BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006E01

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98898.1|  unnamed protein product                                118   5e-27   Coffea canephora [robusta coffee]
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...    112   5e-25   Sesamum indicum [beniseed]
ref|XP_009770759.1|  PREDICTED: acyl-CoA-binding domain-containin...    100   1e-22   Nicotiana sylvestris
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...    102   2e-21   Nicotiana tomentosiformis
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg                100   5e-21   Erythranthe guttata [common monkey flower]
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...  98.2    3e-20   Solanum tuberosum [potatoes]
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...  98.2    4e-20   Solanum lycopersicum
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...  98.2    4e-20   Solanum tuberosum [potatoes]
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...  98.2    4e-20   Solanum lycopersicum
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...  90.9    2e-17   Cicer arietinum [garbanzo]
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...  88.2    1e-16   Vitis vinifera
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...  86.3    6e-16   
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...  85.5    9e-16   Pyrus x bretschneideri [bai li]
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g           85.1    1e-15   Phaseolus vulgaris [French bean]
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...  84.0    3e-15   Pyrus x bretschneideri [bai li]
gb|AES64218.2|  acyl-CoA-binding domain protein                       83.6    4e-15   Medicago truncatula
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein       83.6    5e-15   
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.8    7e-15   Prunus mume [ume]
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.4    1e-14   
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.4    1e-14   
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...  81.3    3e-14   Phoenix dactylifera
gb|EPS67095.1|  hypothetical protein M569_07681                       77.4    4e-14   Genlisea aurea
gb|KDO75106.1|  hypothetical protein CISIN_1g0050431mg                78.2    7e-14   Citrus sinensis [apfelsine]
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg           79.7    9e-14   Citrus clementina [clementine]
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...  79.3    1e-13   Fragaria vesca subsp. vesca
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...  78.2    2e-13   Citrus sinensis [apfelsine]
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...  77.8    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...  77.0    6e-13   Glycine max [soybeans]
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4          77.0    6e-13   Glycine soja [wild soybean]
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4          75.5    2e-12   Glycine soja [wild soybean]
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g           75.5    2e-12   Phaseolus vulgaris [French bean]
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.3    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.3    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.3    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010241732.1|  PREDICTED: acyl-CoA-binding domain-containin...  73.9    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...  73.9    7e-12   Glycine max [soybeans]
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...  73.6    8e-12   Glycine max [soybeans]
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...  71.6    4e-11   Cucumis melo [Oriental melon]
emb|CDY13903.1|  BnaC09g39230D                                        70.1    1e-10   Brassica napus [oilseed rape]
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...  69.7    1e-10   Cucumis sativus [cucumbers]
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...  68.6    4e-10   Brassica rapa
emb|CDX92598.1|  BnaA10g16370D                                        68.6    4e-10   
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.8    7e-10   Elaeis guineensis
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.8    7e-10   Elaeis guineensis
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...  67.8    7e-10   
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.8    7e-10   
gb|KDP40010.1|  hypothetical protein JCGZ_02008                       67.4    8e-10   Jatropha curcas
ref|XP_010098333.1|  hypothetical protein L484_023581                 66.6    2e-09   
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...  66.2    2e-09   Elaeis guineensis
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...  66.2    2e-09   Elaeis guineensis
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...  66.2    2e-09   
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...  66.2    2e-09   Elaeis guineensis
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...  65.5    4e-09   
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...  65.1    5e-09   
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.7    7e-09   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAH19562.1|  AT5G18590                                            62.4    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197360.2|  kelch repeat-containing protein                     62.4    4e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78582.1|  RanGAP1 interacting protein                           62.4    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002516884.1|  acyl-CoA binding protein, putative               61.2    8e-08   Ricinus communis
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...  60.8    1e-07   
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...  60.8    1e-07   
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...  60.8    1e-07   
ref|XP_009402528.1|  PREDICTED: acyl-CoA-binding domain-containin...  60.5    1e-07   
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...  60.5    1e-07   
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g           60.1    2e-07   
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg           59.3    4e-07   Eutrema salsugineum [saltwater cress]
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4          59.3    4e-07   Gossypium arboreum [tree cotton]
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g           58.5    6e-07   
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.5    7e-07   Populus euphratica
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.2    7e-07   Populus euphratica
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.5    7e-07   Populus euphratica
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.2    8e-07   Populus euphratica
gb|KJB72597.1|  hypothetical protein B456_011G187500                  57.8    1e-06   Gossypium raimondii
gb|KJB72598.1|  hypothetical protein B456_011G187500                  57.8    1e-06   Gossypium raimondii
gb|KJB72599.1|  hypothetical protein B456_011G187500                  57.8    1e-06   Gossypium raimondii
ref|XP_006287583.1|  hypothetical protein CARUB_v10000793mg           57.4    1e-06   
gb|KJB72596.1|  hypothetical protein B456_011G187500                  57.8    1e-06   Gossypium raimondii
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.4    1e-06   Cicer arietinum [garbanzo]
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.4    1e-06   Populus euphratica
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.4    2e-06   
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.4    2e-06   Cicer arietinum [garbanzo]
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.4    2e-06   
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.6    3e-06   
ref|XP_002873905.1|  kelch repeat-containing protein                  56.2    3e-06   
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...  55.8    4e-06   Setaria italica
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...  55.8    4e-06   
gb|KCW61088.1|  hypothetical protein EUGRSUZ_H03862                   55.8    5e-06   Eucalyptus grandis [rose gum]
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...  55.8    5e-06   
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...  54.3    2e-05   Camelina sativa [gold-of-pleasure]
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4          53.9    2e-05   Gossypium arboreum [tree cotton]
gb|AES91804.2|  acyl-CoA-binding domain protein                       52.8    5e-05   Medicago truncatula
gb|AES91803.2|  acyl-CoA-binding domain protein                       52.8    5e-05   Medicago truncatula
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein       52.8    5e-05   
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein       52.8    5e-05   
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...  52.0    1e-04   
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...  52.0    1e-04   Brachypodium distachyon [annual false brome]
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein    49.3    7e-04   Gossypium arboreum [tree cotton]
gb|KJB38635.1|  hypothetical protein B456_006G264600                  49.3    7e-04   Gossypium raimondii
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915        49.3    7e-04   



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR SS +G+ +  ++N S ES+CQ S+G
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRVSSYSGQGLAPALNASHESNCQTSSG  60

Query  535  ASEFNNCTSGSSE  573
            A EFNNCTSGSSE
Sbjct  61   APEFNNCTSGSSE  73



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRL+VQLSD+AQGT+SPIRHPKRFS+S GE V  + ++++E +CQ S+ 
Sbjct  1    MFGFSRRRMKLGRLRVQLSDSAQGTRSPIRHPKRFSNSNGEGVAAASSEADELNCQSSSN  60

Query  535  ASEFNNCTSGSSE  573
            A E NNCTSGSSE
Sbjct  61   APELNNCTSGSSE  73



>ref|XP_009770759.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Nicotiana sylvestris]
Length=214

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL      + QGT+SP+RHPKRFS+S+GEAV +S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----SSPQGTRSPMRHPKRFSNSSGEAVPHSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSE  573
            A EFNNC SG +E
Sbjct  56   APEFNNCASGGTE  68



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL      + QGT+SP+RHPKRFS+S+GEAV +S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----SSPQGTRSPMRHPKRFSNSSGEAVPHSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSE  573
            A EFNNC SG SE
Sbjct  56   APEFNNCASGGSE  68



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRR+MK+GR+KVQLSD++QGT+SPIRH KRFSSS GE V  + ++S+E +C  S+ 
Sbjct  1    MFGFSRRKMKIGRVKVQLSDSSQGTRSPIRHAKRFSSSNGEGVALASSESDELNCHSSSN  60

Query  535  ASEFNNCTSGSSE  573
              E NNC+SGSSE
Sbjct  61   TPELNNCSSGSSE  73



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSE  573
            A EFN+C SG SE
Sbjct  56   APEFNDCASGGSE  68



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSE  573
            A EFN+C SG SE
Sbjct  56   APEFNDCASGGSE  68



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSE  573
            A EFN+C SG SE
Sbjct  56   APEFNDCASGGSE  68



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  535  ASEFNNCTSGSSE  573
            A EFN+C SG SE
Sbjct  56   APEFNDCASGGSE  68



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRR  KL R+KVQLSDT QGT+SPIR+PKR  +S G+ V  +   SEE  CQ S+ 
Sbjct  1    MFGFSRRHKKLSRVKVQLSDTTQGTRSPIRYPKRNGNSNGDGVAGTSGHSEEIDCQFSST  60

Query  535  ASEFNNCTSGSSE  573
            A E +NC SGSSE
Sbjct  61   APEISNCVSGSSE  73



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFS-SSTGEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGRLKVQL+D+AQGT+SPI+  KR S ++ GE+ G +   S+E +CQ+S+
Sbjct  1    MFGFSRRRMKLGRLKVQLADSAQGTRSPIKQSKRTSNTNNGESGGRASGQSDELNCQYSS  60

Query  532  GASEFNNCTSGSSE  573
             A E NN T+G SE
Sbjct  61   DAPEANNTTTGKSE  74



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDVPATSNSDELDSQCLSA  60

Query  535  ASEFNNCTSGSSE  573
              E +N  +GSSE
Sbjct  61   VPEISNSATGSSE  73



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDAPASSNSDELDGQCLSA  60

Query  535  ASEFNNCTSGSSE  573
              E +N  +GSSE
Sbjct  61   VPEISNSATGSSE  73



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLS+  QGT++PIRHPKR  +S GE    S   S+E  C  ST 
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANQGTRTPIRHPKRNGNSNGEGDAGSSGHSDEVDCLPST-  59

Query  535  ASEFNNCTSGSSE  573
              E ++C SGSSE
Sbjct  60   --EISSCASGSSE  70



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q  + 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDVLASSNSDELDGQCLSA  60

Query  535  ASEFNNCTSGSSE  573
              E +N  +GSSE
Sbjct  61   VPEISNSATGSSE  73



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSR+  KLGR+K VQLSDT QGT+SP+RHPKR ++S  + V  S   SEE  CQ ++
Sbjct  1    MFGFSRKHKKLGRVKKVQLSDTTQGTRSPLRHPKRNANSNDDGVEGSSGHSEEIDCQFTS  60

Query  532  GASEFNNCTSGSSE  573
               E +NC SGSSE
Sbjct  61   TGPEISNCASGSSE  74



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSR+  KLGR+K VQLSDT QGT+SP+RHPKR ++S  + V  S   SEE  CQ ++
Sbjct  1    MFGFSRKHKKLGRVKKVQLSDTTQGTRSPLRHPKRNANSNDDGVEGSSGHSEEIDCQFTS  60

Query  532  GASEFNNCTSGSSE  573
               E +NC SGSSE
Sbjct  61   TGPEISNCASGSSE  74



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGRLKVQLSD+AQGT+SPIR PK   SS  E    + ++S+E   Q S+ 
Sbjct  1    MFGFSRRRLKLGRLKVQLSDSAQGTRSPIRQPKPNKSSNSECDAPASSNSDEPDHQCSSA  60

Query  535  ASEFNNCTSGSSE  573
            A E +N T GSSE
Sbjct  61   APEISNSTMGSSE  73



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 51/74 (69%), Gaps = 5/74 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH KR     G+ V  +   SEE  C  S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTQGTRSPIRHHKR----NGDRVAGTSGHSEEIDCPLSS  56

Query  532  GASEFNNCTSGSSE  573
             A E + CT+GSSE
Sbjct  57   AAPEMHTCTAGSSE  70



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 51/74 (69%), Gaps = 5/74 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH KR     G+ V  +   SEE  C  S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTQGTRSPIRHHKR----NGDRVAGTSGHSEEIDCPLSS  56

Query  532  GASEFNNCTSGSSE  573
             A E + CT+GSSE
Sbjct  57   AAPEMHTCTAGSSE  70



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SPIRH KR S S GE  V  S+N  S++ +C+  
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPIRHTKRASQSNGENVVSASVNGRSDDINCRCP  63

Query  529  TGASEFNNCTSGSSE  573
             GA + + C  GSSE
Sbjct  64   LGAFDLSKCGLGSSE  78



>gb|EPS67095.1| hypothetical protein M569_07681 [Genlisea aurea]
Length=238

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 3/73 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFS+RRMKLGRLKV LSD++QG +SP R  KRFS +  E    ++ ++++ + Q S+ 
Sbjct  1    MFGFSKRRMKLGRLKVHLSDSSQGLRSPHRPAKRFSHTNVEG---AVAENDDLNRQSSSA  57

Query  535  ASEFNNCTSGSSE  573
             SEF++CTSGSSE
Sbjct  58   VSEFSHCTSGSSE  70



>gb|KDO75106.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75107.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75108.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75109.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
Length=352

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N +++  C+ + 
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTI  60

Query  532  GASEFNNCTSGSSE  573
               E +N TSG+SE
Sbjct  61   AGPEVSNGTSGNSE  74



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N ++E  C+ + 
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADERDCECTI  60

Query  532  GASEFNNCTSGSSE  573
               E +N TSG+SE
Sbjct  61   AGPEVSNGTSGNSE  74



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSR+RMK+GRLKVQLSD+ QGT+SPIR PKR +SS  ++   + + S+E  CQ    
Sbjct  1    MFGFSRKRMKIGRLKVQLSDSTQGTRSPIRQPKRNNSSNNDSDAPASSLSDELDCQ-CPS  59

Query  535  ASEFNNCTSGSSE  573
            A E +N T GSSE
Sbjct  60   APEISNSTMGSSE  72



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N +++  C+ + 
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTI  60

Query  532  GASEFNNCTSGSSE  573
               E +N TSG+SE
Sbjct  61   AGPEVSNGTSGNSE  74



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLSD+ QGT+SPIR  KR   S GE    + + ++E +CQ S+ 
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSTQGTRSPIRPAKRVGHSNGENTAPTSSHTDELNCQCSS-  59

Query  535  ASEFNNCTSGSSE  573
             SE +N T G+SE
Sbjct  60   RSETDNRTPGNSE  72



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 5/73 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLS+   GT++P+R PKR  +  G+A G S   S+E  CQ ST 
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANPGTRTPVRPPKRNGTEIGDAAGGSSGHSDEVDCQPST-  59

Query  535  ASEFNNCTSGSSE  573
              E  +C  GSSE
Sbjct  60   --EITSC--GSSE  68



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 5/73 (7%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQLS+   GT++P+R PKR  +  G+A G S   S+E  CQ ST 
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANPGTRTPVRPPKRNGTEIGDAAGGSSGHSDEVDCQPST-  59

Query  535  ASEFNNCTSGSSE  573
              E  +C  GSSE
Sbjct  60   --EITSC--GSSE  68



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 50/76 (66%), Gaps = 9/76 (12%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGN---SINDSEESSCQH  525
            MFG SRRRMKLGRLKVQLS+   GT++PIRHPKR  +S GE  G+   S   S+E  CQ 
Sbjct  1    MFGISRRRMKLGRLKVQLSEANPGTRTPIRHPKRNGNSNGEGEGDAGGSSGHSDEVDCQP  60

Query  526  STGASEFNNCTSGSSE  573
            ST        TSGSSE
Sbjct  61   ST------EITSGSSE  70



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH ++     G+ V  +   SEE   Q  +
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTPQGTRSPIRHHQK---RNGDGVARTSGHSEEIDRQFLS  57

Query  532  GASEFNNCTSGSSE  573
              +E + CTSGSSE
Sbjct  58   ATAEMHTCTSGSSE  71



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  535  ASEFNNCTSGSSE  573
              E +NCTSG+SE
Sbjct  59   GPEIDNCTSGNSE  71



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  535  ASEFNNCTSGSSE  573
              E +NCTSG+SE
Sbjct  59   GPEIDNCTSGNSE  71



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  535  ASEFNNCTSGSSE  573
              E +NCTSG+SE
Sbjct  59   GPEIDNCTSGNSE  71



>ref|XP_010241732.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Nelumbo nucifera]
Length=576

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E   Q S  
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDELKRQCS--  58

Query  535  ASEFNNCTSGSSE  573
              E +NCTSG+SE
Sbjct  59   GPEIDNCTSGNSE  71



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 51/74 (69%), Gaps = 4/74 (5%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT  GT+SPIRH KR  +S G+ V  +   SE+     S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTLGTRSPIRHHKRNVNSNGDRVTGTSGHSEK---MLSS  57

Query  532  GASEFNNCTSGSSE  573
             A + + CTSGSSE
Sbjct  58   AAPDMHTCTSGSSE  71



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 51/74 (69%), Gaps = 4/74 (5%)
 Frame = +1

Query  355  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRR MKLG RLKVQLSDT  GT+SPIRH KR  +S G+ V  +   SE+     S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTLGTRSPIRHHKRNVNSNGDRVTGTSGHSEK---MLSS  57

Query  532  GASEFNNCTSGSSE  573
             A + + CTSGSSE
Sbjct  58   AAPDMHTCTSGSSE  71



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE-SSCQHST  531
            MFGF RRRMKLGRLKVQLSD AQGT+SPIR+PKR SSS  E    +   SEE    Q ++
Sbjct  1    MFGF-RRRMKLGRLKVQLSDPAQGTRSPIRNPKRGSSSNSECAAPASRHSEEHDEGQRAS  59

Query  532  GASEF-NNCTSGSSE  573
               +  NN  SG SE
Sbjct  60   DVPDISNNGASGQSE  74



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  531
            MF FS+RRMKLGR+KVQLSD+AQGTKSP+R  KR  +ST EA    + + S+E   Q S+
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSAQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPSS  60

Query  532  GASE  543
            G SE
Sbjct  61   GNSE  64



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE-SSCQHST  531
            MFGF RRRMKLGRLKVQLSD AQGT+SPIR+PKR S S  E    +   SEE    Q ++
Sbjct  1    MFGF-RRRMKLGRLKVQLSDPAQGTRSPIRNPKRGSGSNSECAAPASRHSEEHDEGQRAS  59

Query  532  GASEF-NNCTSGSSE  573
               +  NN  SG SE
Sbjct  60   DVPDISNNGASGQSE  74



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  531
            MF FS+RRMKLGR+KVQLSD++QGTKSP+R  KR  +ST EA    + + S+E   Q S+
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSSQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPSS  60

Query  532  GASE  543
            G SE
Sbjct  61   GNSE  64



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  531
            MF FS+RRMKLGR+KVQLSD++QGTKSP+R  KR  +ST EA    + + S+E   Q S+
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSSQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPSS  60

Query  532  GASE  543
            G SE
Sbjct  61   GNSE  64



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSINDSE-ESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE  V  S++    + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  529  TGASEFNNCTSGSSE  573
             G  + + C  GSSE
Sbjct  64   LGTFDLSKCGLGSSE  78



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSINDSE-ESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE  V  S++    + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  529  TGASEFNNCTSGSSE  573
             G  + + C  GSSE
Sbjct  64   LGTFDLSKCGLGSSE  78



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSINDSE-ESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE  V  S++    + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  529  TGASEFNNCTSGSSE  573
             G  + + C  GSSE
Sbjct  64   LGTFDLSKCGLGSSE  78



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSINDSE-ESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE  V  S++    + + Q S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENVVPASVSGRPGDINYQCS  63

Query  529  TGASEFNNCTSGSSE  573
             G  + + C  GSSE
Sbjct  64   LGTFDLSKCGLGSSE  78



>gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = +1

Query  355  MFGFSRRRMKLGRL-KVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFGFSRRRMKLGR+ KVQLSD+   T+SP+R  KR  +  GE    + +  +E  CQ S+
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSTLVTRSPVRTQKR--NPNGEGAAPTTSHFDELDCQCSS  58

Query  532  GASEFNNCTSGSSE  573
               E N+ TSGSSE
Sbjct  59   APPEINSSTSGSSE  72



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  534
            MFGFSRRRMKLGRLKVQL+++A GT  PIR PKR  +S  E  G     S E   Q S+ 
Sbjct  1    MFGFSRRRMKLGRLKVQLNESANGT--PIRQPKRTGNSNSECDGPVSRKSNEVDAQCSSA  58

Query  535  ASEFNNCTSGSSE  573
            A E  +   G+SE
Sbjct  59   APENGSSAMGNSE  71



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  529  TGASEFNNCTSGSSE  573
            +GA +  N   GSSE
Sbjct  64   SGAFDLGNRILGSSE  78



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  529  TGASEFNNCTSGSSE  573
            +GA +  N   GSSE
Sbjct  64   SGAFDLGNRILGSSE  78



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  529  TGASEFNNCTSGSSE  573
            +GA +  N   GSSE
Sbjct  64   SGAFDLGNRILGSSE  78



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  529  TGASEFNNCTSGSSE  573
            +GA +  N   GSSE
Sbjct  64   SGAFDLGNRILGSSE  78



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSST--GEAVGNSINDSEESSCQHS  528
            +FGFSRRR KLGRLKV L+D  QGT+SPIR  KR S S    E + +S   S++ +C  S
Sbjct  4    IFGFSRRRTKLGRLKVHLADPVQGTRSPIRPSKRHSQSNEENEVLPSSSGRSDDHNCHCS  63

Query  529  TGASEFNNCTSGSSE  573
            +   + + C+  SSE
Sbjct  64   SRTFDLHKCSVDSSE  78



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  528
            MFGFSRRRMKLGRLKV L D +QGT+SP R  KR + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPSRPTKRVNQSDGENVVSASVSGRSDDINCPCS  63

Query  529  TGASEFNNCTSGSSE  573
             GA + +  + GSS+
Sbjct  64   VGAFDPSKRSLGSSD  78



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 48/74 (65%), Gaps = 7/74 (9%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEA-VGNSINDSEESSCQHST  531
            MF FSRRR KLGR+KV LSD  QGTKSP+R  KR S+S  E+ V  +   SE SS     
Sbjct  3    MFSFSRRRTKLGRMKV-LSDPTQGTKSPLRPLKRASNSNVESFVATADRVSEPSS-----  56

Query  532  GASEFNNCTSGSSE  573
               + NNCTSGSSE
Sbjct  57   APQDINNCTSGSSE  70



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPSS  60

Query  532  GASE  543
            G SE
Sbjct  61   GNSE  64



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPSS  60

Query  532  GASE  543
            G SE
Sbjct  61   GNSE  64



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPSS  60

Query  532  GASE  543
            G SE
Sbjct  61   GNSE  64



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS RRMKLGR+K VQLSD+A  T+SPIR  KR ++   E V  + + S+E  CQ  +
Sbjct  1    MFSFSGRRMKLGRVKKVQLSDSALVTRSPIRPQKRTNNPNSEGVAPTTSHSDELDCQCPS  60

Query  532  GASEFN-NCTSGSSE  573
               E N + TSG+SE
Sbjct  61   APPETNSSTTSGNSE  75



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 11/78 (14%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGE----AVGNSINDSEESSC  519
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE    A G+S  D+ +S C
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGESAMPAGGHS--DAFDSHC  60

Query  520  QHSTGASEFNNCTSGSSE  573
              +  A E N  +SG+SE
Sbjct  61   PST--APEIN--SSGNSE  74



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 11/78 (14%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGE----AVGNSINDSEESSC  519
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE    A G+S  D+ +S C
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGESAMPAGGHS--DAFDSHC  60

Query  520  QHSTGASEFNNCTSGSSE  573
              +  A E N  +SG+SE
Sbjct  61   PST--APEIN--SSGNSE  74



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 11/78 (14%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGE----AVGNSINDSEESSC  519
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE    A G+S  D+ +S C
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGESAMPAGGHS--DAFDSHC  60

Query  520  QHSTGASEFNNCTSGSSE  573
              +  A E N  +SG+SE
Sbjct  61   PST--APEIN--SSGNSE  74



>ref|XP_009402528.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=553

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE--AVGNSINDSEESSCQHS  528
            +FGFSRRR K+GRLKV L D  QGT+SPIR   + S +  E   + +S   S++ +C  S
Sbjct  4    IFGFSRRRKKIGRLKVHLKDPLQGTRSPIRSSNQLSQTNEENGGLASSSGRSDDPNCHFS  63

Query  529  TGASEFNNCTSGSSE  573
            +   + +NC+  SS+
Sbjct  64   SHTCDLHNCSLESSK  78



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE--AVGNSINDSEESSCQHS  528
            +FGFSRRR K+GRLKV L D  QGT+SPIR   + S +  E   + +S   S++ +C  S
Sbjct  4    IFGFSRRRKKIGRLKVHLKDPLQGTRSPIRSSNQLSQTNEENGGLASSSGRSDDPNCHFS  63

Query  529  TGASEFNNCTSGSSE  573
            +   + +NC+  SS+
Sbjct  64   SHTCDLHNCSLESSK  78



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEESSCQ  522
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E V  + N+S+E    
Sbjct  1    MFGFSKRRTKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNANSEGVALTTNNSDELDYN  60

Query  523  HSTGAS-EFNNCTSGSSE  573
             S+ A  + +  TSG++E
Sbjct  61   CSSSAPLDISASTSGNAE  78



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  +S+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGFKSPLRATKRADNSSNEAALAATSYSDELDFQPSS  60

Query  532  GASE  543
            G  E
Sbjct  61   GNYE  64



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++S  E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNSNVESAMLAVNHSDELE-SHCP  59

Query  532  GASEFNNCTSGSSE  573
             A   N  +SG+SE
Sbjct  60   PAPVIN--SSGNSE  71



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 6/64 (9%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSS-----STGEAVGNSINDSEESS  516
            MFGFS+RRMKLGR+K VQLSD++ G +SPIR PKR  S     S G A+  S +D  +  
Sbjct  1    MFGFSKRRMKLGRVKKVQLSDSSPGIRSPIRPPKRIISNNNANSEGVALTASNSDDLDYH  60

Query  517  CQHS  528
            C  S
Sbjct  61   CSSS  64



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 7/79 (9%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSST-----GEAVGNSINDSEESS  516
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS      G A+  + +D  + +
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  517  CQHSTGASEFNNCTSGSSE  573
            C  S+   + +  TSG++E
Sbjct  61   CS-SSAPLDISASTSGNAE  78



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 7/79 (9%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSST-----GEAVGNSINDSEESS  516
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS      G A+  + +D  + +
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  517  CQHSTGASEFNNCTSGSSE  573
            C  S+   + +  TSG++E
Sbjct  61   CS-SSAPLDISASTSGNAE  78



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 7/79 (9%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSST-----GEAVGNSINDSEESS  516
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS      G A+  + +D  + +
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  517  CQHSTGASEFNNCTSGSSE  573
            C  S+   + +  TSG++E
Sbjct  61   CS-SSAPLDISASTSGNAE  78



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 7/79 (9%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSST-----GEAVGNSINDSEESS  516
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS      G A+  + +D  + +
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDELDYN  60

Query  517  CQHSTGASEFNNCTSGSSE  573
            C  S+   + +  TSG++E
Sbjct  61   CS-SSAPLDISASTSGNAE  78



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELE-SHCP  59

Query  532  GASEFNNCTSGSSE  573
             A   N  +SG+SE
Sbjct  60   PAPVIN--SSGNSE  71



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELE-SHCP  59

Query  532  GASEFNNCTSGSSE  573
             A   N  +SG+SE
Sbjct  60   PAPVIN--SSGNSE  71



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELE-SHCP  59

Query  532  GASEFNNCTSGSSE  573
             A   N  +SG+SE
Sbjct  60   PAPVIN--SSGNSE  71



>ref|XP_006287583.1| hypothetical protein CARUB_v10000793mg [Capsella rubella]
 gb|EOA20481.1| hypothetical protein CARUB_v10000793mg [Capsella rubella]
Length=498

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSSEAPVAATSYSDEHDFQPSS  60

Query  532  GASE  543
            G SE
Sbjct  61   GNSE  64



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E    H  
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDELE-SHCP  59

Query  532  GASEFNNCTSGSSE  573
             A   N  +SG+SE
Sbjct  60   PAPVIN--SSGNSE  71



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 12/65 (18%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  504
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  505  EESSC  519
            +E+ C
Sbjct  59   DENVC  63



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSS  465
            MFGFS+RRMKLGR+K VQLSD++ G +SPIR PKR  S
Sbjct  1    MFGFSKRRMKLGRVKKVQLSDSSPGIRSPIRPPKRIIS  38



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 12/65 (18%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  504
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  505  EESSC  519
            +E+ C
Sbjct  59   DENVC  63



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 12/65 (18%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  504
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  505  EESSC  519
            +E+ C
Sbjct  59   DENVC  63



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 12/65 (18%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  504
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  505  EESSC  519
            +E+ C
Sbjct  59   DENVC  63



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVDFQPSS  60

Query  532  GASE  543
              SE
Sbjct  61   RNSE  64



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVGFQPSS  60

Query  532  GASE  543
              +E
Sbjct  61   RTTE  64



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FS+RRM+LGR+K VQLS++ QG KSP+R  K   +S+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSESVQGYKSPLRVTKLADNSSNEAAVAATSYSDEFDFQPSS  60

Query  532  GASE  543
            G SE
Sbjct  61   GNSE  64



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE  477
            MFGFSRRRMKLGRLK  L D   G++SP R  KRFS   GE
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPSRQTKRFSHPNGE  44



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFG SRRRMK+GR+K VQLSD  QGT+SP+R  KR ++   E    + + S E+  Q  +
Sbjct  1    MFGISRRRMKIGRVKKVQLSDATQGTRSPMRQIKRGNNQNNEGAVPASDCSNENDSQSPS  60

Query  532  GASEF  546
             A E 
Sbjct  61   SAPEI  65



>gb|KCW61088.1| hypothetical protein EUGRSUZ_H03862 [Eucalyptus grandis]
Length=510

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MFG SRRRMK+GR+K VQLSD  QGT+SP+R  KR ++   E    + + S E+  Q  +
Sbjct  1    MFGISRRRMKIGRVKKVQLSDATQGTRSPMRQIKRGNNQNNEGAVPASDCSNENDSQSPS  60

Query  532  GASEF  546
             A E 
Sbjct  61   SAPEI  65



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  531
            MF FSRRR KLGR+K VQLSD+A G  SP+R  KR ++ST E        S+E   Q   
Sbjct  1    MFSFSRRRTKLGRVKKVQLSDSASGRASPLRQTKRVNNSTNEGAETEARHSDELDFQSPP  60

Query  532  GASE  543
            G +E
Sbjct  61   GNAE  64



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  510
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDE  53



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  510
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDE  53



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 4/71 (6%)
 Frame = +1

Query  364  FSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTGAS  540
            FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++S  E+   ++N S+E    H   A 
Sbjct  28   FSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNSNVESAMLAVNHSDELES-HCPPAP  86

Query  541  EFNNCTSGSSE  573
              N  +SG+SE
Sbjct  87   VIN--SSGNSE  95



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKV-QLSDTAQGTKSP--IRHPKRFSSST--GEAVGNSINDSEESSC  519
            MFGFSRRR K GR KV QLSD   GT+SP  +RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  520  QHS  528
             HS
Sbjct  58   GHS  60



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKV-QLSDTAQGTKSP--IRHPKRFSSST--GEAVGNSINDSEESSC  519
            MFGFSRRR K GR KV QLSD   GT+SP  +RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  520  QHS  528
             HS
Sbjct  58   GHS  60



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKV-QLSDTAQGTKSP--IRHPKRFSSST--GEAVGNSINDSEESSC  519
            MFGFSRRR K GR KV QLSD   GT+SP  +RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  520  QHS  528
             HS
Sbjct  58   GHS  60



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKV-QLSDTAQGTKSP--IRHPKRFSSST--GEAVGNSINDSEESSC  519
            MFGFSRRR K GR KV QLSD   GT+SP  +RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  520  QHS  528
             HS
Sbjct  58   GHS  60



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE  477
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARLTKRSSYPNGE  44



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE  477
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARLTKRSSYPNGE  44



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEA  480
            MF FSRRRMKL R+K VQLS++  GT+SPIR  KR +++  E+
Sbjct  3    MFSFSRRRMKLNRVKKVQLSESVHGTRSPIRPSKRNNNTIVES  45



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEA  480
            MF FSRRRMKL R+K VQLS++  GT+SPIR  KR +++  E+
Sbjct  3    MFSFSRRRMKLNRVKKVQLSESVHGTRSPIRPSKRNNNTIVES  45



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
Length=649

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  355  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFS  462
            MFGFSRRRMKLGRLK  L D    ++SP R  KRFS
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHASRSPSRTTKRFS  39



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750