSSSAIEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  142

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  143  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFNGIADRMSKEITALAPSSMK  193



>gb|AED89636.1| actin 2, partial [Rubus plicatus]
Length=248

 Score =   313 bits (802),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  75   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTTAEREIVRDMKEK  134

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  135  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  194

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVD+RKDLYGNIVLSGG+TMF GIADRMSKEI+ALAPSSMK
Sbjct  195  ETTYNSIMKCDVDVRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMK  245



>gb|ABK96176.1| unknown [Populus trichocarpa]
Length=294

 Score =   315 bits (806),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  75   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  134

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  135  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  194

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  195  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  245



>gb|AAB40075.1| actin, partial [Glycine max]
Length=336

 Score =   316 bits (810),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGY FTTSAEREIVRDMKEK
Sbjct  138  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYMFTTSAEREIVRDMKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  198  LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  308



>gb|ACZ72941.1| actin, partial [Corchorus capsularis]
Length=190

 Score =   311 bits (796),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = +1

Query  4    DGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEKL  183
            DGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEKL
Sbjct  1    DGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEKL  60

Query  184  SYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIHE  363
            +YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIHE
Sbjct  61   AYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIHE  120

Query  364  TTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            TTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  121  TTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  170



>ref|XP_010690498.1| PREDICTED: actin-1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690505.1| PREDICTED: actin-1 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   318 bits (814),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ET+KTSSSVEKS+ELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIALDYEQEMETAKTSSSVEKSFELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AGC31654.1| actin 1, partial [Prunus maritima]
Length=247

 Score =   313 bits (802),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  75   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  134

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGME+AGIH
Sbjct  135  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMESAGIH  194

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  195  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  245



>gb|AHC72438.1| actin, partial [Halogeton glomeratus]
Length=199

 Score =   311 bits (797),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGY+FTTSAEREIVRDMKEK
Sbjct  11   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYTFTTSAEREIVRDMKEK  70

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ET+KTSS+VEKSYELPDGQVITIG+ERFRCPEVLFQPS+IG EAAGIH
Sbjct  71   LAYIALDYEQEMETAKTSSAVEKSYELPDGQVITIGSERFRCPEVLFQPSLIGQEAAGIH  130

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSS+K
Sbjct  131  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSVK  181



>dbj|BAF96593.1| actin [Rosa hybrid cultivar]
Length=278

 Score =   314 bits (804),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  78   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  137

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  138  LAYLALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  197

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  198  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  248



>dbj|BAC07538.1| actin [Vitis labrusca x Vitis vinifera]
Length=189

 Score =   310 bits (795),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  9    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  68

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  69   LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  128

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  129  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  179



>gb|ACT78692.1| actin [Thalictrum thalictroides]
Length=195

 Score =   311 bits (796),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  6    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDMKEK  65

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  66   LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  125

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  126  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  176



>gb|AFJ93198.1| actin, partial [Eremosparton songoricum]
Length=189

 Score =   310 bits (795),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHA LRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  15   GDGVSHTVPIYEGYALPHAFLRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDVKEK  74

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET++T SSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  75   LAYIALDYEQELETARTCSSVEKSYELPDGQVITIGDERFRCPEVLFQPSMIGMEAAGIH  134

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  135  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  185



>gb|AEY77415.1| actin, partial [Cirsium setosum]
Length=250

 Score =   313 bits (801),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  54   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDMKEK  113

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  114  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  173

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  174  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  224



>ref|XP_009397437.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009397438.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   317 bits (813),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMK  328



>emb|CDP00088.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   317 bits (813),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ETSKTSSSVEKSYELPDGQVITIGNERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQEIETSKTSSSVEKSYELPDGQVITIGNERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFAGIADRMSKEITALAPSSMK  328



>gb|AED89634.1| actin 1, partial [Rubus plicatus]
Length=261

 Score =   313 bits (802),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  74   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  133

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  134  LAYIALDYEQEIETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  193

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  194  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  244



>ref|XP_006350765.1| PREDICTED: actin-like [Solanum tuberosum]
Length=377

 Score =   317 bits (813),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQEL+TSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELDTSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFNGIADRMSKEITALAPSSMK  328



>gb|ADP89573.1| actin-like protein [Oncidium hybrid cultivar]
Length=208

 Score =   311 bits (797),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  35   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTTAEREIVRDIKEK  94

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGME+AGIH
Sbjct  95   LAYVALDYEQELETAKSSSSVEKTYELPDGQVITIGAERFRCPEVLFQPSMIGMESAGIH  154

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  155  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  205



>gb|AHA91827.1| actin-4, partial [Rosa hybrid cultivar]
Length=302

 Score =   315 bits (806),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  83   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  142

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  143  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  202

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  203  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  253



>ref|XP_004250955.1| PREDICTED: actin-97-like [Solanum lycopersicum]
Length=377

 Score =   317 bits (812),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQEIETSKTSSNVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_009409104.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+E +KT ++VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQEMEAAKTPAAVEKTYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGI DRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIGDRMSKEITALAPSSMK  328



>ref|XP_009802880.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009802881.1| PREDICTED: actin-like [Nicotiana sylvestris]
Length=377

 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALD+EQEL+TSKTSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDFEQELDTSKTSSSVEKSYELPDGQVITIGSERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFNGIADRMSKEITALAPSSMK  328



>ref|XP_008382817.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQEMETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|ACZ56138.1| beta-actin, partial [Microula sikkimensis]
Length=199

 Score =   310 bits (795),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGY FTT+AEREIVRD+KEK
Sbjct  11   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYMFTTTAEREIVRDIKEK  70

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQEL+TSK+SSS+ K+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  71   LAYVALDYEQELDTSKSSSSIGKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  130

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  131  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  181



>gb|ACF75872.1| beta-actin [Pericallis cruenta]
Length=178

 Score =   310 bits (793),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/168 (95%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +1

Query  10   VSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEKLSY  189
            VSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEKL+Y
Sbjct  1    VSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDMKEKLAY  60

Query  190  IALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIHETT  369
            IALDYEQEL+T+ TSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIHETT
Sbjct  61   IALDYEQELQTANTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIHETT  120

Query  370  YNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            YNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  121  YNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  168



>gb|AED89637.1| actin 2 [Rubus idaeus]
Length=248

 Score =   312 bits (800),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHT PIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  75   GDGVSHTAPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTAAEREIVRDMKEK  134

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  135  LSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  194

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGN VLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  195  ETTYNSIMKCDVDIRKDLYGNTVLSGGSTMFPGIADRMSKEITALAPSSMK  245



>gb|ACL78791.1| actin [Solanum lycopersicum]
Length=211

 Score =   311 bits (796),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  38   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYMFTTTAEREIVRDMKEK  97

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQE+ET+++SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  98   LAYVALDYEQEIETARSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  157

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  158  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  208



>gb|AFK48206.1| unknown [Lotus japonicus]
Length=235

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  38   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTSAEREIVRDIKEK  97

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+ +SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  98   LAYVALDYEQELETANSSSSMEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  157

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  158  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  208



>gb|AAF40438.1|AF234528_2 actin 1 [Avena nuda]
Length=377

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDY+QE+ETS TSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIALDYDQEMETSNTSSTVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  328



>gb|EPS60057.1| hypothetical protein M569_14747 [Genlisea aurea]
Length=377

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGY+LPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYSLPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSSSVEKS+ELPDGQVITIGNERFRCPEVLFQPS+IGMEA+GIH
Sbjct  218  LSYIALDYEQELETSKTSSSVEKSFELPDGQVITIGNERFRCPEVLFQPSMIGMEASGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|ACL50999.1| actin [Artemisia sphaerocephala]
 gb|ACL98081.1| actin [Artemisia sphaerocephala]
Length=199

 Score =   310 bits (795),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  11   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDMKEK  70

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  71   LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  130

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  131  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  181



>dbj|BAF45152.1| actin [Scoparia dulcis]
Length=245

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  70   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEK  129

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGME+AGIH
Sbjct  130  LAYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMESAGIH  189

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  190  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  240



>gb|ABK21898.1| unknown [Picea sitchensis]
Length=244

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  25   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDVKEK  84

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS++KSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  85   LAYVALDYEQELETAKSSSSIDKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  144

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  145  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  195



>gb|EPS69960.1| actin-97 [Genlisea aurea]
Length=377

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_010520033.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ETSKTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LAYIALDYEQEMETSKTSSAVEKTYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_010534357.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
 ref|XP_010534358.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LAYIALDYEQEMETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>sp|Q96484.1|ACT3_SOLLC RecName: Full=Actin-52, partial [Solanum lycopersicum]
 gb|AAB40095.1| actin, partial [Solanum lycopersicum]
Length=336

 Score =   315 bits (807),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAI RLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  138  GDGVSHTVPIYEGYALPHAIPRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ET+KTSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  198  LSYIALDYEQEIETAKTSSSVEKSYELPDGQVITIGSERFRCPEVLFQPSMIGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  308



>gb|ACU27913.1| actin [Glycine max]
Length=252

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGY FTTSAEREIVRDMKEK
Sbjct  72   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYMFTTSAEREIVRDMKEK  131

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  132  LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  191

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKE  ALAPSSMK
Sbjct  192  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKETPALAPSSMK  242



>gb|ACU27917.1| actin [Malus domestica]
Length=252

 Score =   312 bits (799),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  72   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  131

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  132  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  191

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTY+SIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  192  ETTYDSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  242



>ref|XP_010685773.1| PREDICTED: actin-66 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ET+KTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQEMETAKTSSAVEKNYELPDGQVITIGGERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>emb|CAE51207.1| putative actin [Lolium multiflorum]
Length=255

 Score =   312 bits (799),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  78   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDIKEK  137

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGME++GIH
Sbjct  138  LAYVALDYEQELETAKNSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMESSGIH  197

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  198  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  248



>ref|XP_009621805.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
 ref|XP_009780859.1| PREDICTED: actin [Nicotiana sylvestris]
 ref|XP_009780860.1| PREDICTED: actin [Nicotiana sylvestris]
Length=377

 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AAG43040.1| actin [Lolium perenne]
Length=193

 Score =   310 bits (793),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  5    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTTAEREIVRDIKEK  64

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELE +K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  65   LAYVALDYEQELENAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  124

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  125  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  175



>dbj|BAC55931.1| actin 1 [Matricaria chamomilla]
Length=199

 Score =   310 bits (794),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  4    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDMKEK  63

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELE S + S++EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  64   LAYIALDYEQELEISNSGSTIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  123

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  124  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  174



>gb|AFW82906.1| putative actin family protein [Zea mays]
Length=243

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  29   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDIKEK  88

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+K SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  89   LAYIALDYEQELETAKNSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  148

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEIT+LAPSSMK
Sbjct  149  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITSLAPSSMK  199



>gb|AGC31655.1| actin 2, partial [Prunus maritima]
Length=247

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  75   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  134

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  135  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  194

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  195  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  245



>ref|XP_011080749.1| PREDICTED: actin-1-like [Sesamum indicum]
 ref|XP_011101608.1| PREDICTED: actin-1-like [Sesamum indicum]
Length=377

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGY+LPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYSLPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSSSVEKS+ELPDGQVITIGNERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETAKTSSSVEKSFELPDGQVITIGNERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLY NIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYSNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_007016434.1| Actin 3 isoform 3 [Theobroma cacao]
 gb|EOY34053.1| Actin 3 isoform 3 [Theobroma cacao]
Length=322

 Score =   314 bits (805),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  103  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  162

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS++EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  163  LAYIALDYEQELETAKTSSAIEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  222

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  223  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  273



>gb|ACU27906.1| actin [Vicia faba]
Length=252

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  72   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDVKEK  131

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET++TSSSVEKSYELPDGQVITIG+ERFRCPEVL+QPS+IGMEAAGIH
Sbjct  132  LSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLYQPSMIGMEAAGIH  191

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSI+KCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  192  ETTYNSIIKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  242



>ref|XP_009625006.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
 ref|XP_009625007.1| PREDICTED: actin-like [Nicotiana tomentosiformis]
Length=377

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALD+EQELETSKTSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGSERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFNGIADRMSKEITALAPSSMK  328



>gb|AGI78241.1| actin 7, partial [Caragana korshinskii]
Length=283

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  99   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDMKEK  158

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVL+QPS++GMEAAGIH
Sbjct  159  LAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLYQPSMVGMEAAGIH  218

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSK+I+ALAPSSMK
Sbjct  219  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKQISALAPSSMK  269



>gb|ABI51282.1| actin [Hibiscus cannabinus]
 gb|ABT17116.1| actin [Hibiscus cannabinus]
Length=253

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  80   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDMKEK  139

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  140  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  199

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  200  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  250



>gb|ADN37687.1| actin [Houttuynia cordata]
Length=181

 Score =   309 bits (791),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  7    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYIFTTTAEREIVRDMKEK  66

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EKSYELPDGQVITIG ERFRCPEVLFQPS+IGME+AGIH
Sbjct  67   LAYVALDYEQELETAKSSSSIEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMESAGIH  126

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  127  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  177



>gb|ACJ05350.1| actin [Camellia sinensis]
Length=225

 Score =   311 bits (796),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  6    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  65

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  66   LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  125

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  126  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  176



>emb|CDP12785.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGY FTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYMFTTSAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALD+EQELET+K+SSS+EK+YELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH
Sbjct  218  LAYVALDFEQELETAKSSSSLEKNYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|AAC49651.1| actin [Striga asiatica]
Length=377

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|ACU27915.1| actin [Castanea sativa]
Length=252

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  72   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  131

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  132  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  191

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  192  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  242



>gb|AEV59655.1| actin, partial [Oxytropis arctobia]
Length=250

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  65   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTSAEREIVRDIKEK  124

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  125  LAYVALDYEQELETAKSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  184

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  185  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  235



>gb|ACU27905.1| actin [Capsicum annuum]
Length=252

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  72   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYMFTTTAEREIVRDMKEK  131

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+++SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  132  LAYVALDYEQELETARSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  191

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  192  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  242



>gb|ACU80552.1| putative actin protein [Jatropha curcas]
Length=253

 Score =   311 bits (798),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  80   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  139

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  140  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  199

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  200  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  250



>gb|ADN37688.1| actin [Berberis julianae]
Length=182

 Score =   309 bits (791),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIV DMKEK
Sbjct  7    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYLFTTTAEREIVSDMKEK  66

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSY+ALDYEQELET+K+SSS+EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  67   LSYVALDYEQELETAKSSSSIEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  126

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  127  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  177



>ref|XP_006351346.1| PREDICTED: actin-58-like [Solanum tuberosum]
 ref|XP_010312150.1| PREDICTED: actin-66 [Solanum lycopersicum]
 ref|XP_010312151.1| PREDICTED: actin-66 [Solanum lycopersicum]
Length=377

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQEIETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AAL89712.1|AF483212_1 actin [Alonsoa meridionalis]
Length=182

 Score =   309 bits (791),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  7    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTTAEREIVRDIKEK  66

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALD++QELETSKTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  67   LAYIALDFDQELETSKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  126

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  127  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  177



>gb|ADK98519.1| actin, partial [Leymus chinensis]
Length=191

 Score =   309 bits (792),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  4    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTTAEREIVRDIKEK  63

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELE +K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  64   LAYVALDYEQELENAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  123

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  124  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  174



>dbj|BAI59710.1| actin [Lobelia erinus]
Length=279

 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  78   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDMKEK  137

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  138  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  197

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  198  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  248



>ref|XP_004239790.1| PREDICTED: actin-58 [Solanum lycopersicum]
Length=377

 Score =   316 bits (809),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALD+EQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKE+TALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELTALAPSSMK  328



>ref|XP_003560589.1| PREDICTED: actin-1 [Brachypodium distachyon]
Length=377

 Score =   316 bits (809),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDY+QE+ETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  328



>ref|XP_011078821.1| PREDICTED: actin [Sesamum indicum]
 ref|XP_011078822.1| PREDICTED: actin [Sesamum indicum]
Length=377

 Score =   316 bits (809),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|AEE98359.1| actin [Deschampsia antarctica]
Length=278

 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  59   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDIKEK  118

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGME++GIH
Sbjct  119  LAYVALDYEQELETAKNSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMESSGIH  178

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  179  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  229



>dbj|BAF36000.1| actin [Rosa hybrid cultivar]
Length=278

 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  78   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  137

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  138  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  197

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  198  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  248



>sp|P81229.1|ACT8_SOLTU RecName: Full=Actin-79, partial [Solanum tuberosum]
 gb|AAB40097.1| actin, partial [Solanum tuberosum]
Length=336

 Score =   314 bits (805),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  138  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ET+KTSSSVEKSYELPDGQVI IG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  198  LSYIALDYEQEIETAKTSSSVEKSYELPDGQVIPIGAERFRCPEVLFQPSMIGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  308



>gb|KDO70920.1| hypothetical protein CISIN_1g017089mg [Citrus sinensis]
Length=332

 Score =   314 bits (804),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  113  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  172

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  173  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  232

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  233  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  283



>ref|XP_007009346.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY18156.1| Actin-11 isoform 1 [Theobroma cacao]
Length=377

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMK  328



>dbj|BAN13564.1| actin, partial [Chrysanthemum seticuspe f. boreale]
Length=280

 Score =   312 bits (799),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  61   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDMKEK  120

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  121  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  180

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  181  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  231



>gb|KHN24335.1| Actin-97 [Glycine soja]
Length=332

 Score =   314 bits (804),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  113  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDVKEK  172

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET++TSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEA+GIH
Sbjct  173  LSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQPSMIGMEASGIH  232

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  233  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  283



>dbj|BAA21108.1| actin [Gossypium hirsutum]
Length=222

 Score =   310 bits (794),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  3    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  62

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  63   LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  122

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  123  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  173



>gb|KDO67622.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
 gb|KDO67623.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
 gb|KDO67624.1| hypothetical protein CISIN_1g017081mg [Citrus sinensis]
Length=377

 Score =   315 bits (808),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMK  328



>gb|AED89635.1| actin 1 [Rubus idaeus]
Length=261

 Score =   311 bits (797),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  74   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  133

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  134  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  193

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  194  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  244



>ref|XP_009787806.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009787807.1| PREDICTED: actin-like [Nicotiana sylvestris]
 ref|XP_009787808.1| PREDICTED: actin-like [Nicotiana sylvestris]
Length=377

 Score =   315 bits (808),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSK+ SSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETSKSGSSVEKTYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|ABG49391.1| actin 1 [Torenia fournieri]
Length=358

 Score =   315 bits (806),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  155  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDIKEK  214

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  215  LAYIALDYEQELETSKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSLVGMEAAGIH  274

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  275  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  325



>gb|ACU27911.1| actin [Rubus idaeus]
Length=252

 Score =   311 bits (796),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  72   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  131

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  132  LAYMALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  191

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  192  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  242



>gb|AEV59660.1| actin, partial [Oxytropis maydelliana]
Length=253

 Score =   311 bits (796),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  80   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTSAEREIVRDIKEK  139

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  140  LAYVALDYEQELETAKSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  199

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  200  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  250



>dbj|BAD93480.1| putative actin [Tricyrtis hirta]
Length=175

 Score =   308 bits (788),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRD+KEK
Sbjct  2    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDIKEK  61

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  62   LAYVALDYEQELETAKSSSSIEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  121

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG TMF GIADRMSKEITALAPSSMK
Sbjct  122  ETTYNSIMKCDVDIRKDLYGNIVLSGGPTMFPGIADRMSKEITALAPSSMK  172



>ref|XP_007009347.1| Actin-11 isoform 2 [Theobroma cacao]
 gb|EOY18157.1| Actin-11 isoform 2 [Theobroma cacao]
Length=380

 Score =   315 bits (808),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMK  328



>ref|XP_009388742.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
 ref|XP_009388743.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYE+ELET+KT SSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEKELETAKTGSSVEKTYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMK  328



>ref|XP_003622020.1| Actin [Medicago truncatula]
Length=360

 Score =   315 bits (806),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  141  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDVKEK  200

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET++TSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  201  LSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQPSMIGMEAAGIH  260

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  261  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  311



>gb|AAZ74666.1| actin [Cucumis sativus]
Length=261

 Score =   311 bits (796),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  74   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  133

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  134  LAYVALDYEQELETAKSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  193

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  194  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  244



>dbj|BAH23584.1| actin [Morus alba]
Length=265

 Score =   311 bits (797),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  77   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  136

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  137  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  196

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  197  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  247



>gb|ACU27919.1| actin [Triticum aestivum]
Length=252

 Score =   311 bits (796),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  72   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTTAEREIVRDIKEK  131

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELE +K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  132  LAYVALDYEQELENAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  191

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  192  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  242



>gb|ACU27904.1| actin [Solanum tuberosum]
Length=252

 Score =   310 bits (795),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  72   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYMFTTTAEREIVRDMKEK  131

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQE+ET+++SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  132  LAYVALDYEQEIETARSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  191

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  192  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  242



>gb|KDP44962.1| hypothetical protein JCGZ_01462 [Jatropha curcas]
Length=377

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVL+QPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLYQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMK  328



>ref|XP_010524532.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
 ref|XP_010524540.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIALDYEQEIETSKTSSTVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_006345961.1| PREDICTED: actin-58-like [Solanum tuberosum]
Length=377

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALD+EQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKE+TALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELTALAPSSMK  328



>ref|XP_006297921.1| hypothetical protein CARUB_v10013962mg [Capsella rubella]
 gb|EOA30819.1| hypothetical protein CARUB_v10013962mg [Capsella rubella]
Length=377

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ET+ TSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LSYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQPSLVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_004156708.1| PREDICTED: actin-97-like [Cucumis sativus]
Length=382

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  163  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDMKEK  222

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  223  LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  282

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF+GIADRMSKEI+ALAPSSMK
Sbjct  283  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFSGIADRMSKEISALAPSSMK  333



>gb|AGK45317.1| actin, partial [Aloe arborescens]
Length=337

 Score =   313 bits (803),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  142  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  201

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  202  LAYVALDYEQELETAKSSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  261

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  262  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  312



>gb|AEV59659.1| actin, partial [Oxytropis campestris subsp. johannensis]
Length=254

 Score =   310 bits (795),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  78   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTSAEREIVRDIKEK  137

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  138  LAYVALDYEQELETAKSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  197

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  198  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  248



>dbj|BAJ85474.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDY+QE+ETSKTSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGSERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  328



>gb|ADK11998.1| putative actin protein [Salvia miltiorrhiza]
Length=377

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>sp|P30167.1|ACT3_SOLTU RecName: Full=Actin-58 [Solanum tuberosum]
 emb|CAA39278.1| actin [Solanum tuberosum]
Length=377

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALD+EQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDFEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKE+TALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELTALAPSSMK  328



>ref|XP_004142758.1| PREDICTED: actin-1-like [Cucumis sativus]
 ref|XP_008458878.1| PREDICTED: actin-1-like isoform X2 [Cucumis melo]
 gb|KGN51311.1| hypothetical protein Csa_5G517100 [Cucumis sativus]
Length=377

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF+GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFSGIADRMSKEISALAPSSMK  328



>ref|XP_003525105.1| PREDICTED: actin-7-like [Glycine max]
 ref|XP_003531402.1| PREDICTED: actin-7-like [Glycine max]
 gb|KHN29151.1| Actin-7 [Glycine soja]
 gb|KHN34050.1| Actin-7 [Glycine soja]
Length=377

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGY FTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYMFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_003575839.1| PREDICTED: actin-1-like [Brachypodium distachyon]
 gb|ACO87663.1| actin [Brachypodium sylvaticum]
Length=377

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD++MKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDY+QE+ETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIALDYDQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  328



>sp|P93372.1|ACT4_TOBAC RecName: Full=Actin-66, partial [Nicotiana tabacum]
 gb|AAB40087.1| actin, partial [Nicotiana tabacum]
Length=336

 Score =   313 bits (803),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  138  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTSAEREIVRDVKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS++GMEAAGIH
Sbjct  198  LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGSERFRCPEVLFQPSLVGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  308



>gb|AIM48894.1| actin, partial [Cinnamomum camphora]
Length=332

 Score =   313 bits (802),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  137  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  196

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  197  LAYVALDYEQELETAKSSSTVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  256

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  257  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  307



>ref|XP_009773924.1| PREDICTED: actin [Nicotiana sylvestris]
 ref|XP_009773925.1| PREDICTED: actin [Nicotiana sylvestris]
Length=377

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALD+EQE++TSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDFEQEMDTSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>emb|CDP10143.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGME+AGIH
Sbjct  218  LAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMESAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|AEL88913.1| actin [Halodule beaudettei]
Length=289

 Score =   311 bits (798),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD  MKILTERGYSFTTSAEREIVRDMKEK
Sbjct  70   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDAFMKILTERGYSFTTSAEREIVRDMKEK  129

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYE+ELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGME AGIH
Sbjct  130  LAYIALDYERELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEVAGIH  189

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  190  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  240



>ref|NP_001276160.1| actin-11-like [Glycine max]
 gb|ACU21101.1| unknown [Glycine max]
Length=377

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET++TSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEA+GIH
Sbjct  218  LSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQPSMIGMEASGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  328



>gb|AFC98748.1| actin, partial [Halocnemum strobilaceum]
Length=217

 Score =   309 bits (791),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  34   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYMFTTSAEREIVRDIKEK  93

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALD+EQE ET+K+SS++EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  94   LAYVALDFEQESETAKSSSAIEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  153

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  154  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  204



>ref|XP_010520278.1| PREDICTED: actin-like [Tarenaya hassleriana]
Length=377

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+ TSSS EKS+ELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETANTSSSAEKSFELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GI DRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIGDRMSKEITALAPSSMK  328



>gb|KJB76652.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=395

 Score =   315 bits (808),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>sp|P30172.1|ACT12_SOLTU RecName: Full=Actin-100, partial [Solanum tuberosum]
 emb|CAA39276.1| actin [Solanum tuberosum]
Length=357

 Score =   314 bits (804),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  138  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTSAEREIVRDMKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SS+VEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  198  LAYVALDYEQELETAKSSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSLVGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  308



>gb|AFP43693.1| actin 1, partial [Eriobotrya japonica]
Length=251

 Score =   310 bits (794),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  32   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  91

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  92   LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  151

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMS+EITALAPSSMK
Sbjct  152  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSREITALAPSSMK  202



>ref|XP_002882767.1| actin-11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59026.1| actin-11 [Arabidopsis lyrata subsp. lyrata]
Length=377

 Score =   315 bits (806),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE++T+ TSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LSYIALDYEQEMDTANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQPSLVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AIM48891.1| actin, partial [Cinnamomum camphora]
Length=332

 Score =   313 bits (802),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  137  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  196

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  197  LAYVALDYEQELETAKSSSSIEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  256

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  257  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  307



>gb|KJB76651.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=382

 Score =   315 bits (806),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|KJB76649.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=372

 Score =   314 bits (805),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AIM48892.1| actin, partial [Cinnamomum camphora]
Length=332

 Score =   313 bits (802),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  137  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  196

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SS++EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  197  LAYVALDYEQELETAKSSSTIEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  256

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  257  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  307



>dbj|BAI39620.1| beta actin [Bruguiera gymnorhiza]
Length=297

 Score =   311 bits (798),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGV HTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  78   GDGVRHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEK  137

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  138  LAYIALDYEQEMETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  197

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEI+ALAPSSMK
Sbjct  198  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMK  248



>gb|AEL88911.1| actin [Halodule beaudettei]
 gb|AEL88912.1| actin, partial [Halodule beaudettei]
Length=289

 Score =   311 bits (797),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD  MKILTERGYSFTTSAEREIVRDMKEK
Sbjct  70   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDAFMKILTERGYSFTTSAEREIVRDMKEK  129

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYE+ELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGME AGIH
Sbjct  130  LAYIALDYERELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEVAGIH  189

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  190  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  240



>dbj|BAD93481.1| putative actin [Tricyrtis hirta]
Length=208

 Score =   308 bits (790),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRD+KEK
Sbjct  35   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDIKEK  94

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EKSYELPDGQVI IG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  95   LAYVALDYEQELETAKSSSSIEKSYELPDGQVIAIGAERFRCPEVLFQPSLIGMEAAGIH  154

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  155  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  205



>gb|KJB76650.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76653.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76654.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76655.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
 gb|KJB76656.1| hypothetical protein B456_012G100700 [Gossypium raimondii]
Length=377

 Score =   314 bits (805),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_008345452.1| PREDICTED: actin [Malus domestica]
Length=360

 Score =   314 bits (804),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  141  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  200

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  201  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  260

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  261  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  311



>gb|EAY79170.1| hypothetical protein OsI_34279 [Oryza sativa Indica Group]
Length=294

 Score =   311 bits (798),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  75   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDIKEK  134

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEV+FQPS+IGMEA GIH
Sbjct  135  LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVMFQPSLIGMEAPGIH  194

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  195  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  245



>gb|ACB40932.1| actin 1 [Artemisia annua]
Length=253

 Score =   310 bits (794),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  80   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  139

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELE S + S++EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  140  LAYIALDYEQELEISNSGSTIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  199

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  200  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  250



>ref|XP_003622019.1| Actin [Medicago truncatula]
 gb|AES78237.1| actin-97 [Medicago truncatula]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET++TSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  328



>dbj|BAK18562.1| actin [Eustoma exaltatum subsp. russellianum]
 dbj|BAK18563.1| actin [Eustoma exaltatum subsp. russellianum]
Length=332

 Score =   313 bits (801),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGY FTTSAEREIVRD+KEK
Sbjct  113  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYMFTTSAEREIVRDIKEK  172

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALD+EQELET+K+SSS+EK+YELPDGQVITI NERFRCPEVLFQPS+IGME+AGIH
Sbjct  173  LAYVALDFEQELETAKSSSSLEKNYELPDGQVITIANERFRCPEVLFQPSMIGMESAGIH  232

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  233  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  283



>ref|XP_011099798.1| PREDICTED: actin-1-like [Sesamum indicum]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGY+LPHAILRLDLAGRDLTD+LMKILTERGY FTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYSLPHAILRLDLAGRDLTDYLMKILTERGYMFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSSSVEK+YELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIALDYEQELETAKTSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMK  328



>gb|AFK41203.1| unknown [Medicago truncatula]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET++TSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  328



>dbj|BAL14664.1| actin [Chrysanthemum seticuspe f. boreale]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|KHF98940.1| hypothetical protein F383_05741 [Gossypium arboreum]
 gb|KJB12121.1| hypothetical protein B456_002G001500 [Gossypium raimondii]
 gb|KJB12122.1| hypothetical protein B456_002G001500 [Gossypium raimondii]
 gb|KJB12123.1| hypothetical protein B456_002G001500 [Gossypium raimondii]
Length=376

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  157  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTTAEREIVRDMKEK  216

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SS++EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  217  LAYVALDYEQELETAKSSSAIEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  276

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  277  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  327



>gb|AGW21693.1| actin 1, partial [Beta vulgaris]
Length=199

 Score =   308 bits (788),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  11   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYMFTTSAEREIVRDIKEK  70

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALD+EQE ET+K+SS++EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  71   LAYVALDFEQESETAKSSSAIEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  130

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  131  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  181



>gb|EYU33199.1| hypothetical protein MIMGU_mgv1a008335mg [Erythranthe guttata]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGY+LPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYSLPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ETSKTSSSVEKSYELPDGQVITIGNERFRCPEVLFQPS++GMEAAG+H
Sbjct  218  LSYIALDYEQEIETSKTSSSVEKSYELPDGQVITIGNERFRCPEVLFQPSMVGMEAAGVH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_008241048.1| PREDICTED: actin [Prunus mume]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_010528400.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010528408.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529829.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529830.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529831.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010529832.1| PREDICTED: actin-1 [Tarenaya hassleriana]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSS+VEK+YELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETAKTSSAVEKNYELPDGQVITIGSERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AAV83798.1| putative actin 2 [Chorispora bungeana]
Length=363

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  144  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEK  203

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+E++ TSSSV+KSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  204  LAYIALDYEQEMESAYTSSSVDKSYELPDGQVITIGGERFRCPEVLFQPSLVGMEAAGIH  263

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  264  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  314



>ref|XP_010553283.1| PREDICTED: actin [Tarenaya hassleriana]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSS+VEK+YELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETSKTSSAVEKNYELPDGQVITIGSERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_007027035.1| Actin 3 [Theobroma cacao]
 gb|EOY07537.1| Actin 3 [Theobroma cacao]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_010554872.1| PREDICTED: actin-1 [Tarenaya hassleriana]
 ref|XP_010554874.1| PREDICTED: actin-1 [Tarenaya hassleriana]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIA+DYEQE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIAVDYEQEMETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>emb|CDP09045.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLT++L+KILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTEYLVKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALD+EQELE +KTSSS+EK+YELPDGQVITIGNERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDFEQELEAAKTSSSIEKNYELPDGQVITIGNERFRCPEVLFQPSLIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_008458880.1| PREDICTED: actin-82-like isoform X3 [Cucumis melo]
Length=419

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF+GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFSGIADRMSKEISALAPSSMK  328



>gb|AEY82383.1| actin, partial [Chrysanthemum lavandulifolium]
Length=290

 Score =   311 bits (797),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  117  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDMKEK  176

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  177  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  236

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  237  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  287



>gb|AGZ90152.1| actin 11, partial [Litsea cubeba]
Length=377

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|AAC49652.1| actin [Striga asiatica]
Length=377

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ET+KTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQEMETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|EPS69959.1| actin [Genlisea aurea]
Length=377

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITI  ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIAAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_002530711.1| actin, putative [Ricinus communis]
 gb|EEF31665.1| actin, putative [Ricinus communis]
Length=377

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_006351818.1| PREDICTED: actin-101-like [Solanum tuberosum]
Length=377

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+ +SS+VEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LAYVALDYEQELETATSSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSLVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>sp|P30171.1|ACT11_SOLTU RecName: Full=Actin-97 [Solanum tuberosum]
 emb|CAA39280.1| actin [Solanum tuberosum]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|NP_187818.1| actin-11 [Arabidopsis thaliana]
 sp|P53496.1|ACT11_ARATH RecName: Full=Actin-11 [Arabidopsis thaliana]
 gb|AAG51045.1|AC069473_7 actin 11 (ACT11); 24016-22523 [Arabidopsis thaliana]
 gb|AAB39404.1| actin-11 [Arabidopsis thaliana]
 dbj|BAB01959.1| actin 11 [Arabidopsis thaliana]
 gb|AAM65277.1| actin 11 (ACT11) [Arabidopsis thaliana]
 dbj|BAC42968.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64013.1| putative actin 11 (ACT11) [Arabidopsis thaliana]
 gb|AEE75151.1| actin-11 [Arabidopsis thaliana]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ET+ TSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LAYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQPSLVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>sp|P30173.1|ACT13_SOLTU RecName: Full=Actin-101 [Solanum tuberosum]
 emb|CAA39281.1| actin [Solanum tuberosum]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SS+VEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LAYVALDYEQELETAKSSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSLVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_007016432.1| Actin-11 isoform 1 [Theobroma cacao]
 ref|XP_007016433.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY34051.1| Actin-11 isoform 1 [Theobroma cacao]
 gb|EOY34052.1| Actin-11 isoform 1 [Theobroma cacao]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS++EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAIEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_004236747.1| PREDICTED: actin-97 [Solanum lycopersicum]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AFO53510.1| actin, partial [Freesia hybrid cultivar]
Length=341

 Score =   313 bits (801),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  141  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEK  200

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  201  LAYIALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  260

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  261  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  311



>ref|XP_004960554.1| PREDICTED: actin-97-like [Setaria italica]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+K SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKNSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_002283590.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658578.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658579.1| PREDICTED: actin-1 [Vitis vinifera]
 ref|XP_010658580.1| PREDICTED: actin-1 [Vitis vinifera]
 emb|CAN83697.1| hypothetical protein VITISV_027542 [Vitis vinifera]
 emb|CBI31677.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD++MKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEA+GIH
Sbjct  218  LSYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEASGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AGA61748.1| actin, partial [Rhus chinensis]
Length=311

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  114  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  173

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  174  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  233

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  234  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  284



>ref|XP_010922421.1| PREDICTED: actin-100-like isoform X2 [Elaeis guineensis]
Length=332

 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  113  GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  172

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+++SS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  173  LAYVALDYEQELETARSSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  232

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  233  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  283



>ref|XP_009618901.1| PREDICTED: actin [Nicotiana tomentosiformis]
 ref|XP_009618902.1| PREDICTED: actin [Nicotiana tomentosiformis]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALD+EQE+ETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDFEQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_007205365.1| hypothetical protein PRUPE_ppa007214mg [Prunus persica]
 gb|EMJ06564.1| hypothetical protein PRUPE_ppa007214mg [Prunus persica]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET+KT SSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETAKTGSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|NP_001051086.1| Os03g0718100 [Oryza sativa Japonica Group]
 sp|Q10DV7.1|ACT1_ORYSJ RecName: Full=Actin-1; AltName: Full=OsRAC1 [Oryza sativa Japonica 
Group]
 sp|A2XLF2.1|ACT1_ORYSI RecName: Full=Actin-1 [Oryza sativa Indica Group]
 dbj|BAC76319.1| actin [Oryza sativa Japonica Group]
 gb|ABF98567.1| Actin-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13000.1| Os03g0718100 [Oryza sativa Japonica Group]
 gb|EAY91662.1| hypothetical protein OsI_13301 [Oryza sativa Indica Group]
 gb|EAZ28382.1| hypothetical protein OsJ_12362 [Oryza sativa Japonica Group]
 gb|AGT42318.1| actin-1 [Oryza sativa Japonica Group]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDY+QE+ET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LSYIALDYDQEMETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AFZ78523.1| actin [Populus tomentosa]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|ABU68265.1| actin [Prunus salicina]
Length=317

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  115  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  174

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  175  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  234

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  235  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  285



>ref|NP_001275087.1| actin-like [Solanum tuberosum]
 gb|ABB55389.1| actin-like [Solanum tuberosum]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|KHN27489.1| Actin-97 [Glycine soja]
Length=332

 Score =   312 bits (799),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  113  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDMKEK  172

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVL+QPS++GMEA+GIH
Sbjct  173  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLYQPSMVGMEASGIH  232

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  233  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  283



>ref|XP_008354115.1| PREDICTED: actin-1 [Malus domestica]
 ref|XP_008354116.1| PREDICTED: actin-1 [Malus domestica]
 ref|XP_009343424.1| PREDICTED: actin-1 [Pyrus x bretschneideri]
Length=377

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQE+ETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQEMETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_004230564.1| PREDICTED: actin-101 [Solanum lycopersicum]
 ref|XP_010315037.1| PREDICTED: actin-101 [Solanum lycopersicum]
 ref|XP_010315039.1| PREDICTED: actin-101 [Solanum lycopersicum]
 ref|XP_010315043.1| PREDICTED: actin-101 [Solanum lycopersicum]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+++SS+VEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LAYVALDYEQELETARSSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSLVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AAZ74665.1| actin [Cucumis sativus]
Length=261

 Score =   310 bits (793),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  74   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  133

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGME AGIH
Sbjct  134  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEDAGIH  193

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIM+CDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  194  ETTYNSIMECDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  244



>ref|XP_010557948.1| PREDICTED: actin-1-like [Tarenaya hassleriana]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ETSKT S+VEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LAYIALDYEQEMETSKTGSAVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AID66748.1| actin protein, partial [Robinia pseudoacacia]
Length=289

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  103  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTSAEREIVRDIKEK  162

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  163  LAYVALDYEQELETAKSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  222

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  223  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  273



>ref|XP_010498525.1| PREDICTED: actin-11 [Camelina sativa]
 ref|XP_010464961.1| PREDICTED: actin-11 [Camelina sativa]
 ref|XP_010486900.1| PREDICTED: actin-11 [Camelina sativa]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ET+ TSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LAYIALDYEQEMETANTSSSVEKSYELPDGQVITIGGERFRCPEVLFQPSLVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|KHG29811.1| Actin [Gossypium arboreum]
 gb|KJB07135.1| hypothetical protein B456_001G110400 [Gossypium raimondii]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALD+EQELET+KTSSS+EKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDFEQELETAKTSSSIEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>gb|AFO68183.1| actin, partial [Anthurium andraeanum]
Length=276

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD KEK
Sbjct  57   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDXKEK  116

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  117  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  176

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKD YGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  177  ETTYNSIMKCDVDIRKDXYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  227



>gb|AFU25697.1| actin, partial [Freesia hybrid cultivar]
Length=344

 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  144  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEK  203

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  204  LAYIALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  263

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  264  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  314



>gb|ACJ05348.1| actin [Camellia sinensis]
Length=225

 Score =   308 bits (789),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAG DLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  6    GDGVSHTVPIYEGYALPHAILRLDLAGHDLTDALMKILTERGYMFTTTAEREIVRDMKEK  65

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  66   LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  125

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  126  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  176



>gb|AAB40078.1| actin, partial [Glycine max]
Length=336

 Score =   312 bits (799),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTSAEREIVRDMKEK
Sbjct  138  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTSAEREIVRDMKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  198  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  308



>gb|AEV59658.1| actin, partial [Oxytropis arctobia]
Length=284

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  95   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTSAEREIVRDIKEK  154

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  155  LAYVALDYEQELETAKSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  214

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  215  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  265



>gb|ABP01541.1| actin [Phalaris canariensis]
Length=253

 Score =   309 bits (791),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  80   GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTTAEREIVRDIKEK  139

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K SSSVEK+YELPDGQVITIG ERFRCPEVLFQPSIIGMEA GIH
Sbjct  140  LAYVALDYEQELETAKGSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSIIGMEAPGIH  199

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIA+RMSKEITALAPSSMK
Sbjct  200  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIAERMSKEITALAPSSMK  250



>gb|AEV59661.1| actin, partial [Oxytropis splendens]
Length=286

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  99   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTSAEREIVRDIKEK  158

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  159  LAYVALDYEQELETAKSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  218

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  219  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  269



>gb|AEV59656.1| actin, partial [Oxytropis maydelliana]
Length=286

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTSAEREIVRD+KEK
Sbjct  98   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTSAEREIVRDIKEK  157

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  158  LAYVALDYEQELETAKSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  217

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  218  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  268



>gb|AAX07755.1| actin [Carica papaya]
Length=193

 Score =   307 bits (786),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  5    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEK  64

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALD+EQELET+K+SSS+EK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  65   LAYVALDFEQELETAKSSSSIEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  124

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADR+SKEITALAPSSMK
Sbjct  125  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRVSKEITALAPSSMK  175



>gb|AEF58501.1| actin [Platycodon grandiflorus]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_008363858.1| PREDICTED: LOW QUALITY PROTEIN: actin-like [Malus domestica]
 ref|XP_009338750.1| PREDICTED: actin-like [Pyrus x bretschneideri]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_010682856.1| PREDICTED: actin-11 [Beta vulgaris subsp. vulgaris]
 ref|XP_010682857.1| PREDICTED: actin-11 [Beta vulgaris subsp. vulgaris]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD++MKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ET+KTSS+VEKS+ELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  218  LAYIALDYEQEMETAKTSSAVEKSFELPDGQVITIGGERFRCPEVLFQPSFIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|NP_001054419.1| Os05g0106600 [Oryza sativa Japonica Group]
 gb|AAU44177.1| putative actin [Oryza sativa Japonica Group]
 dbj|BAF16333.1| Os05g0106600 [Oryza sativa Japonica Group]
 dbj|BAG88048.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYVALDYEQELETAKNSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_010111138.1| hypothetical protein L484_010751 [Morus notabilis]
 gb|AGT97389.1| actin [Morus alba]
 gb|EXC30503.1| hypothetical protein L484_010751 [Morus notabilis]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALD+EQE+ET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDFEQEMETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMK  328



>gb|ADK20401.1| actin [Citrus maxima]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_009381444.1| PREDICTED: actin-like [Musa acuminata subsp. malaccensis]
Length=377

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KT+SSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTNSSVEKNYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMFTGIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFTGIADRMSKEITALAPSSMK  328



>ref|XP_010106464.1| hypothetical protein L484_025221 [Morus notabilis]
 gb|EXC10640.1| hypothetical protein L484_025221 [Morus notabilis]
Length=377

 Score =   313 bits (803),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_002308365.1| actin family protein [Populus trichocarpa]
 ref|XP_002322664.1| actin family protein [Populus trichocarpa]
 ref|XP_011033209.1| PREDICTED: actin [Populus euphratica]
 ref|XP_011004840.1| PREDICTED: actin [Populus euphratica]
 ref|XP_011013244.1| PREDICTED: actin [Populus euphratica]
 gb|ABK92789.1| unknown [Populus trichocarpa]
 gb|ABK93722.1| unknown [Populus trichocarpa]
 gb|ABK95521.1| unknown [Populus trichocarpa]
 gb|EEE91888.1| actin family protein [Populus trichocarpa]
 gb|EEF04425.1| actin family protein [Populus trichocarpa]
 gb|ADK70741.1| actin [Populus tomentosa]
 gb|ADK70742.1| actin [Populus tomentosa]
 gb|ADK70743.1| actin [Populus tomentosa]
 gb|ADK70744.1| actin [Populus tomentosa]
 gb|ADK70745.1| actin [Populus tomentosa]
 gb|ADK70746.1| actin [Populus tomentosa]
 gb|ADK70747.1| actin [Populus tomentosa]
 gb|ADK70748.1| actin [Populus tomentosa]
 gb|ADK70749.1| actin [Populus tomentosa]
 gb|ADK70750.1| actin [Populus tomentosa]
 gb|ADK70751.1| actin [Populus tomentosa]
 gb|ADK70752.1| actin [Populus tomentosa]
 gb|ADK70753.1| actin [Populus tomentosa]
 gb|ADK70754.1| actin [Populus tomentosa]
 gb|ADK70755.1| actin [Populus tomentosa]
 gb|ADK70756.1| actin [Populus tomentosa]
 gb|ADK70757.1| actin [Populus tomentosa]
 gb|ADK70758.1| actin [Populus tomentosa]
 gb|ADK70759.1| actin [Populus tomentosa]
 gb|ADK70760.1| actin [Populus tomentosa]
 gb|ADK70761.1| actin [Populus tomentosa]
 gb|ADK70762.1| actin [Populus tomentosa]
 gb|ADK70763.1| actin [Populus tomentosa]
 gb|ADK70764.1| actin [Populus tomentosa]
 gb|ADK70765.1| actin [Populus tomentosa]
 gb|ADK70766.1| actin [Populus tomentosa]
 gb|ADK70767.1| actin [Populus tomentosa]
 gb|ADK70768.1| actin [Populus tomentosa]
 gb|ADK70769.1| actin [Populus tomentosa]
 gb|ADK70770.1| actin [Populus tomentosa]
 gb|ADK70771.1| actin [Populus tomentosa]
 gb|ADK70772.1| actin [Populus tomentosa]
 gb|ADK70773.1| actin [Populus tomentosa]
 gb|ADK70774.1| actin [Populus tomentosa]
 gb|ADK70775.1| actin [Populus tomentosa]
 gb|ADK70776.1| actin [Populus tomentosa]
 gb|ADK70777.1| actin [Populus tomentosa]
 gb|ADK70778.1| actin [Populus tomentosa]
 gb|ADK70779.1| actin [Populus tomentosa]
 gb|ADK70780.1| actin [Populus tomentosa]
 gb|ADK70781.1| actin [Populus tomentosa]
 gb|AFZ78524.1| actin [Populus tomentosa]
Length=377

 Score =   313 bits (803),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_008355144.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   313 bits (803),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_004302738.1| PREDICTED: actin [Fragaria vesca subsp. vesca]
Length=377

 Score =   313 bits (803),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|NP_001239660.1| uncharacterized protein LOC100781831 [Glycine max]
 gb|ACU22968.1| unknown [Glycine max]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET++TSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEA+GIH
Sbjct  218  LSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQPSMIGMEASGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  328



>gb|AAB18643.1| actin [Pisum sativum]
 gb|AAB38513.1| actin, partial [Pisum sativum]
Length=281

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY+FTTSAEREIVRDMKEK
Sbjct  62   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDGLMKILTERGYTFTTSAEREIVRDMKEK  121

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS+IGME+ GIH
Sbjct  122  LAYIALDYEQELETAKTSSAVEKTYELPDGQVITIGAERFRCPEVLFQPSMIGMESPGIH  181

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETT+NSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  182  ETTFNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  232



>ref|XP_004492148.1| PREDICTED: actin-11-like [Cicer arietinum]
 ref|XP_007139215.1| hypothetical protein PHAVU_008G011000g [Phaseolus vulgaris]
 gb|ESW11209.1| hypothetical protein PHAVU_008G011000g [Phaseolus vulgaris]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET++TSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  328



>gb|EYU20691.1| hypothetical protein MIMGU_mgv1a008334mg [Erythranthe guttata]
 gb|EYU20692.1| hypothetical protein MIMGU_mgv1a008334mg [Erythranthe guttata]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTTAEREIVRDIKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ET+KTSS+VEK+YELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LAYIALDYEQEVETAKTSSAVEKNYELPDGQVITIGAERFRCPEVLFQPSMVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_010111359.1| hypothetical protein L484_028016 [Morus notabilis]
 gb|EXC30837.1| hypothetical protein L484_028016 [Morus notabilis]
 gb|AID16085.1| actin [Morus alba]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|ADY38689.1| actin [Camellia sinensis]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|ABR22550.1| actin, partial [Storeatula sp. CCMP1868]
Length=276

 Score =   310 bits (793),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD++MKILTERGYSFTT+AEREIVRD+KEK
Sbjct  75   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEK  134

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L Y+ALD+EQE++T+ +SSSVEKSYELPDGQVITIGNERFRCPEVLFQPS IG+E+AG+H
Sbjct  135  LCYVALDFEQEMQTAASSSSVEKSYELPDGQVITIGNERFRCPEVLFQPSFIGLESAGVH  194

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF+GIADRM KEITALAPS+MK
Sbjct  195  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFSGIADRMQKEITALAPSTMK  245



>gb|KHN13906.1| Actin-11 [Glycine soja]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELET++TSSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS+IGMEA+GIH
Sbjct  218  LSYIALDYEQELETARTSSSVEKSYELPDGQVITIGDERFRCPEVLFQPSMIGMEASGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  328



>ref|XP_008385127.1| PREDICTED: actin [Malus domestica]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_007028993.1| Actin-11 [Theobroma cacao]
 gb|EOY09495.1| Actin-11 [Theobroma cacao]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_007204362.1| hypothetical protein PRUPE_ppa007228mg [Prunus persica]
 ref|XP_008240928.1| PREDICTED: actin-like [Prunus mume]
 ref|XP_008240929.1| PREDICTED: actin-like [Prunus mume]
 ref|XP_008392069.1| PREDICTED: actin-like [Malus domestica]
 ref|XP_008360627.1| PREDICTED: actin [Malus domestica]
 gb|EMJ05561.1| hypothetical protein PRUPE_ppa007228mg [Prunus persica]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_004304361.1| PREDICTED: actin-like [Fragaria vesca subsp. vesca]
 ref|XP_011468046.1| PREDICTED: actin-like [Fragaria vesca subsp. vesca]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|AFK40690.1| unknown [Lotus japonicus]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQE+ETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LAYIALDYEQEIETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSLVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  328



>gb|KJB76087.1| hypothetical protein B456_012G070300 [Gossypium raimondii]
Length=365

 Score =   313 bits (801),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD+LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LSYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKE++ALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKELSALAPSSMK  328



>gb|AAB40077.1| actin, partial [Glycine max]
Length=336

 Score =   311 bits (798),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRDMKEK
Sbjct  138  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDFLMKILTERGYSFTTSAEREIVRDMKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVL+QPS++GMEA+GIH
Sbjct  198  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLYQPSMVGMEASGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEI+ALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEISALAPSSMK  308



>ref|XP_009759480.1| PREDICTED: actin-101 [Nicotiana sylvestris]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTSAEREIVRDVKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG+ERFRCPEVLFQPS++GMEAAGIH
Sbjct  218  LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGSERFRCPEVLFQPSLVGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_006429882.1| hypothetical protein CICLE_v10011974mg [Citrus clementina]
 ref|XP_006492856.1| PREDICTED: actin-like [Citrus sinensis]
 gb|ESR43122.1| hypothetical protein CICLE_v10011974mg [Citrus clementina]
 gb|KDO70918.1| hypothetical protein CISIN_1g017089mg [Citrus sinensis]
 gb|KDO70919.1| hypothetical protein CISIN_1g017089mg [Citrus sinensis]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_006846523.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda]
 gb|ERN08198.1| hypothetical protein AMTR_s00018p00188200 [Amborella trichopoda]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|AFD62269.1| actin 2 [Annona cherimola]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYVALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_004142070.1| PREDICTED: actin-like [Cucumis sativus]
 ref|XP_004165254.1| PREDICTED: actin-like [Cucumis sativus]
 ref|XP_008447829.1| PREDICTED: actin [Cucumis melo]
 ref|XP_008447838.1| PREDICTED: actin [Cucumis melo]
 ref|XP_008447847.1| PREDICTED: actin [Cucumis melo]
 ref|XP_008447857.1| PREDICTED: actin [Cucumis melo]
 ref|XP_008447866.1| PREDICTED: actin [Cucumis melo]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>dbj|BAD93483.1| putative actin [Agapanthus praecox subsp. orientalis]
Length=208

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGY LPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  35   GDGVSHTVPIYEGYTLPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEK  94

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGME+ GIH
Sbjct  95   LAYVALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSLIGMESPGIH  154

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  155  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  205



>ref|XP_010265918.1| PREDICTED: actin [Nelumbo nucifera]
 ref|XP_010265919.1| PREDICTED: actin [Nelumbo nucifera]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>ref|XP_009341422.1| PREDICTED: actin-like [Pyrus x bretschneideri]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|AEL88498.1| actin [Syringodium filiforme]
Length=289

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY+FTT+AEREIVRDMKEK
Sbjct  70   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYTFTTTAEREIVRDMKEK  129

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  130  LAYIALDYEQELETAKSSSSVEKTYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  189

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMK DVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  190  ETTYNSIMKSDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  240



>ref|XP_004136568.1| PREDICTED: actin-like [Cucumis sativus]
 ref|XP_004163927.1| PREDICTED: actin-like [Cucumis sativus]
 ref|XP_008380137.1| PREDICTED: actin-like [Malus domestica]
 ref|XP_008443052.1| PREDICTED: actin-like [Cucumis melo]
 ref|XP_009369519.1| PREDICTED: actin-like [Pyrus x bretschneideri]
 gb|KGN59299.1| Actin 3 [Cucumis sativus]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|AEI27257.1| actin [Halodule beaudettei]
 gb|AEI27261.1| actin [Halodule beaudettei]
Length=283

 Score =   310 bits (793),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  64   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  123

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  124  LAYIALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  183

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMK DVDIRKDLYGNIVLSGG+TMF GIADRMSKEIT LAPSSMK
Sbjct  184  ETTYNSIMKSDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITVLAPSSMK  234



>dbj|BAD93482.1| putative actin [Agapanthus praecox subsp. orientalis]
Length=175

 Score =   306 bits (783),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGY LPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  2    GDGVSHTVPIYEGYTLPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEK  61

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELETSKTSS+VEKSYELPDGQVITIG ERFRCPE+LFQPS+IGME+ GIH
Sbjct  62   LAYVALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEILFQPSLIGMESPGIH  121

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  122  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  172



>gb|AEI27262.1| actin [Halodule beaudettei]
Length=283

 Score =   310 bits (793),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  64   GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  123

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  124  LAYIALDYEQELETAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  183

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMK DVDIRKDLYGNIVLSGG+TMF GIADRMSKEIT LAPSSMK
Sbjct  184  ETTYNSIMKSDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITVLAPSSMK  234



>gb|KJB18789.1| hypothetical protein B456_003G069800 [Gossypium raimondii]
Length=332

 Score =   311 bits (798),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTT+AEREIVRDMKEK
Sbjct  113  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYMFTTTAEREIVRDMKEK  172

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELET+K+SSSVEK+YELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  173  LAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIGMEAAGIH  232

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  233  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  283



>ref|XP_006855625.1| hypothetical protein AMTR_s00044p00088410 [Amborella trichopoda]
 gb|ERN17092.1| hypothetical protein AMTR_s00044p00088410 [Amborella trichopoda]
Length=398

 Score =   314 bits (804),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  179  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  238

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET++TSS+VEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  239  LAYIALDYEQELETARTSSTVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  298

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  299  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  349



>sp|Q96482.1|ACT1_SOLLC RecName: Full=Actin-41, partial [Solanum lycopersicum]
 gb|AAB40093.1| actin, partial [Solanum lycopersicum]
Length=336

 Score =   311 bits (798),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDG+SHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTTSAEREIVRD+KEK
Sbjct  138  GDGLSHTVPIYEGYALPHAILRLDLAGRDLTDSLMKILTERGYSFTTSAEREIVRDVKEK  197

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVI IG+ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  198  LAYIALDYEQELETSKTSSSVEKSYELPDGQVIPIGSERFRCPEVLFQPSMIGMEAAGIH  257

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMF GIADRMSKEITALAPSSMK
Sbjct  258  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMK  308



>gb|AHL58686.1| actin, partial [Lophopyrum elongatum]
Length=199

 Score =   306 bits (785),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHT PIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRD+KEK
Sbjct  11   GDGVSHTEPIYEGYALPHAILRLDLAGRDLTDCLMKILTERGYSFTTTAEREIVRDIKEK  70

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+Y+ALDYEQELE +K+SSSVEKSYELPDGQVITIG ERFRCPEVLFQPS IGMEAAGIH
Sbjct  71   LAYVALDYEQELENAKSSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAAGIH  130

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  131  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  181



>gb|AFN53639.1| putative actin-97 protein [Linum usitatissimum]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELETSKTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



>gb|AEO45960.1| actin 4 [Mangifera indica]
Length=377

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDHLMKILTERGYSFTTSAEREIVRDMKEK  180
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGYSFTT+AEREIVRDMKEK
Sbjct  158  GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEK  217

Query  181  LSYIALDYEQELetsktsssveksYELPDGQVITIGNERFRCPEVLFQPSIIGMEAAGIH  360
            L+YIALDYEQELET+KTSSSVEKSYELPDGQVITIG ERFRCPEVLFQPS+IGMEAAGIH
Sbjct  218  LAYIALDYEQELETAKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIH  277

Query  361  ETTYNSIMKCDVDIRKDLYGNIVLSGGTTMFTGIADRMSKEITALAPSSMK  513
            ETTYNSIMKCDVDIRKDLYGNIVLSGG+TMF GIADRMSKEITALAPSSMK
Sbjct  278  ETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMK  328



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720