BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006D18

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010246045.1|  PREDICTED: myb-related protein 330                 268   1e-86   Nelumbo nucifera [Indian lotus]
gb|AHB17741.1|  MYB1                                                    263   5e-85   Actinidia chinensis
gb|AAN28270.1|  myb-like transcription factor 1                         262   2e-84   Gossypium hirsutum [American cotton]
gb|KDP34830.1|  hypothetical protein JCGZ_11192                         262   2e-84   Jatropha curcas
gb|KJB81321.1|  hypothetical protein B456_013G139200                    262   2e-84   Gossypium raimondii
gb|AAA33067.1|  MYB1                                                    262   2e-84   Gossypium hirsutum [American cotton]
gb|AEI83425.1|  transcription factor R2R3-MYB1                          261   5e-84   Camellia sinensis [black tea]
ref|XP_008219033.1|  PREDICTED: transcription repressor MYB6-like       261   1e-83   Prunus mume [ume]
ref|XP_009772294.1|  PREDICTED: myb-related protein 330-like            259   1e-83   Nicotiana sylvestris
ref|XP_002534486.1|  r2r3-myb transcription factor, putative            260   2e-83   Ricinus communis
ref|XP_011096483.1|  PREDICTED: myb-related protein 330                 260   2e-83   Sesamum indicum [beniseed]
ref|XP_010680433.1|  PREDICTED: transcription repressor MYB6-like       261   2e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007222954.1|  hypothetical protein PRUPE_ppa008906mg             260   3e-83   Prunus persica
ref|XP_009623355.1|  PREDICTED: myb-related protein 330-like            259   3e-83   Nicotiana tomentosiformis
ref|XP_010104477.1|  Transcription factor                               259   3e-83   Morus notabilis
ref|XP_006356500.1|  PREDICTED: myb-related protein 330-like            258   4e-83   Solanum tuberosum [potatoes]
gb|AFH03053.1|  R2R3-MYB transcription factor MYB1                      259   5e-83   Epimedium sagittatum
gb|AAS19480.1|  MYB6                                                    258   5e-83   Tradescantia fluminensis [spiderwort]
ref|XP_004977234.1|  PREDICTED: myb-related protein Zm38-like           255   6e-83   Setaria italica
ref|XP_010912520.1|  PREDICTED: myb-related protein 308-like            256   9e-83   Elaeis guineensis
ref|XP_006434585.1|  hypothetical protein CICLE_v10002068mg             258   1e-82   Citrus clementina [clementine]
gb|EPS61539.1|  hypothetical protein M569_13258                         253   1e-82   Genlisea aurea
ref|XP_006826645.1|  hypothetical protein AMTR_s00139p00079430          256   1e-82   Amborella trichopoda
ref|XP_011001250.1|  PREDICTED: transcription repressor MYB6-like       258   1e-82   Populus euphratica
ref|XP_008781556.1|  PREDICTED: myb-related protein 308-like            254   2e-82   Phoenix dactylifera
ref|XP_006473170.1|  PREDICTED: myb-related protein 330-like            257   2e-82   Citrus sinensis [apfelsine]
ref|XP_002325733.1|  hypothetical protein POPTR_0019s00750g             258   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_004299892.1|  PREDICTED: transcription repressor MYB6            258   2e-82   Fragaria vesca subsp. vesca
ref|XP_010930777.1|  PREDICTED: myb-related protein 308-like            256   2e-82   Elaeis guineensis
ref|XP_002872444.1|  ATMYB6                                             255   2e-82   
gb|KJB60082.1|  hypothetical protein B456_009G288900                    256   3e-82   Gossypium raimondii
gb|EYU22810.1|  hypothetical protein MIMGU_mgv1a010870mg                257   3e-82   Erythranthe guttata [common monkey flower]
emb|CDP10649.1|  unnamed protein product                                257   3e-82   Coffea canephora [robusta coffee]
gb|ABR01221.1|  MYB8                                                    256   4e-82   Gossypium hirsutum [American cotton]
ref|XP_002325546.1|  myb family transcription factor family protein     256   4e-82   Populus trichocarpa [western balsam poplar]
ref|XP_009767902.1|  PREDICTED: myb-related protein 330-like            256   4e-82   Nicotiana sylvestris
ref|XP_004241841.1|  PREDICTED: myb-related protein 330                 256   4e-82   Solanum lycopersicum
ref|XP_010061981.1|  PREDICTED: transcription repressor MYB6            256   4e-82   Eucalyptus grandis [rose gum]
ref|XP_009362465.1|  PREDICTED: transcription repressor MYB6-like       257   5e-82   Pyrus x bretschneideri [bai li]
gb|KHG10399.1|  Myb-related protein                                     252   5e-82   Gossypium arboreum [tree cotton]
gb|AAS19475.1|  MYB1                                                    255   5e-82   Tradescantia fluminensis [spiderwort]
ref|XP_007020033.1|  Myb domain protein 3, putative                     256   5e-82   
ref|XP_008807672.1|  PREDICTED: myb-related protein 308-like            255   5e-82   Phoenix dactylifera
ref|XP_009600359.1|  PREDICTED: myb-related protein 330-like            256   6e-82   Nicotiana tomentosiformis
ref|XP_006359691.1|  PREDICTED: myb-related protein 308-like            254   7e-82   Solanum tuberosum [potatoes]
ref|XP_010435778.1|  PREDICTED: transcription repressor MYB6-like...    253   8e-82   Camelina sativa [gold-of-pleasure]
ref|XP_008378762.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    256   8e-82   
ref|XP_009804432.1|  PREDICTED: myb-related protein 308-like            254   8e-82   Nicotiana sylvestris
ref|XP_007131703.1|  hypothetical protein PHAVU_011G034900g             254   9e-82   Phaseolus vulgaris [French bean]
ref|XP_006288570.1|  hypothetical protein CARUB_v10001860mg             253   1e-81   Capsella rubella
ref|XP_010538928.1|  PREDICTED: transcription repressor MYB6-like       252   1e-81   Tarenaya hassleriana [spider flower]
gb|AID23891.1|  R2R3-MYB                                                254   1e-81   Rosa hybrid cultivar
gb|KHF99993.1|  Myb-related protein                                     251   1e-81   Gossypium arboreum [tree cotton]
ref|XP_004231034.1|  PREDICTED: myb-related protein 308-like            253   1e-81   Solanum lycopersicum
ref|XP_004977237.1|  PREDICTED: myb-related protein Zm38-like           252   2e-81   Setaria italica
emb|CDO96923.1|  unnamed protein product                                254   2e-81   Coffea canephora [robusta coffee]
ref|XP_008808618.1|  PREDICTED: myb-related protein Hv1                 252   2e-81   Phoenix dactylifera
gb|ABH02902.1|  MYB transcription factor MYB179                         252   2e-81   Glycine max [soybeans]
ref|XP_004289866.1|  PREDICTED: myb-related protein 308                 254   2e-81   Fragaria vesca subsp. vesca
ref|XP_011046699.1|  PREDICTED: myb-related protein 308-like            254   2e-81   Populus euphratica
gb|AEX08668.1|  MYB transcription factor 3                              255   2e-81   Malus domestica [apple tree]
ref|XP_003607200.1|  Myb-like transcription factor                      254   2e-81   Medicago truncatula
ref|XP_006397190.1|  hypothetical protein EUTSA_v10028861mg             254   2e-81   
gb|ACJ84718.1|  unknown                                                 254   2e-81   Medicago truncatula
ref|XP_006426418.1|  hypothetical protein CICLE_v10026112mg             255   3e-81   Citrus clementina [clementine]
sp|P81395.1|MYB30_ANTMA  RecName: Full=Myb-related protein 330          253   3e-81   Antirrhinum majus [garden snapdragon]
ref|XP_010028718.1|  PREDICTED: myb-related protein 308-like            253   3e-81   Eucalyptus grandis [rose gum]
ref|XP_010675151.1|  PREDICTED: transcription repressor MYB6-like       255   3e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006466200.1|  PREDICTED: myb-related protein 330-like            255   3e-81   Citrus sinensis [apfelsine]
ref|XP_009403695.1|  PREDICTED: myb-related protein 308-like            253   3e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU37946.1|  hypothetical protein MIMGU_mgv1a011787mg                253   3e-81   Erythranthe guttata [common monkey flower]
ref|XP_010530161.1|  PREDICTED: transcription repressor MYB6-like       253   3e-81   Tarenaya hassleriana [spider flower]
ref|XP_010543564.1|  PREDICTED: transcription repressor MYB6            253   3e-81   Tarenaya hassleriana [spider flower]
ref|XP_008783376.1|  PREDICTED: myb-related protein 308-like            253   3e-81   Phoenix dactylifera
ref|XP_004147038.1|  PREDICTED: myb-related protein 308-like            253   3e-81   Cucumis sativus [cucumbers]
ref|XP_004977235.1|  PREDICTED: myb-related protein Zm38-like           253   3e-81   Setaria italica
gb|ADY38393.2|  MYB1                                                    252   3e-81   Leucaena leucocephala [cassie]
gb|AAK19619.1|AF336286_1  GHMYB9                                        253   3e-81   Gossypium hirsutum [American cotton]
gb|KJB15797.1|  hypothetical protein B456_002G196700                    253   3e-81   Gossypium raimondii
gb|AGS48990.1|  R2R3 MYB transcription factor 39                        251   4e-81   Salvia miltiorrhiza [Chinese salvia]
gb|KHG11058.1|  Transcription factor MYB3 -like protein                 253   4e-81   Gossypium arboreum [tree cotton]
ref|XP_010455338.1|  PREDICTED: transcription repressor MYB6-like       253   4e-81   
ref|XP_002306180.1|  myb family transcription factor family protein     253   4e-81   Populus trichocarpa [western balsam poplar]
gb|AIS39993.1|  MYB2                                                    254   4e-81   Lithospermum erythrorhizon
ref|NP_001235092.1|  transcription factor MYBZ2                         252   5e-81   
ref|XP_006384572.1|  hypothetical protein POPTR_0004s18020g             253   5e-81   
gb|AEM17351.1|  R2R3-MYB transcriptional factor PvMYB4d                 252   5e-81   Panicum virgatum
ref|XP_008457683.1|  PREDICTED: myb-related protein 308-like            252   5e-81   Cucumis melo [Oriental melon]
gb|KFK32075.1|  hypothetical protein AALP_AA6G196300                    251   5e-81   Arabis alpina [alpine rockcress]
gb|AEM17348.1|  R2R3-MYB transcriptional factor PvMYB4a                 252   5e-81   Panicum virgatum
ref|XP_004505789.1|  PREDICTED: myb-related protein 308-like            253   5e-81   Cicer arietinum [garbanzo]
ref|XP_009631098.1|  PREDICTED: myb-related protein 308-like            252   5e-81   Nicotiana tomentosiformis
gb|AEM17352.1|  R2R3-MYB transcriptional factor PvMYB4e                 252   6e-81   Panicum virgatum
ref|XP_007137351.1|  hypothetical protein PHAVU_009G119900g             252   6e-81   Phaseolus vulgaris [French bean]
ref|XP_007137818.1|  hypothetical protein PHAVU_009G158200g             254   6e-81   Phaseolus vulgaris [French bean]
ref|XP_009406085.1|  PREDICTED: myb-related protein 308-like            252   6e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN39881.1|  Myb-related protein 308                                 252   6e-81   Glycine soja [wild soybean]
ref|XP_009376958.1|  PREDICTED: myb-related protein 308-like            252   6e-81   Pyrus x bretschneideri [bai li]
ref|XP_006384381.1|  hypothetical protein POPTR_0004s14510g             254   6e-81   Populus trichocarpa [western balsam poplar]
gb|AGN52100.1|  MYB-related transcription factor                        251   6e-81   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010421847.1|  PREDICTED: transcription repressor MYB6            251   6e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009379853.1|  PREDICTED: myb-related protein Zm38-like           251   6e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIE54279.1|  transcription factor                                    252   7e-81   Nicotiana tabacum [American tobacco]
gb|AID56314.1|  MYB2                                                    252   7e-81   Eriobotrya japonica [loquat]
ref|XP_010431803.1|  PREDICTED: transcription repressor MYB4-like       253   7e-81   Camelina sativa [gold-of-pleasure]
gb|AHG99473.1|  MYB16                                                   252   7e-81   Malus hybrid cultivar
gb|KHN09677.1|  Myb-related protein 308                                 253   7e-81   Glycine soja [wild soybean]
ref|XP_011088595.1|  PREDICTED: myb-related protein 308                 252   7e-81   Sesamum indicum [beniseed]
ref|XP_008377747.1|  PREDICTED: myb-related protein 308-like            252   7e-81   Malus domestica [apple tree]
gb|ACU19175.1|  unknown                                                 251   8e-81   Glycine max [soybeans]
ref|XP_010446371.1|  PREDICTED: transcription repressor MYB4-like       253   8e-81   Camelina sativa [gold-of-pleasure]
gb|AFI80908.1|  R2R3-type MYB transcription factor                      251   8e-81   Leucaena leucocephala [cassie]
ref|XP_009618136.1|  PREDICTED: myb-related protein 308-like            252   8e-81   Nicotiana tomentosiformis
ref|XP_008677677.1|  PREDICTED: uncharacterized protein LOC100384...    253   8e-81   
gb|KJB47666.1|  hypothetical protein B456_008G035700                    252   8e-81   Gossypium raimondii
ref|XP_008363293.1|  PREDICTED: myb-related protein 308-like            251   8e-81   
gb|AGN52052.1|  MYB-related transcription factor                        250   9e-81   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006284260.1|  hypothetical protein CARUB_v10005426mg             253   9e-81   Capsella rubella
ref|XP_010436959.1|  PREDICTED: transcription repressor MYB4 isof...    253   9e-81   
gb|KHN31220.1|  Myb-related protein 308                                 253   9e-81   Glycine soja [wild soybean]
ref|NP_001233975.1|  transcription factor                               252   1e-80   Solanum lycopersicum
gb|EPS68365.1|  hypothetical protein M569_06408                         247   1e-80   Genlisea aurea
gb|AIU39031.1|  myb transcription factor 2                              251   1e-80   Narcissus tazetta subsp. chinensis
gb|EEC67791.1|  hypothetical protein OsI_35350                          253   1e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_006663259.1|  PREDICTED: myb-related protein 330-like            251   1e-80   
ref|XP_009416922.1|  PREDICTED: myb-related protein 308-like            252   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011097098.1|  PREDICTED: myb-related protein 308-like            252   1e-80   Sesamum indicum [beniseed]
ref|XP_011004000.1|  PREDICTED: transcription repressor MYB6            253   1e-80   Populus euphratica
gb|AHB59595.1|  putative R2R3 MYB protein 7                             253   1e-80   Arachis hypogaea [goober]
emb|CCU64153.1|  ScMYB1 protein                                         251   1e-80   Saccharum hybrid cultivar Co 86032
gb|AAL84619.1|AF474122_1  typical P-type R2R3 Myb protein               249   1e-80   Zea mays [maize]
ref|XP_009418831.1|  PREDICTED: myb-related protein 308-like            251   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010265977.1|  PREDICTED: myb-related protein 308-like            251   1e-80   Nelumbo nucifera [Indian lotus]
gb|AEE81751.1|  MYB transcription factor                                251   1e-80   Morus alba var. multicaulis
dbj|BAF46265.1|  putative transcription factor                          251   1e-80   Humulus lupulus [common hop]
ref|NP_001044957.1|  Os01g0874300                                       252   1e-80   
gb|ABQ81931.1|  transcription factor MYB4                               252   1e-80   Brassica rapa var. purpuraria [purple stem mustard]
ref|NP_001268129.1|  flavonoid-related R2R3 MYB 4a repressor tran...    251   1e-80   Vitis vinifera
ref|XP_009101934.1|  PREDICTED: transcription repressor MYB4            252   1e-80   Brassica rapa
ref|XP_010941310.1|  PREDICTED: myb-related protein Hv1-like            250   1e-80   Elaeis guineensis
ref|XP_006411651.1|  hypothetical protein EUTSA_v10025886mg             252   1e-80   Eutrema salsugineum [saltwater cress]
ref|XP_008788440.1|  PREDICTED: myb-related protein Hv1-like            250   1e-80   Phoenix dactylifera
tpg|DAA38957.1|  TPA: putative MYB DNA-binding domain superfamily...    251   1e-80   
ref|XP_002866812.1|  hypothetical protein ARALYDRAFT_490626             252   2e-80   
emb|CCU64156.1|  ScMYB4 protein                                         247   2e-80   Saccharum hybrid cultivar Co 86032
emb|CBI27689.3|  unnamed protein product                                251   2e-80   Vitis vinifera
ref|XP_006645094.1|  PREDICTED: myb-related protein 330-like            251   2e-80   Oryza brachyantha
gb|KDP29641.1|  hypothetical protein JCGZ_18803                         251   2e-80   Jatropha curcas
gb|ADG46002.1|  MYB4                                                    250   2e-80   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011092988.1|  PREDICTED: myb-related protein 308-like            251   2e-80   Sesamum indicum [beniseed]
ref|XP_010920127.1|  PREDICTED: myb-related protein 308-like            250   2e-80   Elaeis guineensis
emb|CDX72743.1|  BnaC07g47650D                                          252   2e-80   
emb|CCC14990.1|  Myb transcription factor                               251   2e-80   Humulus lupulus [common hop]
ref|NP_001235623.1|  MYB transcription factor MYB54                     251   2e-80   Glycine max [soybeans]
ref|XP_006366980.1|  PREDICTED: myb-related protein 308-like            251   2e-80   Solanum tuberosum [potatoes]
sp|P81393.1|MYB08_ANTMA  RecName: Full=Myb-related protein 308          250   2e-80   Antirrhinum majus [garden snapdragon]
ref|XP_006660900.1|  PREDICTED: myb-related protein Hv1-like            250   2e-80   Oryza brachyantha
ref|XP_006376251.1|  hypothetical protein POPTR_0013s11360g             252   2e-80   
ref|XP_010910804.1|  PREDICTED: myb-related protein 308-like            251   2e-80   Elaeis guineensis
gb|KFK30463.1|  hypothetical protein AALP_AA7G264300                    252   2e-80   Arabis alpina [alpine rockcress]
gb|KEH35662.1|  myb transcription factor                                252   2e-80   Medicago truncatula
ref|NP_001063796.1|  Os09g0538400                                       250   2e-80   
gb|KHN25476.1|  Myb-related protein 308                                 250   2e-80   Glycine soja [wild soybean]
gb|ABR25756.1|  myb related protein hv1                                 250   2e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_007041863.1|  MYB domain class transcription factor              250   2e-80   Theobroma cacao [chocolate]
dbj|BAA23337.1|  OSMYB1                                                 250   2e-80   Oryza sativa [red rice]
ref|XP_011007997.1|  PREDICTED: myb-related protein 308-like            252   2e-80   Populus euphratica
ref|XP_002456719.1|  hypothetical protein SORBIDRAFT_03g041360          251   2e-80   Sorghum bicolor [broomcorn]
ref|XP_004144840.1|  PREDICTED: myb-related protein 308-like            250   2e-80   Cucumis sativus [cucumbers]
ref|XP_011001099.1|  PREDICTED: transcription repressor MYB6            252   2e-80   Populus euphratica
gb|EEE51755.1|  hypothetical protein OsJ_33189                          252   2e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002444621.1|  hypothetical protein SORBIDRAFT_07g024890          250   3e-80   Sorghum bicolor [broomcorn]
gb|ABP57083.1|  Myb transcription factor                                250   3e-80   Plectranthus scutellarioides
ref|XP_007200603.1|  hypothetical protein PRUPE_ppa010277mg             250   3e-80   Prunus persica
gb|AAS19476.1|  MYB2                                                    251   3e-80   Tradescantia fluminensis [spiderwort]
ref|XP_009387206.1|  PREDICTED: myb-related protein Zm38-like           248   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001106037.1|  transcription factor MYB8                          249   3e-80   Zea mays [maize]
ref|XP_008447966.1|  PREDICTED: myb-related protein 308-like            250   3e-80   Cucumis melo [Oriental melon]
ref|NP_001065896.2|  Os11g0180900                                       250   3e-80   
tpg|DAA38956.1|  TPA: putative MYB DNA-binding domain superfamily...    251   3e-80   
gb|EEE63808.1|  hypothetical protein OsJ_18632                          250   3e-80   Oryza sativa Japonica Group [Japonica rice]
gb|AHN16572.1|  MYB1                                                    250   3e-80   Malus hybrid cultivar
ref|XP_009764613.1|  PREDICTED: myb-related protein 308-like            250   3e-80   Nicotiana sylvestris
gb|ACU23165.1|  unknown                                                 252   3e-80   Glycine max [soybeans]
gb|KDP22699.1|  hypothetical protein JCGZ_02792                         252   3e-80   Jatropha curcas
ref|XP_002530824.1|  r2r3-myb transcription factor, putative            250   3e-80   Ricinus communis
ref|NP_001174439.1|  Os05g0429900                                       250   4e-80   
ref|XP_006856762.1|  hypothetical protein AMTR_s00055p00057500          249   4e-80   Amborella trichopoda
emb|CBI37882.3|  unnamed protein product                                248   4e-80   Vitis vinifera
gb|AEX92833.1|  MYB42                                                   250   4e-80   Saccharum hybrid cultivar Co 86032
ref|NP_192684.1|  transcription repressor MYB6                          249   4e-80   Arabidopsis thaliana [mouse-ear cress]
gb|KHN33675.1|  Myb-related protein 308                                 248   5e-80   Glycine soja [wild soybean]
gb|ADT91707.1|  MYB transcription factor                                250   5e-80   Gossypium hirsutum [American cotton]
ref|XP_009414444.1|  PREDICTED: myb-related protein Zm38-like           248   5e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADX33331.1|  R2R3-MYB transcription factor                           249   5e-80   Petunia x hybrida [garden petunia]
ref|XP_008799190.1|  PREDICTED: myb-related protein 308-like            249   6e-80   Phoenix dactylifera
gb|AJD79907.1|  MYB1                                                    250   6e-80   Punica granatum [granado]
ref|NP_195574.1|  transcription repressor MYB4                          250   6e-80   Arabidopsis thaliana [mouse-ear cress]
gb|AAC83582.1|  putative transcription factor                           250   6e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001242477.1|  uncharacterized protein LOC100808083               251   6e-80   
emb|CDX90285.1|  BnaA08g16990D                                          250   6e-80   
ref|XP_004957488.1|  PREDICTED: myb-related protein Hv1-like            249   7e-80   Setaria italica
ref|XP_009393912.1|  PREDICTED: myb-related protein Hv1-like            248   7e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001235637.1|  MYB transcription factor MYB48                     249   7e-80   Glycine max [soybeans]
ref|XP_008653573.1|  PREDICTED: myb-related protein Hv1 isoform X2      249   7e-80   
ref|XP_008800133.1|  PREDICTED: myb-related protein Hv1-like            249   7e-80   Phoenix dactylifera
ref|XP_008653572.1|  PREDICTED: myb-related protein Hv1 isoform X1      249   7e-80   
ref|XP_004141649.1|  PREDICTED: transcription repressor MYB6-like       251   7e-80   Cucumis sativus [cucumbers]
ref|XP_011046315.1|  PREDICTED: myb-related protein 308-like            249   8e-80   Populus euphratica
gb|AGT17220.1|  myb domain protein 4                                    249   8e-80   Saccharum hybrid cultivar R570
gb|ABQ51221.1|  R2R3-MYB transcription factor MYB5                      249   8e-80   Picea glauca
gb|ACF83817.1|  unknown                                                 249   8e-80   Zea mays [maize]
gb|KHG25834.1|  Myb-related protein                                     249   8e-80   Gossypium arboreum [tree cotton]
ref|XP_008236005.1|  PREDICTED: myb-related protein 308-like            249   8e-80   Prunus mume [ume]
gb|AEM17349.1|  R2R3-MYB transcriptional factor PvMYB4b                 249   9e-80   Panicum virgatum
gb|AEO27497.1|  MYB1                                                    250   9e-80   Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAM71804.1|  R2R3-MYB transcription factor                          249   9e-80   Gentiana triflora
ref|XP_009109540.1|  PREDICTED: transcription repressor MYB4            250   1e-79   Brassica rapa
gb|KJB59602.1|  hypothetical protein B456_009G263200                    249   1e-79   Gossypium raimondii
ref|XP_010266817.1|  PREDICTED: myb-related protein 308-like            248   1e-79   Nelumbo nucifera [Indian lotus]
gb|AGN52078.1|  MYB-related transcription factor                        249   1e-79   Salvia miltiorrhiza [Chinese salvia]
gb|AGO33166.1|  MYB transcription factor                                247   1e-79   Narcissus tazetta subsp. chinensis
ref|XP_009603939.1|  PREDICTED: myb-related protein 308-like            249   1e-79   Nicotiana tomentosiformis
ref|XP_004978868.1|  PREDICTED: transcription repressor MYB4-like       249   1e-79   Setaria italica
ref|XP_004147356.1|  PREDICTED: myb-related protein 330-like            247   1e-79   
ref|XP_002312966.1|  putative MYB transcription factor family pro...    249   1e-79   Populus trichocarpa [western balsam poplar]
ref|XP_002442905.1|  hypothetical protein SORBIDRAFT_08g004720          247   1e-79   Sorghum bicolor [broomcorn]
ref|XP_010933337.1|  PREDICTED: myb-related protein Hv1-like            248   1e-79   Elaeis guineensis
ref|XP_008653574.1|  PREDICTED: myb-related protein Hv1 isoform X3      247   1e-79   Zea mays [maize]
ref|XP_006659665.1|  PREDICTED: myb-related protein Zm38-like           248   1e-79   
ref|XP_009420186.1|  PREDICTED: myb-related protein 308-like            248   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEV91151.1|  R2R3-MYB protein                                        249   1e-79   Triticum aestivum [Canadian hard winter wheat]
gb|ADL18407.1|  P1 transcription factor                                 249   2e-79   Eremochloa ophiuroides
sp|P20025.1|MYB38_MAIZE  RecName: Full=Myb-related protein Zm38         248   2e-79   Zea mays [maize]
gb|ACT82838.1|  transcription factor MYB047                             247   2e-79   Glycine max [soybeans]
ref|NP_001105949.1|  transcription factor MYB31                         249   2e-79   
ref|XP_009404326.1|  PREDICTED: myb-related protein Zm38-like iso...    246   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS68045.1|  Transcription repressor MYB4                            249   2e-79   Triticum urartu
gb|AEM17350.1|  R2R3-MYB transcriptional factor PvMYB4c                 248   2e-79   Panicum virgatum
ref|XP_009134143.1|  PREDICTED: transcription repressor MYB6            247   2e-79   Brassica rapa
ref|XP_006664389.1|  PREDICTED: myb-related protein 330-like            248   2e-79   
ref|XP_004970740.1|  PREDICTED: myb-related protein 308-like            249   2e-79   Setaria italica
gb|AFZ78649.1|  MYB transcription factor                                249   2e-79   Populus tomentosa [Chinese white poplar]
gb|KFK40077.1|  hypothetical protein AALP_AA3G327100                    248   2e-79   Arabis alpina [alpine rockcress]
ref|XP_002462743.1|  hypothetical protein SORBIDRAFT_02g031190          248   2e-79   Sorghum bicolor [broomcorn]
gb|AIS35923.1|  MYB transcription factor 6                              248   2e-79   Phalaenopsis equestris
ref|XP_008664600.1|  PREDICTED: myb-related protein Zm38                248   2e-79   Zea mays [maize]
ref|XP_010090332.1|  Myb-related protein 308                            248   2e-79   Morus notabilis
emb|CDY12092.1|  BnaC03g60080D                                          250   2e-79   Brassica napus [oilseed rape]
ref|XP_006422616.1|  hypothetical protein CICLE_v10028908mg             250   2e-79   Citrus clementina [clementine]
gb|KHN19997.1|  Myb-related protein 308                                 247   2e-79   Glycine soja [wild soybean]
gb|EYU31566.1|  hypothetical protein MIMGU_mgv1a013684mg                246   2e-79   Erythranthe guttata [common monkey flower]
gb|EAZ07904.1|  hypothetical protein OsI_30160                          248   2e-79   Oryza sativa Indica Group [Indian rice]
gb|KDO68040.1|  hypothetical protein CISIN_1g021503mg                   250   2e-79   Citrus sinensis [apfelsine]
ref|XP_009390070.1|  PREDICTED: myb-related protein 308-like            247   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGN52027.1|  MYB-related transcription factor                        245   2e-79   Salvia miltiorrhiza [Chinese salvia]
gb|ADK12668.1|  emission of benzenoids III                              248   2e-79   Petunia x hybrida [garden petunia]
gb|ABR01222.1|  MYB10                                                   249   2e-79   Gossypium hirsutum [American cotton]
ref|NP_001062438.1|  Os08g0549000                                       247   3e-79   
ref|XP_009418701.1|  PREDICTED: myb-related protein Zm38-like           246   3e-79   
dbj|BAJ86668.1|  predicted protein                                      248   3e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006486752.1|  PREDICTED: myb-related protein 308-like            249   3e-79   Citrus sinensis [apfelsine]
ref|XP_003564745.1|  PREDICTED: myb-related protein 308-like            248   3e-79   Brachypodium distachyon [annual false brome]
gb|AAO49417.1|AF485899_1  MYB8                                          246   3e-79   Dendrobium sp. XMW-2002-8
ref|XP_003576234.1|  PREDICTED: myb-related protein 308                 248   3e-79   Brachypodium distachyon [annual false brome]
dbj|BAJ92735.1|  predicted protein                                      248   3e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010535219.1|  PREDICTED: transcription factor MYB3               248   3e-79   Tarenaya hassleriana [spider flower]
gb|ACB12238.1|  MYB-like protein MYB5d8                                 248   3e-79   Petunia x hybrida [garden petunia]
ref|XP_008657016.1|  PREDICTED: myb-related protein 308                 248   3e-79   Zea mays [maize]
gb|AAL84628.1|AF474138_1  typical P-type R2R3 Myb protein               247   3e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010935101.1|  PREDICTED: myb-related protein Hv1-like            247   4e-79   Elaeis guineensis
ref|XP_008460839.1|  PREDICTED: myb-related protein 330-like            246   4e-79   Cucumis melo [Oriental melon]
gb|AIS35922.1|  MYB transcription factor 5                              244   4e-79   Phalaenopsis equestris
ref|XP_010521146.1|  PREDICTED: transcription factor MYB3-like          247   4e-79   Tarenaya hassleriana [spider flower]
ref|XP_006383085.1|  hypothetical protein POPTR_0005s11410g             247   5e-79   
ref|XP_010526552.1|  PREDICTED: transcription repressor MYB4            248   5e-79   Tarenaya hassleriana [spider flower]
emb|CBI17347.3|  unnamed protein product                                247   5e-79   Vitis vinifera
ref|XP_004961985.1|  PREDICTED: myb-related protein Hv1-like            247   5e-79   Setaria italica
ref|NP_001146153.1|  uncharacterized protein LOC100279722               248   5e-79   Zea mays [maize]
ref|XP_008459665.1|  PREDICTED: transcription repressor MYB6-like       248   5e-79   
gb|AIS35925.1|  MYB transcription factor 8                              246   6e-79   
gb|AAO49419.1|AF485901_1  MYB10                                         246   6e-79   
dbj|BAM05596.1|  MYB transcription factor 1                             247   7e-79   
ref|XP_010690379.1|  PREDICTED: myb-related protein 308                 248   7e-79   
ref|XP_008808405.1|  PREDICTED: myb-related protein Hv1-like            246   7e-79   
gb|KHG01332.1|  Myb-related protein                                     246   8e-79   
ref|NP_001131856.1|  uncharacterized protein LOC100193234               247   9e-79   
ref|XP_010066271.1|  PREDICTED: myb-related protein 308-like            246   9e-79   
ref|NP_001267938.1|  R2R3 MYB 4b transcription factor                   246   9e-79   
dbj|BAJ99931.1|  predicted protein                                      246   9e-79   
emb|CAE09058.1|  MYB transcription factor                               246   9e-79   
emb|CAA50221.1|  MybHv5                                                 246   9e-79   
gb|ACG36029.1|  hypothetical protein                                    245   9e-79   
gb|KJB32654.1|  hypothetical protein B456_005G254000                    246   9e-79   
emb|CDY05057.1|  BnaC03g28550D                                          245   9e-79   
ref|NP_001236232.1|  uncharacterized protein LOC100306265               244   1e-78   
gb|AGE09589.1|  MYB83-like protein                                      246   1e-78   
dbj|BAJ34375.1|  unnamed protein product                                247   1e-78   
ref|XP_004974147.1|  PREDICTED: myb-related protein Zm38-like           246   1e-78   
ref|XP_006416177.1|  hypothetical protein EUTSA_v10008456mg             246   1e-78   
ref|XP_006298307.1|  hypothetical protein CARUB_v10014371mg             246   1e-78   
tpg|DAA56596.1|  TPA: putative MYB DNA-binding domain superfamily...    248   1e-78   
gb|AGO33164.1|  MYB transcription factor                                245   2e-78   
ref|NP_001176813.1|  Os12g0175400                                       246   2e-78   
ref|XP_010516381.1|  PREDICTED: transcription factor MYB32-like         246   2e-78   
ref|NP_179263.1|  myb domain protein 7                                  246   2e-78   
gb|AIS35924.1|  MYB transcription factor 7                              245   2e-78   
ref|XP_003578527.1|  PREDICTED: myb-related protein Hv1                 245   2e-78   
gb|AFW78196.1|  putative MYB DNA-binding domain superfamily protein     245   2e-78   
ref|XP_011043175.1|  PREDICTED: myb-related protein 308-like            245   3e-78   
gb|EPS69277.1|  hypothetical protein M569_05492                         243   3e-78   
dbj|BAJ33514.1|  R2R3-MYB transcriptional factor                        247   3e-78   
ref|XP_006409406.1|  hypothetical protein EUTSA_v10022799mg             246   3e-78   
ref|XP_010467401.1|  PREDICTED: transcription factor MYB32-like         245   3e-78   
gb|ABQ51226.1|  R2R3-MYB transcription factor MYB10                     243   4e-78   
gb|AIS39994.1|  MYB3                                                    245   4e-78   
ref|XP_010489241.1|  PREDICTED: transcription factor MYB32-like         245   5e-78   
emb|CDM85224.1|  unnamed protein product                                245   5e-78   
gb|AEV91143.1|  R2R3-MYB protein                                        244   7e-78   
ref|XP_002886068.1|  hypothetical protein ARALYDRAFT_899987             244   7e-78   
ref|XP_002890523.1|  hypothetical protein ARALYDRAFT_472503             244   7e-78   
ref|XP_010555232.1|  PREDICTED: transcription repressor MYB4-like       245   7e-78   
ref|XP_009393441.1|  PREDICTED: myb-related protein 308-like            243   9e-78   
ref|XP_011074956.1|  PREDICTED: myb-related protein 330-like            244   9e-78   
gb|AIS35921.1|  MYB transcription factor 4                              242   1e-77   
gb|ABN42495.1|  MYB protein                                             243   1e-77   
gb|AIU39727.1|  MYB transcription factor 32-1                           244   2e-77   
ref|XP_009115618.1|  PREDICTED: transcription factor MYB3               244   2e-77   
ref|XP_009138333.1|  PREDICTED: transcription factor MYB32-like         244   2e-77   
emb|CCU64174.1|  ScMYB22 protein                                        241   2e-77   
ref|XP_009414620.1|  PREDICTED: myb-related protein 308-like            242   2e-77   
emb|CDX91687.1|  BnaC08g06060D                                          242   2e-77   
gb|AEG64799.1|  R2R3 MYB transcriptional factor                         242   2e-77   
ref|NP_001106009.1|  transcription factor MYB42                         243   2e-77   
emb|CDY04798.1|  BnaC05g17910D                                          243   3e-77   
gb|AFW65671.1|  putative MYB DNA-binding domain superfamily protein     243   3e-77   
emb|CAD98762.1|  MYB transcription factor R2R3 type                     243   3e-77   
dbj|BAJ89618.1|  predicted protein                                      242   3e-77   
dbj|BAM71805.1|  R2R3-MYB transcription factor                          242   3e-77   
ref|NP_564176.2|  transcription factor MYB3                             243   3e-77   
emb|CDY25747.1|  BnaA07g10350D                                          243   3e-77   
gb|KFK30137.1|  hypothetical protein AALP_AA7G221700                    243   4e-77   
ref|XP_009103226.1|  PREDICTED: transcription factor MYB3-like          243   4e-77   
ref|XP_003568394.1|  PREDICTED: myb-related protein Zm38-like           241   4e-77   
gb|AIO09658.1|  MYB transcription factor                                244   4e-77   
ref|XP_002867097.1|  AtMYB32                                            243   5e-77   
emb|CDX72510.1|  BnaC07g45320D                                          243   5e-77   
ref|XP_010530893.1|  PREDICTED: transcription factor MYB32-like         243   5e-77   
gb|KFK44357.1|  hypothetical protein AALP_AA1G246900                    242   6e-77   
ref|XP_007046650.1|  MYB domain class transcription factor              241   6e-77   
gb|AEV91152.1|  R2R3-MYB protein                                        242   6e-77   
gb|AAT37167.1|  transcription factor Myb1                               242   6e-77   
gb|ABK25787.1|  unknown                                                 241   6e-77   
ref|XP_009136324.1|  PREDICTED: transcription factor MYB32              243   7e-77   
ref|XP_010460022.1|  PREDICTED: transcription factor MYB3-like          242   7e-77   
ref|XP_010027479.1|  PREDICTED: myb-related protein 308-like            244   7e-77   
gb|EMS61792.1|  Myb-related protein Hv1                                 242   7e-77   
ref|XP_006412165.1|  hypothetical protein EUTSA_v10025926mg             243   8e-77   
emb|CDY02243.1|  BnaA03g39240D                                          243   8e-77   
emb|CDY72116.1|  BnaCnng76050D                                          242   9e-77   
gb|ABD60287.2|  R2R3-MYB transcription factor MYB10                     238   1e-76   
gb|EMT18797.1|  Myb-related protein Hv1                                 241   1e-76   
ref|XP_010477522.1|  PREDICTED: transcription factor MYB3               242   1e-76   
ref|XP_010498742.1|  PREDICTED: transcription factor MYB3 isoform X1    241   1e-76   
emb|CDX69102.1|  BnaC01g03510D                                          242   2e-76   
gb|KJB43302.1|  hypothetical protein B456_007G192900                    239   2e-76   
gb|KHG07216.1|  Myb-related protein                                     239   2e-76   
emb|CDX75478.1|  BnaA01g02240D                                          241   2e-76   
emb|CDY12520.1|  BnaC07g13600D                                          241   2e-76   
ref|XP_009786709.1|  PREDICTED: myb-related protein 308-like            241   2e-76   
ref|XP_009107363.1|  PREDICTED: transcription factor MYB32-like         241   2e-76   
ref|XP_006305372.1|  hypothetical protein CARUB_v10009761mg             242   3e-76   
sp|P20026.1|MYB1_HORVU  RecName: Full=Myb-related protein Hv1           240   4e-76   
dbj|BAJ93190.1|  predicted protein                                      240   4e-76   
ref|NP_195225.1|  transcription factor MYB32                            240   5e-76   
gb|AAF13100.1|U26933_1  DNA-binding protein                             240   5e-76   
gb|ABQ51229.1|  R2R3-MYB transcription factor MYB13                     237   6e-76   
ref|XP_009382726.1|  PREDICTED: myb-related protein Zm38-like           237   8e-76   
ref|XP_006383086.1|  hypothetical protein POPTR_0005s11410g             239   8e-76   
ref|XP_006284274.1|  hypothetical protein CARUB_v10005438mg             239   1e-75   
ref|XP_009399305.1|  PREDICTED: myb-related protein 308-like            238   1e-75   
ref|XP_010437544.1|  PREDICTED: transcription factor MYB32-like         239   1e-75   
gb|AEC32978.1|  transcription factor MYB3                               237   1e-75   
ref|XP_010447013.1|  PREDICTED: transcription factor MYB32-like         239   1e-75   
gb|AEC32977.1|  transcription factor MYB3                               237   1e-75   
ref|XP_010432359.1|  PREDICTED: transcription factor MYB32-like         239   1e-75   
ref|XP_006303828.1|  hypothetical protein CARUB_v10012451mg             235   5e-75   
dbj|BAA23338.1|  OSMYB2                                                 237   6e-75   
ref|XP_002891188.1|  hypothetical protein ARALYDRAFT_473681             234   1e-74   
gb|AAX96198.1|  transposon protein, putative, CACTA, En/Spm sub-c...    256   1e-74   
ref|XP_004503863.1|  PREDICTED: myb-related protein 330-like isof...    237   1e-74   
ref|XP_009402646.1|  PREDICTED: myb-related protein 308-like            235   2e-74   
gb|ABK25585.1|  unknown                                                 233   2e-74   
ref|XP_010478947.1|  PREDICTED: transcription repressor MYB6-like       233   2e-74   
gb|AAL84616.1|AF474119_1  typical P-type R2R3 Myb protein               230   4e-74   
ref|XP_003630424.1|  Myb-like transcription factor                      236   4e-74   
ref|XP_008655313.1|  PREDICTED: putative MYB DNA-binding domain s...    233   5e-74   
ref|NP_849749.1|  R2R3-type MYB transcription factor                    233   6e-74   
gb|ABK24898.1|  unknown                                                 233   1e-73   
gb|AAN28271.1|  myb-like transcription factor 1                         233   2e-73   
ref|XP_009404325.1|  PREDICTED: myb-related protein Zm38-like iso...    232   2e-73   
ref|XP_003578854.1|  PREDICTED: myb-related protein 308-like            232   9e-73   
gb|EMT24564.1|  Myb-related protein 308                                 232   1e-72   
gb|AAN28273.1|  myb-like transcription factor 1                         229   7e-72   
ref|XP_009413581.1|  PREDICTED: myb-related protein Hv1-like            228   9e-72   
ref|XP_010274638.1|  PREDICTED: transcription repressor MYB6-like       228   1e-71   
gb|ABK25487.1|  unknown                                                 228   1e-71   
gb|EYU28562.1|  hypothetical protein MIMGU_mgv1a022685mg                224   8e-71   
gb|AAN28272.1|  myb-like transcription factor 1                         226   1e-70   
gb|ABD60279.1|  R2R3-MYB transcription factor MYB14                     224   2e-70   
ref|XP_009401133.1|  PREDICTED: myb-related protein 308-like            224   2e-70   
gb|ACN12959.1|  R2R3-MYB transcription factor MYB17                     224   2e-70   
emb|CBI18519.3|  unnamed protein product                                223   6e-70   
gb|KHG19549.1|  Transcription repressor MYB4 -like protein              223   6e-70   
ref|XP_002315890.2|  hypothetical protein POPTR_0010s12420g             223   7e-70   
gb|KJB30829.1|  hypothetical protein B456_005G162600                    222   7e-70   
ref|XP_011038671.1|  PREDICTED: transcription repressor MYB6-like       223   1e-69   
ref|XP_010044170.1|  PREDICTED: transcription repressor MYB4-like       222   2e-69   
ref|XP_010259378.1|  PREDICTED: transcription repressor MYB4-like       221   3e-69   
gb|ABD60284.2|  R2R3-MYB transcription factor MYB13                     219   4e-69   
gb|AAL90628.1|AF470060_1  P-type R2R3 Myb protein                       219   6e-69   
ref|XP_010032675.1|  PREDICTED: transcription factor MYB3-like          220   7e-69   
gb|AGI61042.1|  MaMYB3                                                  221   7e-69   
ref|XP_007045103.1|  R2R3 MYB C2 repressor motif-like1 protein          220   1e-68   
ref|XP_004297358.1|  PREDICTED: transcription repressor MYB6-like       221   1e-68   
gb|ABK23961.1|  unknown                                                 220   1e-68   
ref|XP_008229231.1|  PREDICTED: myb-related protein 308-like            220   1e-68   
ref|XP_007033078.1|  Myb domain protein 6                               219   2e-68   
ref|XP_008243345.1|  PREDICTED: transcription repressor MYB4-like       219   2e-68   
ref|XP_007223871.1|  hypothetical protein PRUPE_ppa010846mg             219   2e-68   
ref|XP_007215900.1|  hypothetical protein PRUPE_ppa010716mg             219   2e-68   
gb|AAN28286.1|  myb-like transcription factor 6                         219   2e-68   
gb|AAN28287.1|  myb-like transcription factor 6                         219   3e-68   
gb|KHG22126.1|  Transcription repressor MYB6 -like protein              219   3e-68   
ref|XP_010665255.1|  PREDICTED: myb-related protein 308-like            219   3e-68   
gb|AHG99475.1|  MYB111                                                  219   3e-68   
gb|AAC04720.1|  MYB-like DNA-binding domain protein                     218   3e-68   
ref|XP_002273328.1|  PREDICTED: transcription repressor MYB6            218   4e-68   
emb|CBI26917.3|  unnamed protein product                                218   4e-68   
gb|KJB43003.1|  hypothetical protein B456_007G179300                    219   5e-68   
ref|NP_001268133.1|  R2R3 Myb transcription factor C2 repressor m...    218   5e-68   
gb|AAF18515.1|AC006551_1  Putative DNA binding protein                  219   5e-68   
ref|XP_009371802.1|  PREDICTED: transcription repressor MYB6-like       218   5e-68   
ref|NP_001235662.1|  MYB transcription factor MYB56                     220   5e-68   
ref|XP_010066635.1|  PREDICTED: myb-related protein 308-like            218   6e-68   
gb|KDP38039.1|  hypothetical protein JCGZ_04682                         218   6e-68   
ref|XP_009357784.1|  PREDICTED: myb-related protein 308-like            218   7e-68   
ref|XP_008797850.1|  PREDICTED: myb-related protein 308-like            218   7e-68   
ref|XP_010916352.1|  PREDICTED: myb-related protein 308-like            218   8e-68   
emb|CAN80942.1|  hypothetical protein VITISV_012175                     218   9e-68   
ref|XP_008352913.1|  PREDICTED: myb-related protein 308-like            218   1e-67   
ref|NP_001281006.1|  myb-related protein 308-like                       217   1e-67   
ref|XP_006845300.1|  hypothetical protein AMTR_s00005p00268890          218   2e-67   
ref|XP_007036734.1|  R2R3 MYB C2 repressor 2 protein                    217   2e-67   
ref|XP_009393580.1|  PREDICTED: myb-related protein 308-like isof...    216   2e-67   
gb|ACM62749.1|  MYB1                                                    217   2e-67   
gb|KHN20933.1|  Transcription repressor MYB4-like protein               215   2e-67   
gb|AFH03064.1|  R2R3-MYB transcription factor MYB12                     217   3e-67   
gb|AAL84621.1|AF474124_1  typical P-type R2R3 Myb protein               213   5e-67   
ref|XP_010663664.1|  PREDICTED: transcription repressor MYB6 isof...    213   5e-67   
ref|XP_006448287.1|  hypothetical protein CICLE_v10017654mg             214   7e-67   
ref|XP_002281502.1|  PREDICTED: transcription repressor MYB6 isof...    213   9e-67   
ref|XP_002978781.1|  hypothetical protein SELMODRAFT_450007             211   1e-66   
ref|XP_002984694.1|  hypothetical protein SELMODRAFT_120788             211   1e-66   
gb|ABW34393.1|  R2R3 MYB transcription factor C2 motif flavonoid ...    214   2e-66   
ref|XP_008806257.1|  PREDICTED: myb-related protein 308-like            214   2e-66   
ref|XP_009398917.1|  PREDICTED: myb-related protein Zm38-like           211   6e-66   
dbj|BAI49718.1|  putative MYB transcription factor                      210   1e-65   
gb|AEI83426.1|  transcription factor R2R3-MYB2                          212   1e-65   
ref|XP_002305872.1|  hypothetical protein POPTR_0004s08650g             212   2e-65   
gb|AJI76863.1|  R2R3 MYB flavonoid repressor protein                    212   2e-65   
gb|KDP22654.1|  hypothetical protein JCGZ_02496                         211   2e-65   
ref|XP_003528525.1|  PREDICTED: myb-related protein 308-like            211   2e-65   
ref|NP_001238116.1|  uncharacterized protein LOC100306391               211   2e-65   
ref|XP_006372586.1|  putative MYB transcription factor family pro...    211   3e-65   
ref|XP_011007260.1|  PREDICTED: transcription repressor MYB6-like       211   3e-65   
ref|XP_011001591.1|  PREDICTED: transcription repressor MYB6-like       211   3e-65   
ref|XP_008240175.1|  PREDICTED: myb-related protein 308-like            209   6e-65   
ref|XP_004299543.1|  PREDICTED: myb-related protein 308-like            209   6e-65   
ref|XP_010926054.1|  PREDICTED: transcription repressor MYB4-like       210   8e-65   
emb|CBI15545.3|  unnamed protein product                                209   8e-65   
ref|XP_007209645.1|  hypothetical protein PRUPE_ppa011954mg             208   1e-64   
emb|CAN84079.1|  hypothetical protein VITISV_005933                     209   1e-64   
ref|NP_001268180.2|  uncharacterized protein LOC100257749               209   1e-64   
ref|XP_007159923.1|  hypothetical protein PHAVU_002G279000g             211   1e-64   
gb|AAL78373.1|  putative myb protein                                    207   2e-64   
ref|XP_004239398.1|  PREDICTED: transcription factor MYB3-like          207   3e-64   
ref|XP_002972896.1|  hypothetical protein SELMODRAFT_98669              205   3e-64   
ref|XP_009380308.1|  PREDICTED: myb-related protein 308-like            207   5e-64   
ref|XP_007157714.1|  hypothetical protein PHAVU_002G092100g             207   6e-64   
gb|AAN28289.1|  myb-like transcription factor 6                         207   8e-64   
ref|XP_003556646.1|  PREDICTED: transcription factor MYB3-like          207   8e-64   
ref|XP_010032684.1|  PREDICTED: myb-related protein 308-like            206   9e-64   
gb|KJB15483.1|  hypothetical protein B456_002G180300                    207   1e-63   
ref|XP_010093406.1|  Transcription factor                               207   1e-63   
emb|CBI18520.3|  unnamed protein product                                205   1e-63   
gb|KHG05049.1|  Myb-related protein                                     205   1e-63   
ref|XP_006344224.1|  PREDICTED: transcription factor MYB3-like          205   2e-63   
emb|CDY52797.1|  BnaCnng23360D                                          207   2e-63   
gb|ADM74805.1|  myb-like protein                                        206   2e-63   



>ref|XP_010246045.1| PREDICTED: myb-related protein 330 [Nelumbo nucifera]
Length=291

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/128 (97%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>gb|AHB17741.1| MYB1 [Actinidia chinensis]
Length=260

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/128 (96%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  VDPQTHRP  128



>gb|AAN28270.1| myb-like transcription factor 1 [Gossypium hirsutum]
Length=294

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|KDP34830.1| hypothetical protein JCGZ_11192 [Jatropha curcas]
 gb|AIT52254.1| MYB family protein [Jatropha curcas]
Length=294

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|KJB81321.1| hypothetical protein B456_013G139200 [Gossypium raimondii]
Length=294

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|AAA33067.1| MYB1 [Gossypium hirsutum]
 gb|AAN28269.1| myb-like transcription factor 1 [Gossypium hirsutum]
Length=294

 Score =   262 bits (670),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|AEI83425.1| transcription factor R2R3-MYB1 [Camellia sinensis]
Length=292

 Score =   261 bits (667),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHS+LGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+ RG
Sbjct  61   LRPDLKRGNFTEQEDELIIKLHSMLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLIVRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_008219033.1| PREDICTED: transcription repressor MYB6-like [Prunus mume]
Length=314

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_009772294.1| PREDICTED: myb-related protein 330-like [Nicotiana sylvestris]
Length=270

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL+NYIRSHGEGCWRSLPKAAGL  CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVNYIRSHGEGCWRSLPKAAGLQRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDDLIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            LDP THRP
Sbjct  121  LDPHTHRP  128



>ref|XP_002534486.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF27899.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=301

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_011096483.1| PREDICTED: myb-related protein 330 [Sesamum indicum]
Length=298

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_010680433.1| PREDICTED: transcription repressor MYB6-like [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTK+EDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKDEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_007222954.1| hypothetical protein PRUPE_ppa008906mg [Prunus persica]
 gb|EMJ24153.1| hypothetical protein PRUPE_ppa008906mg [Prunus persica]
Length=315

 Score =   260 bits (664),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_009623355.1| PREDICTED: myb-related protein 330-like [Nicotiana tomentosiformis]
Length=275

 Score =   259 bits (661),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL+NYIRSHGEGCWRSLPK AGL  CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVNYIRSHGEGCWRSLPKPAGLQRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_010104477.1| Transcription factor [Morus notabilis]
 gb|EXC01078.1| Transcription factor [Morus notabilis]
Length=305

 Score =   259 bits (663),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_006356500.1| PREDICTED: myb-related protein 330-like [Solanum tuberosum]
Length=285

 Score =   258 bits (660),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR+HGEGCWRSLPKAAGL  CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLSRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|AFH03053.1| R2R3-MYB transcription factor MYB1 [Epimedium sagittatum]
Length=295

 Score =   259 bits (661),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRTHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>gb|AAS19480.1| MYB6 [Tradescantia fluminensis]
Length=268

 Score =   258 bits (658),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHALLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_004977234.1| PREDICTED: myb-related protein Zm38-like [Setaria italica]
Length=197

 Score =   255 bits (651),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDDLIIKLH +LGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHQILGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTH+P
Sbjct  121  IDPQTHQP  128



>ref|XP_010912520.1| PREDICTED: myb-related protein 308-like [Elaeis guineensis]
Length=254

 Score =   256 bits (655),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI+SHGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS+G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHALLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSQG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_006434585.1| hypothetical protein CICLE_v10002068mg [Citrus clementina]
 gb|ESR47825.1| hypothetical protein CICLE_v10002068mg [Citrus clementina]
 gb|KDO83870.1| hypothetical protein CISIN_1g023056mg [Citrus sinensis]
Length=288

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>gb|EPS61539.1| hypothetical protein M569_13258, partial [Genlisea aurea]
Length=165

 Score =   253 bits (647),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINY+++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYVKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+E+ED++IIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTH+KRKL+SRG
Sbjct  61   LRPDLKRGNFSEDEDEIIIKLHSLLGNKWSMIAGRLPGRTDNEIKNYWNTHLKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_006826645.1| hypothetical protein AMTR_s00139p00079430 [Amborella trichopoda]
 gb|ERM93882.1| hypothetical protein AMTR_s00139p00079430 [Amborella trichopoda]
Length=259

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  VDPHTHRP  128



>ref|XP_011001250.1| PREDICTED: transcription repressor MYB6-like [Populus euphratica]
 ref|XP_011015999.1| PREDICTED: transcription repressor MYB6-like [Populus euphratica]
Length=318

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RLINYI+SHGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF++EED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFSDEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLFSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_008781556.1| PREDICTED: myb-related protein 308-like [Phoenix dactylifera]
Length=217

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_006473170.1| PREDICTED: myb-related protein 330-like [Citrus sinensis]
Length=288

 Score =   257 bits (657),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 126/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_002325733.1| hypothetical protein POPTR_0019s00750g [Populus trichocarpa]
 gb|EEF00115.1| hypothetical protein POPTR_0019s00750g [Populus trichocarpa]
Length=318

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RLINYI+SHGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF++EED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFSDEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLFSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  VDPQTHRP  128



>ref|XP_004299892.1| PREDICTED: transcription repressor MYB6 [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPK AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLTRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_010930777.1| PREDICTED: myb-related protein 308-like [Elaeis guineensis]
Length=253

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_002872444.1| ATMYB6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48703.1| ATMYB6 [Arabidopsis lyrata subsp. lyrata]
Length=236

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL++YIR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED +IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS G
Sbjct  61   LRPDLKRGNFTDEEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|KJB60082.1| hypothetical protein B456_009G288900 [Gossypium raimondii]
Length=284

 Score =   256 bits (655),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+E ED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFSEAEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTH P
Sbjct  121  IDPQTHGP  128



>gb|EYU22810.1| hypothetical protein MIMGU_mgv1a010870mg [Erythranthe guttata]
Length=299

 Score =   257 bits (656),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EEDD+IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTDEEDDIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPHTHR  127



>emb|CDP10649.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED++IIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHNLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|ABR01221.1| MYB8 [Gossypium hirsutum]
Length=284

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+E ED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFSEAEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTH P
Sbjct  121  IDPQTHGP  128



>ref|XP_002325546.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE99927.1| myb family transcription factor family protein [Populus trichocarpa]
Length=298

 Score =   256 bits (655),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED++IIKLHSLLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHSLLGNKWSLIAGKLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_009767902.1| PREDICTED: myb-related protein 330-like [Nicotiana sylvestris]
Length=291

 Score =   256 bits (654),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLP AAGL  CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPTAAGLQRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQ+HRP
Sbjct  121  IDPQSHRP  128



>ref|XP_004241841.1| PREDICTED: myb-related protein 330 [Solanum lycopersicum]
Length=279

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR+HGEGCWRSLPKAAGL  CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLSRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_010061981.1| PREDICTED: transcription repressor MYB6 [Eucalyptus grandis]
 gb|KCW69028.1| hypothetical protein EUGRSUZ_F02583 [Eucalyptus grandis]
Length=301

 Score =   256 bits (655),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_009362465.1| PREDICTED: transcription repressor MYB6-like [Pyrus x bretschneideri]
Length=310

 Score =   257 bits (656),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGR+PCCEKAHTNKGAWTKEEDQRLI++IR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRAPCCEKAHTNKGAWTKEEDQRLIDHIRQHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTQEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>gb|KHG10399.1| Myb-related protein [Gossypium arboreum]
Length=172

 Score =   252 bits (643),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|AAS19475.1| MYB1 [Tradescantia fluminensis]
Length=270

 Score =   255 bits (652),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI+ HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKVHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED++IIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDEVIIKLHALLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_007020033.1| Myb domain protein 3, putative [Theobroma cacao]
 gb|EOY17258.1| Myb domain protein 3, putative [Theobroma cacao]
Length=306

 Score =   256 bits (655),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHR  512
            +DPQTHR
Sbjct  121  IDPQTHR  127



>ref|XP_008807672.1| PREDICTED: myb-related protein 308-like [Phoenix dactylifera]
Length=256

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH+LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS+G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHALLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSQG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_009600359.1| PREDICTED: myb-related protein 330-like [Nicotiana tomentosiformis]
Length=288

 Score =   256 bits (653),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLP AAGL  CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPTAAGLQRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQ+HRP
Sbjct  121  IDPQSHRP  128



>ref|XP_006359691.1| PREDICTED: myb-related protein 308-like [Solanum tuberosum]
Length=254

 Score =   254 bits (649),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_010435778.1| PREDICTED: transcription repressor MYB6-like isoform X1 [Camelina 
sativa]
 ref|XP_010435785.1| PREDICTED: transcription repressor MYB6-like isoform X2 [Camelina 
sativa]
Length=236

 Score =   253 bits (647),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT++ED +IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS G
Sbjct  61   LRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_008378762.1| PREDICTED: LOW QUALITY PROTEIN: transcription repressor MYB6-like 
[Malus domestica]
Length=308

 Score =   256 bits (654),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGR+PCCEKAHTNKGAW+KEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRAPCCEKAHTNKGAWSKEEDQRLIDYIRQHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTH+KR L+SRG
Sbjct  61   LRPDLKRGNFTQEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHVKRNLISRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_009804432.1| PREDICTED: myb-related protein 308-like [Nicotiana sylvestris]
Length=258

 Score =   254 bits (649),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIRNHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_007131703.1| hypothetical protein PHAVU_011G034900g [Phaseolus vulgaris]
 gb|ESW03697.1| hypothetical protein PHAVU_011G034900g [Phaseolus vulgaris]
Length=253

 Score =   254 bits (649),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_006288570.1| hypothetical protein CARUB_v10001860mg [Capsella rubella]
 gb|EOA21468.1| hypothetical protein CARUB_v10001860mg [Capsella rubella]
Length=236

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT++ED +IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS G
Sbjct  61   LRPDLKRGNFTDDEDQVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_010538928.1| PREDICTED: transcription repressor MYB6-like [Tarenaya hassleriana]
Length=203

 Score =   252 bits (643),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQ LI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQHLIDYIRKHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEE +LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEVELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DPQ+HRP
Sbjct  121  IDPQSHRP  128



>gb|AID23891.1| R2R3-MYB [Rosa hybrid cultivar]
Length=258

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|KHF99993.1| Myb-related protein [Gossypium arboreum]
Length=181

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_004231034.1| PREDICTED: myb-related protein 308-like [Solanum lycopersicum]
Length=252

 Score =   253 bits (647),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI+YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIKTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_004977237.1| PREDICTED: myb-related protein Zm38-like [Setaria italica]
Length=220

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDDLIIKLH +LGNKWS IA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHQILGNKWSQIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DP+THRP
Sbjct  121  IDPKTHRP  128



>emb|CDO96923.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_008808618.1| PREDICTED: myb-related protein Hv1 [Phoenix dactylifera]
Length=229

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/128 (95%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI +IR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            LDP THRP
Sbjct  121  LDPTTHRP  128



>gb|ABH02902.1| MYB transcription factor MYB179 [Glycine max]
Length=217

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_004289866.1| PREDICTED: myb-related protein 308 [Fragaria vesca subsp. vesca]
Length=266

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_011046699.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=268

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|AEX08668.1| MYB transcription factor 3 [Malus domestica]
Length=310

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGR+PCCEK+HTNKGAWTKEEDQRLI++IR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRAPCCEKSHTNKGAWTKEEDQRLIDHIRQHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTQEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_003607200.1| Myb-like transcription factor [Medicago truncatula]
 gb|AES89397.1| myb transcription factor [Medicago truncatula]
Length=285

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_006397190.1| hypothetical protein EUTSA_v10028861mg [Eutrema salsugineum]
 gb|ESQ38643.1| hypothetical protein EUTSA_v10028861mg [Eutrema salsugineum]
Length=286

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL++YIR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  41   MGRSPCCEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  100

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF++EED +IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS G
Sbjct  101  LRPDLKRGNFSDEEDQVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  160

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  161  IDPQTHRP  168



>gb|ACJ84718.1| unknown [Medicago truncatula]
 gb|AFK49402.1| unknown [Medicago truncatula]
Length=285

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_006426418.1| hypothetical protein CICLE_v10026112mg [Citrus clementina]
 gb|ESR39658.1| hypothetical protein CICLE_v10026112mg [Citrus clementina]
 gb|KDO58731.1| hypothetical protein CISIN_1g021220mg [Citrus sinensis]
Length=316

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RLINYI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LII  HSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTEEEDELIINFHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>sp|P81395.1|MYB30_ANTMA RecName: Full=Myb-related protein 330 [Antirrhinum majus]
Length=274

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLINYIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED++IIKLHSLLGNKWSLIA  LPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHSLLGNKWSLIAGALPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  492  LDPQTHR  512
            +DPQTHR
Sbjct  121  IDPQTHR  127



>ref|XP_010028718.1| PREDICTED: myb-related protein 308-like [Eucalyptus grandis]
 gb|KCW55514.1| hypothetical protein EUGRSUZ_I01406 [Eucalyptus grandis]
Length=256

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_010675151.1| PREDICTED: transcription repressor MYB6-like [Beta vulgaris subsp. 
vulgaris]
Length=322

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED RL+NYI+SHGEGCWRSLPKAAGL  CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDDRLVNYIKSHGEGCWRSLPKAAGLQRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LII LHSLLGNKWSLIAA+LPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAAKLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHR  512
            +DPQTHR
Sbjct  121  IDPQTHR  127



>ref|XP_006466200.1| PREDICTED: myb-related protein 330-like [Citrus sinensis]
Length=315

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RLINYI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LII  HSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTEEEDELIINFHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_009403695.1| PREDICTED: myb-related protein 308-like [Musa acuminata subsp. 
malaccensis]
Length=247

 Score =   253 bits (645),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQ+LI+YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQKLISYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DPQTH P
Sbjct  121  IDPQTHGP  128



>gb|EYU37946.1| hypothetical protein MIMGU_mgv1a011787mg [Erythranthe guttata]
Length=271

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_010530161.1| PREDICTED: transcription repressor MYB6-like [Tarenaya hassleriana]
Length=247

 Score =   253 bits (645),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL +YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDLRLTDYIRKHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_010543564.1| PREDICTED: transcription repressor MYB6 [Tarenaya hassleriana]
Length=277

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRKHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  492  LDPQTHRP  515
            +DPQTH P
Sbjct  121  IDPQTHHP  128



>ref|XP_008783376.1| PREDICTED: myb-related protein 308-like [Phoenix dactylifera]
Length=262

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWR+LPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRTLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED++IIKLH +LGNKWS+IA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDEVIIKLHGMLGNKWSIIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_004147038.1| PREDICTED: myb-related protein 308-like [Cucumis sativus]
 ref|XP_004172908.1| PREDICTED: LOW QUALITY PROTEIN: myb-related protein 308-like 
[Cucumis sativus]
Length=256

 Score =   253 bits (645),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_004977235.1| PREDICTED: myb-related protein Zm38-like [Setaria italica]
Length=250

 Score =   253 bits (645),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDDLIIKLH +LGNKWS IA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHQILGNKWSQIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DP+THRP
Sbjct  121  IDPKTHRP  128



>gb|ADY38393.2| MYB1 [Leucaena leucocephala]
Length=235

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNE+KNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEMKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|AAK19619.1|AF336286_1 GHMYB9 [Gossypium hirsutum]
 gb|ACI23564.1| MYB-like protein 3 [Gossypium barbadense]
Length=264

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|KJB15797.1| hypothetical protein B456_002G196700 [Gossypium raimondii]
Length=265

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|AGS48990.1| R2R3 MYB transcription factor 39 [Salvia miltiorrhiza]
 gb|AGS55356.1| R2R3 MYB transcription factor 39 [Salvia miltiorrhiza]
Length=230

 Score =   251 bits (642),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|KHG11058.1| Transcription factor MYB3 -like protein [Gossypium arboreum]
Length=279

 Score =   253 bits (647),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+E ED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFSEAEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQ H P
Sbjct  121  IDPQNHGP  128



>ref|XP_010455338.1| PREDICTED: transcription repressor MYB6-like [Camelina sativa]
Length=274

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  40   MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  99

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT++ED +IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS G
Sbjct  100  LRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  159

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  160  IDPQTHRP  167



>ref|XP_002306180.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE86691.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|ACN97176.1| MYB transcription factor [Populus trichocarpa]
Length=268

 Score =   253 bits (645),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|AIS39993.1| MYB2 [Lithospermum erythrorhizon]
Length=318

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK+HTNKGAWTKEED+RLINYIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKSHTNKGAWTKEEDERLINYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDD+IIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDDIIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHR  512
            +DPQTHR
Sbjct  121  IDPQTHR  127



>ref|NP_001235092.1| transcription factor MYBZ2 [Glycine max]
 gb|ABI73970.1| transcription factor MYBZ2 [Glycine max]
Length=247

 Score =   252 bits (643),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_006384572.1| hypothetical protein POPTR_0004s18020g [Populus trichocarpa]
 gb|ERP62369.1| hypothetical protein POPTR_0004s18020g [Populus trichocarpa]
Length=266

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|AEM17351.1| R2R3-MYB transcriptional factor PvMYB4d [Panicum virgatum]
Length=256

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_008457683.1| PREDICTED: myb-related protein 308-like [Cucumis melo]
Length=257

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>gb|KFK32075.1| hypothetical protein AALP_AA6G196300 [Arabis alpina]
Length=236

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR+HGEGCWRSLPK+AGL  CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRNHGEGCWRSLPKSAGLFRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF++EED +IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+S G
Sbjct  61   LRPDLKRGNFSDEEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISHG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|AEM17348.1| R2R3-MYB transcriptional factor PvMYB4a [Panicum virgatum]
Length=258

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_004505789.1| PREDICTED: myb-related protein 308-like [Cicer arietinum]
Length=286

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_009631098.1| PREDICTED: myb-related protein 308-like [Nicotiana tomentosiformis]
Length=260

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|AEM17352.1| R2R3-MYB transcriptional factor PvMYB4e, partial [Panicum virgatum]
Length=255

 Score =   252 bits (644),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_007137351.1| hypothetical protein PHAVU_009G119900g [Phaseolus vulgaris]
 gb|ESW09345.1| hypothetical protein PHAVU_009G119900g [Phaseolus vulgaris]
Length=259

 Score =   252 bits (644),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_007137818.1| hypothetical protein PHAVU_009G158200g [Phaseolus vulgaris]
 gb|ESW09812.1| hypothetical protein PHAVU_009G158200g [Phaseolus vulgaris]
Length=318

 Score =   254 bits (649),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RLINYI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTEDEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_009406085.1| PREDICTED: myb-related protein 308-like [Musa acuminata subsp. 
malaccensis]
Length=257

 Score =   252 bits (644),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQ+LI YI++HGEGCWRSLP AAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQKLIAYIKAHGEGCWRSLPSAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDALIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|KHN39881.1| Myb-related protein 308 [Glycine soja]
Length=246

 Score =   252 bits (643),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_009376958.1| PREDICTED: myb-related protein 308-like [Pyrus x bretschneideri]
 ref|XP_009376962.1| PREDICTED: myb-related protein 308-like [Pyrus x bretschneideri]
Length=255

 Score =   252 bits (643),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_006384381.1| hypothetical protein POPTR_0004s14510g [Populus trichocarpa]
 gb|ERP62178.1| hypothetical protein POPTR_0004s14510g [Populus trichocarpa]
Length=319

 Score =   254 bits (649),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RL+NYI++ GEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVNYIKAQGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF++EED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL +RG
Sbjct  61   LRPDLKRGNFSDEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLFTRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|AGN52100.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52210.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=230

 Score =   251 bits (641),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_010421847.1| PREDICTED: transcription repressor MYB6 [Camelina sativa]
Length=235

 Score =   251 bits (641),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI++IR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDHIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT EED +IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS G
Sbjct  61   LRPDLKRGNFTNEEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_009379853.1| PREDICTED: myb-related protein Zm38-like [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   251 bits (640),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED++LI+YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDEKLISYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT EEDDLIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTAEEDDLIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            LDP+THRP
Sbjct  121  LDPKTHRP  128



>gb|AIE54279.1| transcription factor [Nicotiana tabacum]
Length=262

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|AID56314.1| MYB2 [Eriobotrya japonica]
Length=255

 Score =   252 bits (643),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_010431803.1| PREDICTED: transcription repressor MYB4-like [Camelina sativa]
Length=292

 Score =   253 bits (646),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|AHG99473.1| MYB16 [Malus hybrid cultivar]
Length=255

 Score =   252 bits (643),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|KHN09677.1| Myb-related protein 308 [Glycine soja]
Length=301

 Score =   253 bits (647),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RLINYI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_011088595.1| PREDICTED: myb-related protein 308 [Sesamum indicum]
Length=270

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_008377747.1| PREDICTED: myb-related protein 308-like [Malus domestica]
Length=255

 Score =   252 bits (643),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|ACU19175.1| unknown [Glycine max]
Length=246

 Score =   251 bits (642),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCE+AHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEEAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_010446371.1| PREDICTED: transcription repressor MYB4-like [Camelina sativa]
Length=292

 Score =   253 bits (646),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|AFI80908.1| R2R3-type MYB transcription factor [Leucaena leucocephala]
Length=235

 Score =   251 bits (641),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_009618136.1| PREDICTED: myb-related protein 308-like [Nicotiana tomentosiformis]
Length=258

 Score =   252 bits (643),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPTTHR  127



>ref|XP_008677677.1| PREDICTED: uncharacterized protein LOC100384270 isoform X1 [Zea 
mays]
 gb|AFW65431.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04293.1| MYB transcription factor, partial [Zea mays]
Length=288

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCE+AHTNKGAWTKEEDQRL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEQAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDDLIIK H L GNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDDLIIKFHELFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  MDPQTHRP  128



>gb|KJB47666.1| hypothetical protein B456_008G035700 [Gossypium raimondii]
Length=257

 Score =   252 bits (643),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_008363293.1| PREDICTED: myb-related protein 308-like [Malus domestica]
 gb|ADL36756.1| MYB domain class transcription factor [Malus domestica]
 gb|AHG99474.1| MYB17 [Malus hybrid cultivar]
 gb|AHG99478.1| MYB17 [Malus hybrid cultivar]
Length=255

 Score =   251 bits (642),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|AGN52052.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52162.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=219

 Score =   250 bits (639),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLISYIRAHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL RG
Sbjct  61   LRPDLKRGNFTEEEDEVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLRRG  120

Query  492  LDPQTHR  512
            +DPQTHR
Sbjct  121  MDPQTHR  127



>ref|XP_006284260.1| hypothetical protein CARUB_v10005426mg [Capsella rubella]
 gb|EOA17158.1| hypothetical protein CARUB_v10005426mg [Capsella rubella]
Length=285

 Score =   253 bits (645),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI+SHGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKSHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_010436959.1| PREDICTED: transcription repressor MYB4 isoform X1 [Camelina 
sativa]
 ref|XP_010436960.1| PREDICTED: transcription repressor MYB4 isoform X2 [Camelina 
sativa]
Length=291

 Score =   253 bits (645),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|KHN31220.1| Myb-related protein 308 [Glycine soja]
Length=302

 Score =   253 bits (646),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RLINYI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|NP_001233975.1| transcription factor [Solanum lycopersicum]
 emb|CAA64614.1| transcription factor [Solanum lycopersicum]
Length=273

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPTTHR  127



>gb|EPS68365.1| hypothetical protein M569_06408, partial [Genlisea aurea]
Length=129

 Score =   247 bits (630),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI Y+++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLITYVKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+EEEDD+IIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTH+KR+L+SRG
Sbjct  61   LRPDLKRGNFSEEEDDIIIKLHSLLGNKWSMIAGRLPGRTDNEIKNYWNTHLKRRLISRG  120

Query  492  LDPQTHR  512
            +DPQTHR
Sbjct  121  VDPQTHR  127



>gb|AIU39031.1| myb transcription factor 2, partial [Narcissus tazetta var. chinensis]
Length=251

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YI++HGEGCWRSLP+AAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDHRLISYIKAHGEGCWRSLPQAAGLLRCGKSCRLRWVNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDDLIIKLH +LGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL RG
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHGMLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLRRG  120

Query  492  LDPQTHRP  515
            LDPQTH+P
Sbjct  121  LDPQTHKP  128



>gb|EEC67791.1| hypothetical protein OsI_35350 [Oryza sativa Indica Group]
Length=295

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI+++GEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHELLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  VDPQTHRP  128



>ref|XP_006663259.1| PREDICTED: myb-related protein 330-like [Oryza brachyantha]
Length=256

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI+++GEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHELLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  VDPQTHRP  128



>ref|XP_009416922.1| PREDICTED: myb-related protein 308-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQ+LI YI +HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQKLITYIAAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLGRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_011097098.1| PREDICTED: myb-related protein 308-like [Sesamum indicum]
Length=274

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RL+ YI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVKYIKQHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED++II LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLL RG
Sbjct  61   LRPDLKRGNFTDEEDEIIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLGRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_011004000.1| PREDICTED: transcription repressor MYB6 [Populus euphratica]
Length=298

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI+YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIDYIRLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED++IIKLH LLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHGLLGNKWSLIAGKLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|AHB59595.1| putative R2R3 MYB protein 7 [Arachis hypogaea]
Length=317

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>emb|CCU64153.1| ScMYB1 protein [Saccharum hybrid cultivar Co 86032]
Length=245

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHI+RKLL RG
Sbjct  61   LRPDLKRGNFTADEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLGRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>gb|AAL84619.1|AF474122_1 typical P-type R2R3 Myb protein [Zea mays]
 gb|AAL90645.1|AF470077_1 P-type R2R3 Myb protein [Zea mays]
Length=198

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCE+AHTNKGAWTKEEDQRL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEQAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDDLIIK H L GNKW+LI+ RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDDLIIKFHELFGNKWALISRRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  MDPQTHRP  128



>ref|XP_009418831.1| PREDICTED: myb-related protein 308-like [Musa acuminata subsp. 
malaccensis]
Length=241

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED +LI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDQLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  VDPVTHRP  128



>ref|XP_010265977.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
Length=244

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI +IR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|AEE81751.1| MYB transcription factor [Morus alba var. multicaulis]
Length=260

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>dbj|BAF46265.1| putative transcription factor [Humulus lupulus]
Length=265

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|NP_001044957.1| Os01g0874300 [Oryza sativa Japonica Group]
 dbj|BAB86217.1| putative myb-related protein [Oryza sativa Japonica Group]
 dbj|BAB89293.1| putative myb2 [Oryza sativa Japonica Group]
 dbj|BAB92433.1| putative myb2 [Oryza sativa Japonica Group]
 dbj|BAF06871.1| Os01g0874300 [Oryza sativa Japonica Group]
 gb|EAY76672.1| hypothetical protein OsI_04627 [Oryza sativa Indica Group]
 gb|EAZ14337.1| hypothetical protein OsJ_04260 [Oryza sativa Japonica Group]
 dbj|BAG87538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=287

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+++D+LIIKLH+LLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTDDDDELIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|ABQ81931.1| transcription factor MYB4 [Brassica rapa var. purpuraria]
Length=294

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|NP_001268129.1| flavonoid-related R2R3 MYB 4a repressor transcription factor 
[Vitis vinifera]
 gb|ABL61515.1| R2R3 Myb4a C2 repressor motif protein [Vitis vinifera]
Length=251

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPSTHRP  128



>ref|XP_009101934.1| PREDICTED: transcription repressor MYB4 [Brassica rapa]
 gb|ABQ81932.1| transcription factor MYB4 [Brassica rapa subsp. chinensis]
 gb|ADZ98868.1| MYB domain protein 12 [Brassica rapa subsp. rapa]
 emb|CDY22416.1| BnaA06g37380D [Brassica napus]
Length=294

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_010941310.1| PREDICTED: myb-related protein Hv1-like [Elaeis guineensis]
Length=233

 Score =   250 bits (639),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/128 (94%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI +IR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAHIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            LDP THRP
Sbjct  121  LDPTTHRP  128



>ref|XP_006411651.1| hypothetical protein EUTSA_v10025886mg [Eutrema salsugineum]
 dbj|BAJ34516.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53104.1| hypothetical protein EUTSA_v10025886mg [Eutrema salsugineum]
Length=292

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_008788440.1| PREDICTED: myb-related protein Hv1-like [Phoenix dactylifera]
Length=237

 Score =   250 bits (639),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP TH P
Sbjct  121  IDPATHGP  128



>tpg|DAA38957.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=269

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCE+AHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEQAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+EEED+LIIK H L GNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFSEEEDELIIKFHELFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  MDPQTHRP  128



>ref|XP_002866812.1| hypothetical protein ARALYDRAFT_490626 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43071.1| hypothetical protein ARALYDRAFT_490626 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>emb|CCU64156.1| ScMYB4 protein [Saccharum hybrid cultivar Co 86032]
Length=148

 Score =   247 bits (631),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLS+G
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSKG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>emb|CBI27689.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDQRLIAYIKTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LII LHS  GNKWSLIA RLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTDEEDELIINLHSFFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_006645094.1| PREDICTED: myb-related protein 330-like [Oryza brachyantha]
Length=262

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+E+D+LIIKLH+LLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTDEDDELIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|KDP29641.1| hypothetical protein JCGZ_18803 [Jatropha curcas]
 gb|AIT52253.1| MYB family protein [Jatropha curcas]
Length=268

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|ADG46002.1| MYB4 [Salvia miltiorrhiza]
Length=230

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGR+PCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRAPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_011092988.1| PREDICTED: myb-related protein 308-like [Sesamum indicum]
Length=273

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_010920127.1| PREDICTED: myb-related protein 308-like [Elaeis guineensis]
Length=237

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>emb|CDX72743.1| BnaC07g47650D [Brassica napus]
Length=294

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>emb|CCC14990.1| Myb transcription factor [Humulus lupulus]
Length=265

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|NP_001235623.1| MYB transcription factor MYB54 [Glycine max]
 gb|ABH02822.1| MYB transcription factor MYB54 [Glycine max]
Length=253

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_006366980.1| PREDICTED: myb-related protein 308-like [Solanum tuberosum]
Length=268

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+EEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFSEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPTTHR  127



>sp|P81393.1|MYB08_ANTMA RecName: Full=Myb-related protein 308 [Antirrhinum majus]
Length=232

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPTTHR  127



>ref|XP_006660900.1| PREDICTED: myb-related protein Hv1-like [Oryza brachyantha]
Length=248

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_006376251.1| hypothetical protein POPTR_0013s11360g [Populus trichocarpa]
 gb|ERP54048.1| hypothetical protein POPTR_0013s11360g [Populus trichocarpa]
Length=301

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEEDQRL++YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDQRLMDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTDEEDEIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPHTHRP  128



>ref|XP_010910804.1| PREDICTED: myb-related protein 308-like [Elaeis guineensis]
Length=260

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWR+LPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRTLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLH +LGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHGMLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            LDP THRP
Sbjct  121  LDPLTHRP  128



>gb|KFK30463.1| hypothetical protein AALP_AA7G264300 [Arabis alpina]
Length=288

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|KEH35662.1| myb transcription factor [Medicago truncatula]
Length=297

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RLINYI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+EDDLII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTEQEDDLIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHR  512
            +DPQTHR
Sbjct  121  VDPQTHR  127



>ref|NP_001063796.1| Os09g0538400 [Oryza sativa Japonica Group]
 dbj|BAD34380.1| putative Myb-related protein Zm38 [Oryza sativa Japonica Group]
 dbj|BAF25710.1| Os09g0538400 [Oryza sativa Japonica Group]
 gb|EAZ09902.1| hypothetical protein OsI_32196 [Oryza sativa Indica Group]
 gb|EAZ45501.1| hypothetical protein OsJ_30158 [Oryza sativa Japonica Group]
 dbj|BAG96655.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96699.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99491.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60239.1| MYB transcription factor [Oryza sativa Japonica Group]
Length=251

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>gb|KHN25476.1| Myb-related protein 308 [Glycine soja]
Length=250

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|ABR25756.1| myb related protein hv1 [Oryza sativa Indica Group]
Length=235

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_007041863.1| MYB domain class transcription factor [Theobroma cacao]
 gb|EOX97694.1| MYB domain class transcription factor [Theobroma cacao]
Length=250

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>dbj|BAA23337.1| OSMYB1 [Oryza sativa]
Length=239

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT++ED+LII+LHSLLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_011007997.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=309

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RL++YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVSYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF++EED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFSDEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLFSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPLTHRP  128



>ref|XP_002456719.1| hypothetical protein SORBIDRAFT_03g041360 [Sorghum bicolor]
 gb|EES01839.1| hypothetical protein SORBIDRAFT_03g041360 [Sorghum bicolor]
Length=269

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+++D++IIKLH+LLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTDDDDEIIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_004144840.1| PREDICTED: myb-related protein 308-like [Cucumis sativus]
 ref|XP_004162908.1| PREDICTED: myb-related protein 308-like [Cucumis sativus]
Length=248

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+ EDDLIIKLHSLLGN+WSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTQHEDDLIIKLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_011001099.1| PREDICTED: transcription repressor MYB6 [Populus euphratica]
Length=302

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEEDQRL++YIR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDQRLMDYIRVHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED++IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTDEEDEIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPHTHRP  128



>gb|EEE51755.1| hypothetical protein OsJ_33189 [Oryza sativa Japonica Group]
Length=295

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI+++GEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+ IIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDEFIIKLHELLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  VDPQTHRP  128



>ref|XP_002444621.1| hypothetical protein SORBIDRAFT_07g024890 [Sorghum bicolor]
 gb|EES14116.1| hypothetical protein SORBIDRAFT_07g024890 [Sorghum bicolor]
Length=258

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGL+ CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLMRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHI+RKLL RG
Sbjct  61   LRPDLKRGNFTADEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLGRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>gb|ABP57083.1| Myb transcription factor [Solenostemon scutellarioides]
 gb|ABP57084.1| Myb transcription factor [Solenostemon scutellarioides]
Length=244

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  2    MGRSPCCEKAHTNKGAWTKEEDDRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  61

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL+S+G
Sbjct  62   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVSQG  121

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  122  IDPTTHRP  129



>ref|XP_007200603.1| hypothetical protein PRUPE_ppa010277mg [Prunus persica]
 gb|ADY15315.1| R2R3-MYB transcription factor [Prunus avium]
 gb|EMJ01802.1| hypothetical protein PRUPE_ppa010277mg [Prunus persica]
Length=256

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPTTHR  127



>gb|AAS19476.1| MYB2 [Tradescantia fluminensis]
Length=276

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI +I++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAHIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+EEED+LIIKLH++LGNKWSLIA +LPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFSEEEDELIIKLHAMLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  492  LDPQTHR  512
            +DPQTHR
Sbjct  121  IDPQTHR  127



>ref|XP_009387206.1| PREDICTED: myb-related protein Zm38-like, partial [Musa acuminata 
subsp. malaccensis]
Length=198

 Score =   248 bits (634),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED++L++YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  23   MGRSPCCEKAHTNKGAWTKEEDEKLVSYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  82

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+ IIKLH +LGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL RG
Sbjct  83   LRPDLKRGNFTEEEDEHIIKLHGVLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLGRG  142

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  143  IDPQTHRP  150



>ref|NP_001106037.1| transcription factor MYB8 [Zea mays]
 emb|CAJ42201.1| transcription factor MYB8 [Zea mays]
 gb|ADX60104.1| ZmMYB8 transcription factor [Zea mays]
 tpg|DAA55533.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=226

 Score =   249 bits (636),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EEDD+IIKLH +LGNKWSLIAA+LPGRTDNEIKNYWNTHIKRKL++RG
Sbjct  61   LRPDLKRGNFTQEEDDVIIKLHQVLGNKWSLIAAQLPGRTDNEIKNYWNTHIKRKLIARG  120

Query  492  LDPQTHRP  515
            +DP+TH+P
Sbjct  121  IDPRTHQP  128



>ref|XP_008447966.1| PREDICTED: myb-related protein 308-like [Cucumis melo]
Length=250

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+ EDDLIIKLHSLLGN+WSLIA RLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTQHEDDLIIKLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|NP_001065896.2| Os11g0180900 [Oryza sativa Japonica Group]
 dbj|BAF27741.2| Os11g0180900 [Oryza sativa Japonica Group]
Length=261

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI+++GEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+ IIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDEFIIKLHELLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  VDPQTHRP  128



>tpg|DAA38956.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=275

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCE+AHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEQAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+EEED+LIIK H L GNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFSEEEDELIIKFHELFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  MDPQTHRP  128



>gb|EEE63808.1| hypothetical protein OsJ_18632 [Oryza sativa Japonica Group]
Length=260

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT++ED+LII+LHSLLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|AHN16572.1| MYB1 [Malus hybrid cultivar]
 gb|AIW63284.1| MYB16 [Malus hybrid cultivar]
Length=252

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRG+FTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGSFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_009764613.1| PREDICTED: myb-related protein 308-like [Nicotiana sylvestris]
Length=262

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPTTHR  127



>gb|ACU23165.1| unknown [Glycine max]
Length=302

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK H NKGAWTKEED+RLINYI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHANKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|KDP22699.1| hypothetical protein JCGZ_02792 [Jatropha curcas]
 gb|AIT52252.1| MYB family protein [Jatropha curcas]
Length=307

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RL+NYI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVNYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LII LHSLLG KWSLIAARLPGRTDNEIKNYWNTHI+RKL SRG
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGTKWSLIAARLPGRTDNEIKNYWNTHIRRKLYSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_002530824.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF31564.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=266

 Score =   250 bits (639),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|NP_001174439.1| Os05g0429900 [Oryza sativa Japonica Group]
 gb|AAV59423.1| putative myb protein [Oryza sativa Japonica Group]
 gb|EAY98145.1| hypothetical protein OsI_20061 [Oryza sativa Indica Group]
 gb|ACF60464.1| myb transcription factor [Oryza sativa Japonica Group]
 dbj|BAG96391.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90147.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93928.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93167.1| Os05g0429900 [Oryza sativa Japonica Group]
Length=260

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT++ED+LII+LHSLLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_006856762.1| hypothetical protein AMTR_s00055p00057500 [Amborella trichopoda]
 gb|ERN18229.1| hypothetical protein AMTR_s00055p00057500 [Amborella trichopoda]
Length=233

 Score =   249 bits (636),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI++IR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLISHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  VDPLTHRP  128



>emb|CBI37882.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   248 bits (634),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPSTHRP  128



>gb|AEX92833.1| MYB42 [Saccharum hybrid cultivar Co 86032]
Length=260

 Score =   250 bits (638),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHI+RKLL RG
Sbjct  61   LRPDLKRGNFTADEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLGRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|NP_192684.1| transcription repressor MYB6 [Arabidopsis thaliana]
 sp|Q38851.1|MYB6_ARATH RecName: Full=Transcription repressor MYB6; AltName: Full=Myb-related 
protein 6; Short=AtMYB6 [Arabidopsis thaliana]
 gb|AAA98761.1| DNA-binding protein [Arabidopsis thaliana]
 emb|CAB78069.1| DNA-binding protein [Arabidopsis thaliana]
 gb|AAM63862.1| DNA-binding protein [Arabidopsis thaliana]
 gb|AAO42191.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAO50618.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAS10074.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE82750.1| transcription repressor MYB6 [Arabidopsis thaliana]
Length=236

 Score =   249 bits (636),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL++YIR+HGEGCWRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT++ED +IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS G
Sbjct  61   LRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  492  LDPQTHR  512
            +DPQTHR
Sbjct  121  IDPQTHR  127



>gb|KHN33675.1| Myb-related protein 308 [Glycine soja]
Length=210

 Score =   248 bits (633),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDHRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT EED LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTLEEDQLIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|ADT91707.1| MYB transcription factor [Gossypium hirsutum]
Length=257

 Score =   250 bits (638),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MG SPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGSSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_009414444.1| PREDICTED: myb-related protein Zm38-like [Musa acuminata subsp. 
malaccensis]
Length=225

 Score =   248 bits (634),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSL+GNKWSLIAARLPGRTDNEIKNYWNTHI+RKLL RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLIGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLCRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  VDPVTHRP  128



>gb|ADX33331.1| R2R3-MYB transcription factor [Petunia x hybrida]
Length=258

 Score =   249 bits (637),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPTTHR  127



>ref|XP_008799190.1| PREDICTED: myb-related protein 308-like [Phoenix dactylifera]
Length=258

 Score =   249 bits (637),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCC++AHTNKGAWTKEEDQRLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCDRAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLH LLGNKWSLIA +LPGRTDNEIKNYWNTHI+RKL+SRG
Sbjct  61   LRPDLKRGNFTEKEDELIIKLHGLLGNKWSLIAGQLPGRTDNEIKNYWNTHIRRKLISRG  120

Query  492  LDPQTHRP  515
            LDP THRP
Sbjct  121  LDPNTHRP  128



>gb|AJD79907.1| MYB1 [Punica granatum]
Length=263

 Score =   250 bits (638),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAH NKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHMNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPSTHRP  128



>ref|NP_195574.1| transcription repressor MYB4 [Arabidopsis thaliana]
 sp|Q9SZP1.1|MYB4_ARATH RecName: Full=Transcription repressor MYB4; AltName: Full=Myb-related 
protein 4; Short=AtMYB4 [Arabidopsis thaliana]
 emb|CAB37518.1| putative transcription factor (MYB4) [Arabidopsis thaliana]
 emb|CAB80526.1| putative transcription factor (MYB4) [Arabidopsis thaliana]
 gb|AAL49837.1| putative transcription factor MYB4 [Arabidopsis thaliana]
 gb|AAM67537.1| putative transcription factor MYB4 [Arabidopsis thaliana]
 gb|AAM98178.1| putative transcription factor MYB4 [Arabidopsis thaliana]
 gb|AAP13410.1| At4g38620 [Arabidopsis thaliana]
 gb|AAS10085.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE86955.1| transcription repressor MYB4 [Arabidopsis thaliana]
Length=282

 Score =   250 bits (639),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP +HRP
Sbjct  121  IDPTSHRP  128



>gb|AAC83582.1| putative transcription factor [Arabidopsis thaliana]
Length=282

 Score =   250 bits (639),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP +HRP
Sbjct  121  IDPTSHRP  128



>ref|NP_001242477.1| uncharacterized protein LOC100808083 [Glycine max]
 gb|ACU21306.1| unknown [Glycine max]
Length=303

 Score =   251 bits (641),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RLINYI+ HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LII LHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHRP  515
            +DP+THRP
Sbjct  121  IDPRTHRP  128



>emb|CDX90285.1| BnaA08g16990D [Brassica napus]
Length=283

 Score =   250 bits (639),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RL  YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>ref|XP_004957488.1| PREDICTED: myb-related protein Hv1-like [Setaria italica]
Length=246

 Score =   249 bits (636),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_009393912.1| PREDICTED: myb-related protein Hv1-like [Musa acuminata subsp. 
malaccensis]
Length=226

 Score =   248 bits (634),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI +IR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKN+WNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNHWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  VDPATHRP  128



>ref|NP_001235637.1| MYB transcription factor MYB48 [Glycine max]
 gb|ABH02823.1| MYB transcription factor MYB48 [Glycine max]
Length=235

 Score =   249 bits (635),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDHRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+ EED LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFSLEEDQLIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_008653573.1| PREDICTED: myb-related protein Hv1 isoform X2 [Zea mays]
Length=262

 Score =   249 bits (637),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YI++HGEGCWRSLPKAAGL+ CGKSCRLRWINY
Sbjct  45   MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLVRCGKSCRLRWINY  104

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  105  LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  164

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  165  IDPVTHRP  172



>ref|XP_008800133.1| PREDICTED: myb-related protein Hv1-like [Phoenix dactylifera]
Length=236

 Score =   249 bits (635),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLVNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_008653572.1| PREDICTED: myb-related protein Hv1 isoform X1 [Zea mays]
Length=263

 Score =   249 bits (637),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YI++HGEGCWRSLPKAAGL+ CGKSCRLRWINY
Sbjct  46   MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLVRCGKSCRLRWINY  105

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  106  LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  165

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  166  IDPVTHRP  173



>ref|XP_004141649.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
 ref|XP_004162864.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
 gb|KGN52706.1| hypothetical protein Csa_5G651640 [Cucumis sativus]
Length=294

 Score =   251 bits (640),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTK+EDQRLI+YIR HGEGCWR+LPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKDEDQRLIDYIRLHGEGCWRTLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWS+IA RLPGRTDNEIKNYWNTHIKRKL++RG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSVIAGRLPGRTDNEIKNYWNTHIKRKLITRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_011046315.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=271

 Score =   249 bits (637),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEAEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|AGT17220.1| myb domain protein 4 [Saccharum hybrid cultivar R570]
Length=259

 Score =   249 bits (636),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>gb|ABQ51221.1| R2R3-MYB transcription factor MYB5 [Picea glauca]
Length=257

 Score =   249 bits (636),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI +IR+HGEGCWRSLPKAAGL+ CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAHIRAHGEGCWRSLPKAAGLMRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+EEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL++G
Sbjct  61   LRPDLKRGNFSEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLNKG  120

Query  492  LDPQTHRP  515
            LDPQ+HRP
Sbjct  121  LDPQSHRP  128



>gb|ACF83817.1| unknown [Zea mays]
 gb|ADX60205.1| MYB transcription factor [Zea mays]
 tpg|DAA40645.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=273

 Score =   249 bits (637),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RL+ +IR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LI+KLHS+LGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIVKLHSVLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>gb|KHG25834.1| Myb-related protein [Gossypium arboreum]
Length=260

 Score =   249 bits (636),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEG WRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIHYIRVHGEGSWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  492  LDPQTHRP  515
            +DPQ+HRP
Sbjct  121  IDPQSHRP  128



>ref|XP_008236005.1| PREDICTED: myb-related protein 308-like [Prunus mume]
Length=256

 Score =   249 bits (636),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLTRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPTTHR  127



>gb|AEM17349.1| R2R3-MYB transcriptional factor PvMYB4b [Panicum virgatum]
Length=256

 Score =   249 bits (636),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNK AWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKCAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>gb|AEO27497.1| MYB1 [Chrysanthemum x morifolium]
Length=281

 Score =   250 bits (638),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>dbj|BAM71804.1| R2R3-MYB transcription factor [Gentiana triflora]
Length=266

 Score =   249 bits (637),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+EEED+LIIKLHS+LGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFSEEEDELIIKLHSILGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_009109540.1| PREDICTED: transcription repressor MYB4 [Brassica rapa]
Length=283

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RL  YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPTTHRP  128



>gb|KJB59602.1| hypothetical protein B456_009G263200 [Gossypium raimondii]
Length=260

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEG WRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIHYIRVHGEGSWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEDEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLVSRG  120

Query  492  LDPQTHRP  515
            +DPQ+HRP
Sbjct  121  IDPQSHRP  128



>ref|XP_010266817.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
Length=241

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI +IR++GEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAHIRAYGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|AGN52078.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52188.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=267

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTK+EDQRLINYIR+HGEG WRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKDEDQRLINYIRAHGEGNWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED++IIKLHSLLGN+WSLIA RLPGRTDNEIKNYWNTHIKRKL+S G
Sbjct  61   LRPDLKRGNFTEEEDEIIIKLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHIKRKLISSG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  VDPQTHRP  128



>gb|AGO33166.1| MYB transcription factor [Narcissus tazetta var. chinensis]
Length=201

 Score =   247 bits (630),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI +I++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAHIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIA RL GRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAGRLQGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  VDPNTHRP  128



>ref|XP_009603939.1| PREDICTED: myb-related protein 308-like [Nicotiana tomentosiformis]
Length=264

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK+HTNKGAWTKEED+RLI YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKSHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPTTHR  127



>ref|XP_004978868.1| PREDICTED: transcription repressor MYB4-like [Setaria italica]
Length=280

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCE+AHTNKGAWTKEEDQRLI YI++HGEGCWRSLP+AAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEQAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPRAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIK H L GNKWSLIA RLPGRTDNEIKNYWNTHIKRKL++RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKFHELFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLVARG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_004147356.1| PREDICTED: myb-related protein 330-like, partial [Cucumis sativus]
 ref|XP_004170999.1| PREDICTED: myb-related protein 330-like, partial [Cucumis sativus]
Length=198

 Score =   247 bits (630),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEEDQRLINYI+ HG+GCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKQHTNKGAWTKEEDQRLINYIQIHGDGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT EED +II LH+LLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL SRG
Sbjct  61   LRPDLKRGNFTAEEDQIIINLHTLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLYSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_002312966.1| putative MYB transcription factor family protein [Populus trichocarpa]
 gb|EEE86921.1| putative MYB transcription factor family protein [Populus trichocarpa]
 gb|ACN97177.1| MYB transcription factor [Populus trichocarpa]
Length=271

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEAEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_002442905.1| hypothetical protein SORBIDRAFT_08g004720 [Sorghum bicolor]
 gb|EES16743.1| hypothetical protein SORBIDRAFT_08g004720 [Sorghum bicolor]
Length=215

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLH +LGNKWSLIA RLPGRTDNEIKNYWNTHIKRKL++RG
Sbjct  61   LRPDLKRGNFTQEEDELIIKLHQILGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLIARG  120

Query  492  LDPQTHRP  515
            +DP+TH+P
Sbjct  121  IDPRTHQP  128



>ref|XP_010933337.1| PREDICTED: myb-related protein Hv1-like [Elaeis guineensis]
Length=229

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRTHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTKEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_008653574.1| PREDICTED: myb-related protein Hv1 isoform X3 [Zea mays]
 tpg|DAA64349.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05021.1| MYB transcription factor, partial [Zea mays]
Length=218

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YI++HGEGCWRSLPKAAGL+ CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLVRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_006659665.1| PREDICTED: myb-related protein Zm38-like [Oryza brachyantha]
Length=247

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK HTNKGAWTKEED+RL++YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHTNKGAWTKEEDERLVSYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHI+RKLL RG
Sbjct  61   LRPDLKRGNFTADEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIRRKLLGRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_009420186.1| PREDICTED: myb-related protein 308-like [Musa acuminata subsp. 
malaccensis]
Length=247

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YI +HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDLRLISYINAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LII LHSLLGNKWS+IA RLPGRTDNEIKNYWNTHI+RKLL RG
Sbjct  61   LRPDLKRGNFTEEEDELIINLHSLLGNKWSVIARRLPGRTDNEIKNYWNTHIRRKLLGRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>gb|AEV91151.1| R2R3-MYB protein [Triticum aestivum]
 gb|EMT01533.1| Transcription repressor MYB4 [Aegilops tauschii]
Length=271

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIGYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+++D+LIIKLH+LLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTDDDDELIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  MDPHTHRP  128



>gb|ADL18407.1| P1 transcription factor [Eremochloa ophiuroides]
Length=261

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGR+PCCEKAHTNKGAWTKEED RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRAPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>sp|P20025.1|MYB38_MAIZE RecName: Full=Myb-related protein Zm38 [Zea mays]
 prf||1613412D myb-related gene Zm38
Length=255

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTN+GAWTKEED+RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNRGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNTH++RKLL RG
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHVRRKLLGRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>gb|ACT82838.1| transcription factor MYB047 [Glycine max]
Length=210

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI+YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDHRLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF+ EED LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFSLEEDQLIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|NP_001105949.1| transcription factor MYB31 [Zea mays]
 emb|CAJ42202.1| transcription factor MYB31 [Zea mays]
Length=275

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RL+ +IR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLVAHIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LI+KLHS+LGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIVKLHSVLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_009404326.1| PREDICTED: myb-related protein Zm38-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/128 (90%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED++LI+YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDEKLISYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT  ED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNT IKRKLL RG
Sbjct  61   LRPDLKRGNFTAAEDELIIKLHGLLGNKWSLIAGRLPGRTDNEIKNYWNTTIKRKLLGRG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>gb|EMS68045.1| Transcription repressor MYB4 [Triticum urartu]
Length=267

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIGYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+++D+LIIKLH+LLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTDDDDELIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  MDPHTHRP  128



>gb|AEM17350.1| R2R3-MYB transcriptional factor PvMYB4c [Panicum virgatum]
Length=258

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSP CEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPFCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_009134143.1| PREDICTED: transcription repressor MYB6 [Brassica rapa]
 emb|CDX90721.1| BnaA03g24010D [Brassica napus]
Length=224

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI+YIR HGEG WRSLPK+AGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIDYIRIHGEGSWRSLPKSAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNF++EED +IIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLLS G
Sbjct  61   LRPDLKRGNFSDEEDKVIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>ref|XP_006664389.1| PREDICTED: myb-related protein 330-like [Oryza brachyantha]
Length=257

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI +IR HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAHIRQHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT++ED+LIIKLH LLGNKWSLIA RLPGRTDNEIKNYWNTHIKRKLL+RG
Sbjct  61   LRPDLKRGNFTDDEDELIIKLHELLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARG  120

Query  492  LDPQTHRP  515
            LDPQTHRP
Sbjct  121  LDPQTHRP  128



>ref|XP_004970740.1| PREDICTED: myb-related protein 308-like [Setaria italica]
Length=271

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 125/128 (98%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEEDQRLI YI++HGEGCWRSLPKAAGLL CGKSCRLRW+NY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+E+D+LIIKLH+LLGNKWSLIA +LPGRTDNEIKNYWNTHIKRKLLSRG
Sbjct  61   LRPDLKRGNFTDEDDELIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLSRG  120

Query  492  LDPQTHRP  515
            +DPQTHRP
Sbjct  121  IDPQTHRP  128



>gb|AFZ78649.1| MYB transcription factor [Populus tomentosa]
Length=269

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEAEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>gb|KFK40077.1| hypothetical protein AALP_AA3G327100 [Arabis alpina]
Length=259

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEK H NKGAWTKEED+RL++YI+SHGEGCWRSLP+AAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKEHMNKGAWTKEEDERLVSYIKSHGEGCWRSLPRAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT EEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLS+G
Sbjct  61   LRPDLKRGNFTHEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSKG  120

Query  492  LDPQTHR  512
            +DP THR
Sbjct  121  IDPATHR  127



>ref|XP_002462743.1| hypothetical protein SORBIDRAFT_02g031190 [Sorghum bicolor]
 gb|EER99264.1| hypothetical protein SORBIDRAFT_02g031190 [Sorghum bicolor]
Length=264

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL+ YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLLSRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>gb|AIS35923.1| MYB transcription factor 6 [Phalaenopsis equestris]
Length=262

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED+RLI YI+++GEGCWRSLPKAA LL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDERLIAYIKANGEGCWRSLPKAASLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKL+SRG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLISRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



>ref|XP_008664600.1| PREDICTED: myb-related protein Zm38 [Zea mays]
 tpg|DAA48745.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04526.1| MYB transcription factor, partial [Zea mays]
Length=254

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTN+GAWTKEED+RL+ YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNRGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT +EDDLI+KLHSLLGNKWSLIAARLPGRTDNEIKNYWNTH++RKLL RG
Sbjct  61   LRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHVRRKLLGRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPVTHRP  128



>ref|XP_010090332.1| Myb-related protein 308 [Morus notabilis]
 gb|EXB39302.1| Myb-related protein 308 [Morus notabilis]
Length=261

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTEEED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHR  512
            +DP TH+
Sbjct  121  IDPATHK  127



>emb|CDY12092.1| BnaC03g60080D [Brassica napus]
Length=304

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RL  YI++HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  23   MGRSPCCEKAHTNKGAWTKEEDARLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  82

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFTE+ED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKL++RG
Sbjct  83   LRPDLKRGNFTEDEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRG  142

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  143  IDPTTHRP  150



>ref|XP_006422616.1| hypothetical protein CICLE_v10028908mg [Citrus clementina]
 gb|ESR35856.1| hypothetical protein CICLE_v10028908mg [Citrus clementina]
Length=307

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +3

Query  132  MGRSPCCEKAHTNKGAWTKEEDQRLINYIRSHGEGCWRSLPKAAGLLXCGKSCRLRWINY  311
            MGRSPCCEKAHTNKGAWTKEED RLI YIR+HGEGCWRSLPKAAGLL CGKSCRLRWINY
Sbjct  1    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINY  60

Query  312  LRPDLKRGNFTEEEDDLIIKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHIKRKLLSRG  491
            LRPDLKRGNFT+EED+LIIKLHSLLGNKWSLIA RLPGRTDNEIKNYWNTHI+RKLL+RG
Sbjct  61   LRPDLKRGNFTDEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLNRG  120

Query  492  LDPQTHRP  515
            +DP THRP
Sbjct  121  IDPATHRP  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325