BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006A20

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009793156.1|  PREDICTED: dnaJ homolog subfamily C member 14      114   1e-27   Nicotiana sylvestris
ref|XP_009599104.1|  PREDICTED: dnaJ homolog subfamily C member 14      113   3e-27   Nicotiana tomentosiformis
ref|XP_006376249.1|  hypothetical protein POPTR_0013s11340g             107   5e-25   
ref|XP_011001096.1|  PREDICTED: dnaJ homolog subfamily B member 14      107   6e-25   Populus euphratica
ref|XP_004247453.1|  PREDICTED: uncharacterized protein LOC101257008    107   1e-24   Solanum lycopersicum
ref|XP_006359423.1|  PREDICTED: dnaJ homolog subfamily C member 1...    105   2e-24   Solanum tuberosum [potatoes]
ref|XP_007045885.1|  Chaperone DnaJ-domain superfamily protein          105   4e-24   
ref|XP_010679887.1|  PREDICTED: uncharacterized protein LOC104895126    103   1e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006473166.1|  PREDICTED: uncharacterized J domain-containi...    103   1e-23   Citrus sinensis [apfelsine]
ref|XP_011079729.1|  PREDICTED: dnaJ homolog subfamily C member 9       103   2e-23   Sesamum indicum [beniseed]
gb|KJB60803.1|  hypothetical protein B456_009G326500                    102   3e-23   Gossypium raimondii
ref|XP_006434578.1|  hypothetical protein CICLE_v10002209mg             101   7e-23   Citrus clementina [clementine]
gb|KHG19820.1|  Triose phosphate/phosphate translocator, chloropl...    105   8e-23   Gossypium arboreum [tree cotton]
ref|XP_010246036.1|  PREDICTED: uncharacterized protein LOC104589413    100   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010064575.1|  PREDICTED: dnaJ homolog subfamily B member 1...  98.2    1e-21   Eucalyptus grandis [rose gum]
ref|XP_009362458.1|  PREDICTED: dnaJ homolog subfamily B member 1...  97.4    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_008339223.1|  PREDICTED: dnaJ homolog subfamily B member 1...  97.4    2e-21   
ref|XP_008339222.1|  PREDICTED: dnaJ homolog subfamily C member 1...  97.1    4e-21   
ref|XP_010045171.1|  PREDICTED: dnaJ homolog subfamily B member 1...  96.7    4e-21   Eucalyptus grandis [rose gum]
gb|KDP34831.1|  hypothetical protein JCGZ_11193                       96.7    5e-21   Jatropha curcas
ref|XP_010104484.1|  Chaperone protein DnaJ                           96.3    6e-21   Morus notabilis
ref|XP_007223682.1|  hypothetical protein PRUPE_ppa010245mg           92.4    1e-19   Prunus persica
ref|XP_010530162.1|  PREDICTED: dnaJ homolog subfamily B member 14    91.7    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_008462782.1|  PREDICTED: dnaJ homolog subfamily B member 12    90.9    4e-19   Cucumis melo [Oriental melon]
ref|XP_002272533.1|  PREDICTED: uncharacterized protein LOC100252905  89.7    1e-18   Vitis vinifera
ref|XP_008219027.1|  PREDICTED: dnaJ homolog subfamily B member 14    89.0    3e-18   Prunus mume [ume]
ref|XP_010421846.1|  PREDICTED: dnaJ homolog subfamily B member 12    88.6    3e-18   Camelina sativa [gold-of-pleasure]
emb|CDP03536.1|  unnamed protein product                              87.8    6e-18   Coffea canephora [robusta coffee]
ref|XP_003539686.1|  PREDICTED: uncharacterized protein LOC100819309  87.8    7e-18   Glycine max [soybeans]
ref|XP_004299890.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...  87.8    8e-18   Fragaria vesca subsp. vesca
ref|XP_002874566.1|  DNAJ heat shock N-terminal domain-containing...  87.4    9e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_010455337.1|  PREDICTED: dnaJ homolog subfamily B member 1...  87.0    2e-17   Camelina sativa [gold-of-pleasure]
gb|KFK32077.1|  hypothetical protein AALP_AA6G196600                  86.7    2e-17   Arabis alpina [alpine rockcress]
ref|XP_010435793.1|  PREDICTED: dnaJ homolog subfamily B member 1...  86.3    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006397191.1|  hypothetical protein EUTSA_v10028742mg           87.0    3e-17   
ref|NP_192673.1|  NADH dehydrogenase-like complex T                   85.1    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34686.1|  unknown                                               84.7    9e-17   Medicago truncatula
gb|KEH29266.1|  DnaJ heat shock amino-terminal domain protein         84.7    9e-17   Medicago truncatula
ref|XP_004137622.1|  PREDICTED: uncharacterized protein LOC101208302  84.0    1e-16   Cucumis sativus [cucumbers]
ref|XP_004506395.1|  PREDICTED: uncharacterized protein LOC101493556  83.2    4e-16   
ref|XP_009113533.1|  PREDICTED: uncharacterized protein LOC103838834  82.4    6e-16   Brassica rapa
emb|CDX75107.1|  BnaC09g25750D                                        81.3    1e-15   
gb|EYU46716.1|  hypothetical protein MIMGU_mgv1a012583mg              80.5    2e-15   Erythranthe guttata [common monkey flower]
ref|NP_001148857.1|  LOC100282476                                     78.2    2e-14   Zea mays [maize]
ref|XP_002533580.1|  conserved hypothetical protein                   76.3    2e-14   Ricinus communis
ref|XP_006288529.1|  hypothetical protein CARUB_v10001800mg           77.8    2e-14   Capsella rubella
ref|XP_008786523.1|  PREDICTED: dnaJ homolog subfamily C member 2...  77.0    4e-14   
ref|XP_008786524.1|  PREDICTED: dnaJ homolog subfamily C member 2...  76.3    5e-14   
ref|XP_007131284.1|  hypothetical protein PHAVU_011G001000g           75.9    1e-13   Phaseolus vulgaris [French bean]
ref|XP_010930616.1|  PREDICTED: uncharacterized protein LOC105051729  75.9    1e-13   Elaeis guineensis
ref|XP_003531831.1|  PREDICTED: dnaJ homolog subfamily C member 1...  75.5    1e-13   
gb|ACU17982.1|  unknown                                               75.1    1e-13   Glycine max [soybeans]
gb|KHM98836.1|  Chaperone protein DnaJ                                75.5    1e-13   Glycine soja [wild soybean]
ref|XP_009406485.1|  PREDICTED: dnaJ homolog subfamily B member 14    75.5    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002449374.1|  hypothetical protein SORBIDRAFT_05g008750        73.2    8e-13   Sorghum bicolor [broomcorn]
ref|XP_003577706.1|  PREDICTED: dnaJ homolog subfamily A member 3...  70.1    9e-12   Brachypodium distachyon [annual false brome]
ref|XP_004979103.1|  PREDICTED: dnaJ homolog subfamily B member 1...  70.1    1e-11   Setaria italica
ref|XP_006858482.1|  hypothetical protein AMTR_s00071p00121290        67.0    1e-10   Amborella trichopoda
ref|NP_001067508.1|  Os11g0216100                                     65.5    4e-10   
ref|XP_006663300.1|  PREDICTED: dnaJ homolog subfamily B member 1...  59.7    5e-08   Oryza brachyantha
ref|XP_001768838.1|  predicted protein                                48.1    8e-04   



>ref|XP_009793156.1| PREDICTED: dnaJ homolog subfamily C member 14 [Nicotiana sylvestris]
Length=249

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 84/127 (66%), Gaps = 5/127 (4%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevrIFATTQGPKPPPRQTAPP  289
            MAS T+P + F+ L   + TE R +       +        ++ AT +GP    RQ APP
Sbjct  1    MASATSPPAPFTFLSSNQSTEHR-TYGRWLTTKQRSQHGSFQVCATQEGP--SKRQRAPP  57

Query  290  GVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVG  469
            GVDTRIHWENEDEGW+GGS S   + ++++KADE  LL +KFS++LNSS DSHYQFLGV 
Sbjct  58   GVDTRIHWENEDEGWVGGSKSQ--SAQERIKADEKNLLDEKFSDLLNSSADSHYQFLGVS  115

Query  470  ADADVEE  490
            A AD+EE
Sbjct  116  ATADLEE  122



>ref|XP_009599104.1| PREDICTED: dnaJ homolog subfamily C member 14 [Nicotiana tomentosiformis]
Length=249

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 84/127 (66%), Gaps = 5/127 (4%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevrIFATTQGPKPPPRQTAPP  289
            MAS T+P + F+ L   + TE R +       +        +++AT +GP    RQ APP
Sbjct  1    MASATSPPAPFTFLSSNQSTEHR-TYGQWLTAKQRSRCGGFQVYATQEGP--SKRQRAPP  57

Query  290  GVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVG  469
             VDTRIHWENEDEGW+GGS S   + ++++KADE  LL +KFS++LNSS DSHYQFLGV 
Sbjct  58   DVDTRIHWENEDEGWVGGSKSQ--SAQERIKADEKNLLDEKFSDLLNSSADSHYQFLGVS  115

Query  470  ADADVEE  490
            A AD+EE
Sbjct  116  ATADLEE  122



>ref|XP_006376249.1| hypothetical protein POPTR_0013s11340g [Populus trichocarpa]
 gb|ERP54046.1| hypothetical protein POPTR_0013s11340g [Populus trichocarpa]
Length=256

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 16/136 (12%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRC------RRTE---LRQSPAVErrrrpygcrrevrIFATTQGPK  262
            MASTTA Q+ FS+  R       RR +   +R++P+     R     R   ++A    P+
Sbjct  1    MASTTATQAPFSLFLRTQNGSGHRRKKHLLIRKAPS----GRTGNRGRAFGVYAEQGSPE  56

Query  263  PPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTD  442
             P R  APPGVDTRIHW+NEDEGW+GGSS+SS  Q +Q + ++ ++LG +F+++LN S+D
Sbjct  57   KPQR--APPGVDTRIHWDNEDEGWVGGSSTSSE-QTKQAEDEQKDMLGKRFADLLNDSSD  113

Query  443  SHYQFLGVGADADVEE  490
            SHYQFLGV ADAD+EE
Sbjct  114  SHYQFLGVSADADMEE  129



>ref|XP_011001096.1| PREDICTED: dnaJ homolog subfamily B member 14 [Populus euphratica]
Length=256

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 90/136 (66%), Gaps = 16/136 (12%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRC------RRTE---LRQSPAVErrrrpygcrrevrIFATTQGPK  262
            MASTTA Q+ FS+  R       RR +   +R++P+     R         ++A    P+
Sbjct  1    MASTTATQAPFSLFLRTENGSGHRRKKHLLVRKAPS----GRTGNRGSVFGVYAEQGSPE  56

Query  263  PPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTD  442
             P R  APPGVDTRIHW+NEDEGW+GG+S+SS  Q +Q + ++ ++LG +F+++LN S+D
Sbjct  57   KPRR--APPGVDTRIHWDNEDEGWVGGTSTSSE-QTKQAEDEQKDMLGKRFADLLNDSSD  113

Query  443  SHYQFLGVGADADVEE  490
            SHYQFLGV ADAD+EE
Sbjct  114  SHYQFLGVSADADMEE  129



>ref|XP_004247453.1| PREDICTED: uncharacterized protein LOC101257008 [Solanum lycopersicum]
Length=270

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +2

Query  98   IPIPMASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevrIFATTQGPKPPPRQ  277
            I   MAS TAP + F+ L R +     ++       +    R  ++++A  +G     RQ
Sbjct  17   ISNSMASATAPPAPFTFLTRNQTNNEHRTDTRWLTTKQRRRRVGLQVYAKEEGA--TGRQ  74

Query  278  TAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQF  457
             APPGVDTRIHWENEDEGW+G  S S STQE+ +K DE  L  +KFS++LNSS +SHYQF
Sbjct  75   RAPPGVDTRIHWENEDEGWVG-ESKSRSTQER-IKTDEKNLFDEKFSDLLNSSANSHYQF  132

Query  458  LGVGADADVEE  490
            LGV A AD+EE
Sbjct  133  LGVSATADLEE  143



>ref|XP_006359423.1| PREDICTED: dnaJ homolog subfamily C member 14-like [Solanum tuberosum]
Length=250

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevrIFATTQGPKPPPRQTAPP  289
            MAS TAP + F+ L R       ++ A     +    R  ++++AT +G     +Q APP
Sbjct  1    MASATAPPTPFTFLSRNLSNNDHRTDARWLTTKQRRRRVGLQVYATEEGA--SGQQRAPP  58

Query  290  GVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVG  469
            GVDTRIHWENEDEGW+G  S S STQE+ +K ++  LL +KFS++LNSS +SHYQFLGV 
Sbjct  59   GVDTRIHWENEDEGWVG-ESKSRSTQER-IKTEKKNLLDEKFSDLLNSSANSHYQFLGVS  116

Query  470  ADADVEE  490
            A AD+EE
Sbjct  117  ATADLEE  123



>ref|XP_007045885.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
 gb|EOY01717.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
Length=299

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 65/78 (83%), Gaps = 3/78 (4%)
 Frame = +2

Query  263  PPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENE--LLGDKFSEVLNSS  436
            P  RQ APPGVDTRIHW+NEDEGWIGGSS S  T E++L A+E +  LLG+KF+++LN S
Sbjct  95   PSGRQRAPPGVDTRIHWDNEDEGWIGGSSKSQQT-EEKLGAEEQQKNLLGEKFADLLNDS  153

Query  437  TDSHYQFLGVGADADVEE  490
            +DSHYQFLGV A+AD+EE
Sbjct  154  SDSHYQFLGVSAEADLEE  171



>ref|XP_010679887.1| PREDICTED: uncharacterized protein LOC104895126 [Beta vulgaris 
subsp. vulgaris]
Length=255

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 87/132 (66%), Gaps = 8/132 (6%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRCRRT-----ELRQSPAVErrrrpygcrrevrIFATTQGPKPPPR  274
            MAST+AP S  S+     R      + + +  +++         ++ +FA TQ      +
Sbjct  1    MASTSAPPSPLSLFLGNNRNGYPTWKKQVTILIQKAVAKRKNHAKLCVFAATQDAGE--Q  58

Query  275  QTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQ  454
            Q APPGVDTRIHWENEDEGWIGGS+S ++ ++ + + ++ +LLG+KF+E+LNSS DSHYQ
Sbjct  59   QRAPPGVDTRIHWENEDEGWIGGSTSKANEEQFKAETEQKDLLGEKFAELLNSS-DSHYQ  117

Query  455  FLGVGADADVEE  490
            FLGV  DAD+EE
Sbjct  118  FLGVTPDADLEE  129



>ref|XP_006473166.1| PREDICTED: uncharacterized J domain-containing protein C17A3.05c-like 
[Citrus sinensis]
 gb|KDO83864.1| hypothetical protein CISIN_1g024973mg [Citrus sinensis]
Length=259

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevrIFATTQGPKPPPRQTAPP  289
            MAST +PQS +S+  + +   L+Q     R        + +R+FA+ +      ++ A P
Sbjct  3    MASTVSPQSPYSLFLKTQHGSLQQLTKEPRAATARTRSKILRVFASQKAGSNKSQRRAQP  62

Query  290  GVDTRIHWENEDEGWIGGssssssTQEQQLKADENE--LLGDKFSEVLNSSTDSHYQFLG  463
            GVDTRIHWENEDEGWIGGSSSSS    Q   A+E +  LLG+KF+++LN+S+DSHYQFLG
Sbjct  63   GVDTRIHWENEDEGWIGGSSSSSHQTNQNFNAEEEQKNLLGEKFADLLNNSSDSHYQFLG  122

Query  464  VGADADVEE  490
            +   AD+EE
Sbjct  123  ISPSADLEE  131



>ref|XP_011079729.1| PREDICTED: dnaJ homolog subfamily C member 9 [Sesamum indicum]
Length=249

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 64/73 (88%), Gaps = 3/73 (4%)
 Frame = +2

Query  272  RQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHY  451
            RQ APPGVDTRIHWENEDEGWIGG SS  STQEQ    D+++LLG+KFS++L+SSTDS+Y
Sbjct  53   RQRAPPGVDTRIHWENEDEGWIGG-SSPRSTQEQ--VKDDDDLLGEKFSDLLDSSTDSYY  109

Query  452  QFLGVGADADVEE  490
            QFLGV A+AD+EE
Sbjct  110  QFLGVPANADLEE  122



>gb|KJB60803.1| hypothetical protein B456_009G326500 [Gossypium raimondii]
Length=257

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 3/86 (3%)
 Frame = +2

Query  236  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENE-LLGDK  412
            +FA T GP  P R   PPGVDTRIHW+NEDEGWIG SS+S  T+E+    +E + LLG+K
Sbjct  46   VFAATTGPSKPQR--PPPGVDTRIHWDNEDEGWIGESSNSRQTKEKLNPEEEQKSLLGEK  103

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F+++LN S+DSHYQFLGV A+AD+EE
Sbjct  104  FADLLNDSSDSHYQFLGVSAEADLEE  129



>ref|XP_006434578.1| hypothetical protein CICLE_v10002209mg [Citrus clementina]
 gb|ESR47818.1| hypothetical protein CICLE_v10002209mg [Citrus clementina]
Length=259

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevrIFATTQGPKPPPRQTAPP  289
            MAST +PQS +S+  + +   L+Q     R        + +R+FA+ +      ++ A P
Sbjct  3    MASTVSPQSPYSLFLKTQHGSLQQLTKEPRAATARTRSKILRVFASQKAGSNKSQRRAQP  62

Query  290  GVDTRIHWENEDEGWIGGssssssTQEQQLKADENE--LLGDKFSEVLNSSTDSHYQFLG  463
            GVDTRIHWENEDEGWIGGSSSSS    Q   A+E +  LLG+KF+++L++S+DSHYQFLG
Sbjct  63   GVDTRIHWENEDEGWIGGSSSSSHQTNQNFNAEEEQKNLLGEKFADLLDNSSDSHYQFLG  122

Query  464  VGADADVEE  490
            +   AD+EE
Sbjct  123  ISPSADLEE  131



>gb|KHG19820.1| Triose phosphate/phosphate translocator, chloroplastic [Gossypium 
arboreum]
Length=685

 Score =   105 bits (261),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 51/86 (59%), Positives = 66/86 (77%), Gaps = 3/86 (3%)
 Frame = +2

Query  236  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQ-QLKADENELLGDK  412
            +FA T GP  P R   PPGVDTRIHW+NEDEGWIG SS+S  T+E+   + ++  LLG+K
Sbjct  474  VFAATTGPSKPQR--PPPGVDTRIHWDNEDEGWIGESSNSRQTKEKLNPEEEQKSLLGEK  531

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F++ LN S+DSHYQFLGV A+AD+E+
Sbjct  532  FADFLNDSSDSHYQFLGVSAEADLED  557



>ref|XP_010246036.1| PREDICTED: uncharacterized protein LOC104589413 [Nelumbo nucifera]
Length=245

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 11/128 (9%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevrIFATTQGPKPPPRQTAPP  289
            MAST AP +  S+L   R+   R   A          RR  R+FA+     P  R+ APP
Sbjct  1    MASTAAPPTL-SLLFGSRKGGNRSEEA------HGRSRRNCRVFASEN---PDRRKRAPP  50

Query  290  GVDTRIHWENEDEGWIGGsssss-sTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGV  466
            GVDTRIHW+N DEGWIGGS+SSS +++   ++ ++  LLG+KFS++LN+S+DSHYQFLGV
Sbjct  51   GVDTRIHWDNPDEGWIGGSTSSSQASRRLNVEEEQRNLLGEKFSDLLNTSSDSHYQFLGV  110

Query  467  GADADVEE  490
              DAD+EE
Sbjct  111  AVDADMEE  118



>ref|XP_010064575.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Eucalyptus 
grandis]
 gb|KCW87888.1| hypothetical protein EUGRSUZ_A00280 [Eucalyptus grandis]
Length=261

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 6/86 (7%)
 Frame = +2

Query  242  ATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQ-EQQLKADENE--LLGDK  412
            + TQGP+ P     PPGVDTRIHWENEDEGWIGG   S S +  +QL A+E +  LLG+K
Sbjct  51   SATQGPQEP---RPPPGVDTRIHWENEDEGWIGGGDGSRSEEGGKQLGAEEEQRNLLGEK  107

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F+++LN S DSHYQFLG+ A+AD+EE
Sbjct  108  FADLLNESADSHYQFLGISANADLEE  133



>ref|XP_009362458.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Pyrus x bretschneideri]
 ref|XP_009373252.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Pyrus x bretschneideri]
Length=257

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 5/84 (6%)
 Frame = +2

Query  248  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENE--LLGDKFSE  421
            +QGP    R+ APPGVDTRIHWEN+DEGWIGGSSS     EQ+ ++++ +  LLGDKF++
Sbjct  48   SQGPSN--RERAPPGVDTRIHWENDDEGWIGGSSSRKEQAEQEPESEQQKSNLLGDKFAD  105

Query  422  VLNSS-TDSHYQFLGVGADADVEE  490
            +LN S +DSHYQFLGV A+AD+EE
Sbjct  106  LLNDSISDSHYQFLGVPAEADLEE  129



>ref|XP_008339223.1| PREDICTED: dnaJ homolog subfamily B member 14 isoform X2 [Malus 
domestica]
Length=260

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 9/88 (10%)
 Frame = +2

Query  248  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssT------QEQQLKADENELLGD  409
            +QGP    R+ APPGVDTRIHWEN+DEGWIGGSSS           EQQ    ++ LLGD
Sbjct  47   SQGPSB--RERAPPGVDTRIHWENDDEGWIGGSSSRKEQAEQEPESEQQKSQRQSNLLGD  104

Query  410  KFSEVLNSS-TDSHYQFLGVGADADVEE  490
            KF+++LN S +DSHYQFLGV A+AD+EE
Sbjct  105  KFADLLNDSISDSHYQFLGVSAEADLEE  132



>ref|XP_008339222.1| PREDICTED: dnaJ homolog subfamily C member 14 isoform X1 [Malus 
domestica]
Length=276

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 7/83 (8%)
 Frame = +2

Query  263  PPPRQTAPPGVDTRIHWENEDEGWIGGssssssT------QEQQLKADENELLGDKFSEV  424
            P  R+ APPGVDTRIHWEN+DEGWIGGSSS           EQQ    ++ LLGDKF+++
Sbjct  66   PSBRERAPPGVDTRIHWENDDEGWIGGSSSRKEQAEQEPESEQQKSQRQSNLLGDKFADL  125

Query  425  LNSS-TDSHYQFLGVGADADVEE  490
            LN S +DSHYQFLGV A+AD+EE
Sbjct  126  LNDSISDSHYQFLGVSAEADLEE  148



>ref|XP_010045171.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Eucalyptus 
grandis]
 gb|KCW87708.1| hypothetical protein EUGRSUZ_A00085 [Eucalyptus grandis]
Length=262

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 6/86 (7%)
 Frame = +2

Query  242  ATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQ-EQQLKADENE--LLGDK  412
            + TQGP+    +  PPGVDTRIHWENEDEGWIGG   S S +  +QL A+E +  LLG+K
Sbjct  52   SATQGPQ---ERRPPPGVDTRIHWENEDEGWIGGGDGSRSEEGGKQLGAEEEQRNLLGEK  108

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F+++LN S DSHYQFLG+ A+AD+EE
Sbjct  109  FADLLNESADSHYQFLGISANADLEE  134



>gb|KDP34831.1| hypothetical protein JCGZ_11193 [Jatropha curcas]
Length=263

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 65/90 (72%), Gaps = 7/90 (8%)
 Frame = +2

Query  236  IFATTQGPKP-PPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQL----KADENEL  400
            + A TQ P+    RQ A PGVDTRIHWENE+EGWIGG  SS+ST +++L    +     L
Sbjct  49   VLAETQEPQSQSKRQRATPGVDTRIHWENEEEGWIGG--SSNSTSQKRLEEEEEEQRKSL  106

Query  401  LGDKFSEVLNSSTDSHYQFLGVGADADVEE  490
            LGDKF+++LN ++ SHYQFLG+  DAD+EE
Sbjct  107  LGDKFADLLNDTSGSHYQFLGISVDADIEE  136



>ref|XP_010104484.1| Chaperone protein DnaJ [Morus notabilis]
 gb|EXC01085.1| Chaperone protein DnaJ [Morus notabilis]
Length=252

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  236  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKF  415
            +     G  P  R+ +PPGVDTRIHW+NEDEGW+GGSSSSS++   Q   D+  LLG+KF
Sbjct  40   LVRAVSGEGPRKRERSPPGVDTRIHWDNEDEGWVGGSSSSSTSTSGQAHDDQKNLLGEKF  99

Query  416  SEVLNSSTDSHYQFLGVGADADVEE  490
            +++LN S DSHYQFLGV  +AD+EE
Sbjct  100  ADLLNQSADSHYQFLGVSVEADLEE  124



>ref|XP_007223682.1| hypothetical protein PRUPE_ppa010245mg [Prunus persica]
 gb|EMJ24881.1| hypothetical protein PRUPE_ppa010245mg [Prunus persica]
Length=257

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 6/87 (7%)
 Frame = +2

Query  242  ATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQ---EQQLKADENELLGDK  412
            + +QGP    R  APPGVDTRIHWENEDEGWIGGSS++SS++    Q  +  ++ LL DK
Sbjct  45   SASQGPSKSER--APPGVDTRIHWENEDEGWIGGSSATSSSKAQQAQAEQEQQSNLLEDK  102

Query  413  FSEVLNSS-TDSHYQFLGVGADADVEE  490
            F+++LN S +DSHYQFLGV A+AD+EE
Sbjct  103  FADLLNDSISDSHYQFLGVSAEADLEE  129



>ref|XP_010530162.1| PREDICTED: dnaJ homolog subfamily B member 14 [Tarenaya hassleriana]
Length=253

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +2

Query  263  PPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLG-DKFSEVLNSST  439
            P  RQ APPGVDTRIHW+N D+GWIGG   + S  E     D+  L G DKFS++L  S+
Sbjct  54   PTERQRAPPGVDTRIHWDNPDDGWIGGPDPTKSEVE-----DKTTLFGDDKFSDLLMESS  108

Query  440  DSHYQFLGVGADADVEE  490
            DSHYQFLGV ADAD+EE
Sbjct  109  DSHYQFLGVNADADIEE  125



>ref|XP_008462782.1| PREDICTED: dnaJ homolog subfamily B member 12 [Cucumis melo]
Length=234

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +2

Query  272  RQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHY  451
            R+  PPGVDTRIHW+NE+EGWIGG    S+ Q  +     N +LG   +++LN+S+DSHY
Sbjct  38   RRRPPPGVDTRIHWQNEEEGWIGGKKKESNDQNNE----SNNMLGPSLADLLNNSSDSHY  93

Query  452  QFLGVGADADVEE  490
            QFLGVGA+A+VEE
Sbjct  94   QFLGVGAEAEVEE  106



>ref|XP_002272533.1| PREDICTED: uncharacterized protein LOC100252905 [Vitis vinifera]
 emb|CAN75474.1| hypothetical protein VITISV_002798 [Vitis vinifera]
 emb|CBI18515.3| unnamed protein product [Vitis vinifera]
Length=253

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 6/129 (5%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRCRRT--ELRQSPAVErrrrpygcrrevrIFATTQGPKPPPRQTA  283
            MAST AP   FS+L + + T  +LR      RRRR    +    I A  Q  K P RQ A
Sbjct  1    MASTAAPPPSFSLLLKTQNTTNQLRSVTPSRRRRRSSSSQGGFWILAAAQDSKNP-RQRA  59

Query  284  PPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLG  463
            PPGVDTRIHW+N DEGWIGGSSS      ++   +E  LLG++FS++L+ S+DSHYQFLG
Sbjct  60   PPGVDTRIHWDNPDEGWIGGSSSKPKLNGEE---EEKNLLGEEFSDLLDDSSDSHYQFLG  116

Query  464  VGADADVEE  490
            + A AD+EE
Sbjct  117  ISAQADLEE  125



>ref|XP_008219027.1| PREDICTED: dnaJ homolog subfamily B member 14 [Prunus mume]
Length=254

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 6/87 (7%)
 Frame = +2

Query  242  ATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGG---ssssssTQEQQLKADENELLGDK  412
            + +QGP    R  APPGVDTRIHWENEDEGWIGG   SSSS + Q +  +  ++ LL DK
Sbjct  42   SASQGPSKHER--APPGVDTRIHWENEDEGWIGGSSASSSSKAQQARAEQEQQSNLLEDK  99

Query  413  FSEVLNSS-TDSHYQFLGVGADADVEE  490
            F+++LN S +DSHYQFLGV A+AD+EE
Sbjct  100  FADLLNDSISDSHYQFLGVSAEADLEE  126



>ref|XP_010421846.1| PREDICTED: dnaJ homolog subfamily B member 12 [Camelina sativa]
Length=249

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 8/86 (9%)
 Frame = +2

Query  236  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGD-K  412
            I+A+ QGP  PP+ +  PGVDTRIHWE+ DEGWIGG S+S+ + E+    D+  L  D K
Sbjct  43   IYAS-QGPTKPPKPS--PGVDTRIHWESLDEGWIGGGSNSTKSVEE----DKTNLFSDEK  95

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F+E++  S DSHYQFLGV  DAD+EE
Sbjct  96   FAELIKDSFDSHYQFLGVSTDADLEE  121



>emb|CDP03536.1| unnamed protein product [Coffea canephora]
Length=256

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = +2

Query  263  PPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTD  442
            P  R+ APPGVDTRIHWENEDEGWIGG   S  TQE QLK D+N LLG  FS++LNSS+D
Sbjct  58   PNQRRRAPPGVDTRIHWENEDEGWIGG-PKSQPTQE-QLKTDQN-LLGQNFSDLLNSSSD  114

Query  443  SHYQFLGVGADADVEE  490
            SHYQFLGV A+AD+EE
Sbjct  115  SHYQFLGVSAEADMEE  130



>ref|XP_003539686.1| PREDICTED: uncharacterized protein LOC100819309 [Glycine max]
 gb|KHN32476.1| Chaperone protein DnaJ [Glycine soja]
Length=252

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +2

Query  281  APPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFL  460
            APPGVDTRIHWENEDEGWIGG    ++T+ QQ     N L  D F ++L++S  SHY+FL
Sbjct  58   APPGVDTRIHWENEDEGWIGG----TNTKHQQTHKPNNMLQADDFPDLLSASLGSHYEFL  113

Query  461  GVGADADVEE  490
            GV  DAD+EE
Sbjct  114  GVSPDADLEE  123



>ref|XP_004299890.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit T, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=259

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 5/77 (6%)
 Frame = +2

Query  260  KPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSST  439
            +PPP     PG+DTRIHWENEDEGWIGG +SS  TQ+Q  +  + ++ G+KF+++L+ S 
Sbjct  60   RPPP----APGIDTRIHWENEDEGWIGG-TSSKKTQQQVEQEQQKDVWGNKFADLLDDSA  114

Query  440  DSHYQFLGVGADADVEE  490
            DSHYQFLGV A+AD+EE
Sbjct  115  DSHYQFLGVSAEADLEE  131



>ref|XP_002874566.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH50825.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=247

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 7/82 (9%)
 Frame = +2

Query  248  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGD-KFSEV  424
            +QGP  PP+ +  PGVDTRIHWE+ DEGWIGG S  + + ++    D+  LL D KF+E+
Sbjct  44   SQGPTKPPKPS--PGVDTRIHWESPDEGWIGGRSDPTKSVDE----DKTNLLSDEKFAEL  97

Query  425  LNSSTDSHYQFLGVGADADVEE  490
            +  S DSHYQFLGV  DAD+EE
Sbjct  98   IKDSFDSHYQFLGVSTDADLEE  119



>ref|XP_010455337.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Camelina 
sativa]
Length=265

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 8/86 (9%)
 Frame = +2

Query  236  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGD-K  412
            I+A+ QGP  PP+ +   GVDTRIHWE+ DEGWIGG S+S+ + E+    D+  LL D K
Sbjct  59   IYAS-QGPTKPPKPSH--GVDTRIHWESPDEGWIGGGSNSTKSVEE----DKTNLLSDEK  111

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F+E++  S DSHYQFLGV  DAD+EE
Sbjct  112  FAELIKDSFDSHYQFLGVSTDADLEE  137



>gb|KFK32077.1| hypothetical protein AALP_AA6G196600 [Arabis alpina]
Length=251

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 57/82 (70%), Gaps = 7/82 (9%)
 Frame = +2

Query  248  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLG-DKFSEV  424
            +QGP  PP+ +  PGVDTRIHWEN DEGWIGG S  + + ++    D+  L   DKF+E+
Sbjct  48   SQGPTKPPKPS--PGVDTRIHWENPDEGWIGGGSDPTKSVDE----DKTNLFSEDKFAEL  101

Query  425  LNSSTDSHYQFLGVGADADVEE  490
            +  S DSHYQFLGV  DAD+E+
Sbjct  102  IKDSFDSHYQFLGVSTDADLED  123



>ref|XP_010435793.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Camelina 
sativa]
Length=249

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 8/86 (9%)
 Frame = +2

Query  236  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGD-K  412
            I+A+ Q P  PP+ +  PGVDTRIHWE+ DEGWIGG     S Q + ++ D+  L  D K
Sbjct  43   IYAS-QDPTKPPKPS--PGVDTRIHWESPDEGWIGG----GSNQTKSVEEDKTNLFSDEK  95

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F+E++  S DSHYQFLGV  DAD+EE
Sbjct  96   FAELIKDSFDSHYQFLGVSTDADLEE  121



>ref|XP_006397191.1| hypothetical protein EUTSA_v10028742mg [Eutrema salsugineum]
 gb|ESQ38644.1| hypothetical protein EUTSA_v10028742mg [Eutrema salsugineum]
Length=372

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 5/82 (6%)
 Frame = +2

Query  245  TTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEV  424
            +++GP  PP+ +  PGVDTRIHWEN DEGWIGG S  + + +++     N    DKF+E+
Sbjct  168  SSRGPTKPPKPS--PGVDTRIHWENPDEGWIGGGSDPTKSVDEE---RNNLFSDDKFAEL  222

Query  425  LNSSTDSHYQFLGVGADADVEE  490
            +  S DSHYQFLGV  DAD+EE
Sbjct  223  IKDSFDSHYQFLGVSTDADLEE  244



>ref|NP_192673.1| NADH dehydrogenase-like complex T [Arabidopsis thaliana]
 sp|Q9SMS0.1|NDHT_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit T, chloroplastic; 
AltName: Full=DNA J PROTEIN C75; AltName: Full=NAD(P)H 
dehydrogenase subunit T; Short=NDH subunit T; AltName: 
Full=NADH-plastoquinone oxidoreductase subunit T; AltName: Full=Protein 
CHLORORESPIRATORY REDUCTION J; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB55698.1| putative protein [Arabidopsis thaliana]
 emb|CAB78058.1| putative protein [Arabidopsis thaliana]
 gb|AEE82744.1| NADH dehydrogenase-like complex T [Arabidopsis thaliana]
Length=249

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 60/86 (70%), Gaps = 8/86 (9%)
 Frame = +2

Query  236  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGD-K  412
            I+A+ QGP  P + +  PGVDTRIHWE+ DEGWIGG S  + + ++    D+  LL D K
Sbjct  43   IYAS-QGPTKPSKPS--PGVDTRIHWESPDEGWIGGRSDPAKSVDE----DKTNLLSDEK  95

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F+E++  S DSHYQFLGV  DAD+EE
Sbjct  96   FAELIKDSFDSHYQFLGVSTDADLEE  121



>gb|AFK34686.1| unknown [Medicago truncatula]
Length=247

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 13/82 (16%)
 Frame = +2

Query  248  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADE--NELLGDKFSE  421
            +QGP     Q APPG+DTRIHWEN+DEGWIGG     ST++QQ  A+E   +LLG+ F++
Sbjct  50   SQGP-----QKAPPGIDTRIHWENDDEGWIGG-----STKQQQTNAEEKPKKLLGEDFAD  99

Query  422  VLNSSTDSHYQFLGVGADADVE  487
            +LN    SHY+FLG+  +ADVE
Sbjct  100  LLNFQ-GSHYEFLGISPEADVE  120



>gb|KEH29266.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=269

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 13/82 (16%)
 Frame = +2

Query  248  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADE--NELLGDKFSE  421
            +QGP     Q APPG+DTRIHWEN+DEGWIGG     ST++QQ  A+E   +LLG+ F++
Sbjct  72   SQGP-----QKAPPGIDTRIHWENDDEGWIGG-----STKQQQTNAEEKPKKLLGEDFAD  121

Query  422  VLNSSTDSHYQFLGVGADADVE  487
            +LN    SHY+FLG+  +ADVE
Sbjct  122  LLNFQ-GSHYEFLGISPEADVE  142



>ref|XP_004137622.1| PREDICTED: uncharacterized protein LOC101208302 [Cucumis sativus]
 ref|XP_004161851.1| PREDICTED: uncharacterized LOC101208302 [Cucumis sativus]
 gb|KGN64159.1| hypothetical protein Csa_1G042670 [Cucumis sativus]
Length=234

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  272  RQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHY  451
            R+  PPGVDTRIHW+NE+EGWIG     S+ Q        N +LG   +++LN+S+DSHY
Sbjct  38   RRRPPPGVDTRIHWQNEEEGWIGRKKKESNDQNNV----SNNMLGPSLADLLNNSSDSHY  93

Query  452  QFLGVGADADVEE  490
            QFLGV A+A+VEE
Sbjct  94   QFLGVDAEAEVEE  106



>ref|XP_004506395.1| PREDICTED: uncharacterized protein LOC101493556 [Cicer arietinum]
Length=271

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +2

Query  275  QTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADE-NELLGDKFSEVLNSSTDSHY  451
            Q APPGVDTRIHWENEDEGW+GGS+ SS  ++Q    ++ N+LLG+ F ++L S   SHY
Sbjct  72   QRAPPGVDTRIHWENEDEGWVGGSTKSSEKKKQTNSEEKPNKLLGEDFGDLL-SFEGSHY  130

Query  452  QFLGVGADADVEE  490
            +FLGV  +AD+EE
Sbjct  131  EFLGVSPEADLEE  143



>ref|XP_009113533.1| PREDICTED: uncharacterized protein LOC103838834 [Brassica rapa]
 emb|CDY48053.1| BnaA09g23050D [Brassica napus]
Length=243

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 52/86 (60%), Gaps = 13/86 (15%)
 Frame = +2

Query  236  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLG-DK  412
            +   +QGP  P      PGVDTRIHWEN D+GWIGG           +K D+  L   DK
Sbjct  42   LIHASQGPTKPL-----PGVDTRIHWENPDDGWIGGG-------SDTIKPDDTNLFSDDK  89

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F+E++  S DSHYQFLGV  DAD+E+
Sbjct  90   FAELIKDSFDSHYQFLGVSTDADLED  115



>emb|CDX75107.1| BnaC09g25750D [Brassica napus]
Length=243

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 52/86 (60%), Gaps = 13/86 (15%)
 Frame = +2

Query  236  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLG-DK  412
            +   +QGP  P      PGVDTRIHWEN D+GWIGG           +K D+  L   DK
Sbjct  42   LIHASQGPTKPL-----PGVDTRIHWENPDDGWIGGG-------SDPIKPDDTNLFSDDK  89

Query  413  FSEVLNSSTDSHYQFLGVGADADVEE  490
            F+E++  S DSHYQFLGV  DAD+E+
Sbjct  90   FAELIKDSFDSHYQFLGVSTDADLED  115



>gb|EYU46716.1| hypothetical protein MIMGU_mgv1a012583mg [Erythranthe guttata]
Length=246

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 59/73 (81%), Gaps = 6/73 (8%)
 Frame = +2

Query  272  RQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHY  451
            RQ A PG DTRIHWEN+DEGWIGG      T ++++K DE++  GDKFS++LNSS+DSHY
Sbjct  53   RQPASPGFDTRIHWENDDEGWIGGK-----TSQEKVK-DESDFTGDKFSDLLNSSSDSHY  106

Query  452  QFLGVGADADVEE  490
            QFLGV ++AD+EE
Sbjct  107  QFLGVSSNADLEE  119



>ref|NP_001148857.1| LOC100282476 [Zea mays]
 gb|ACG33162.1| heat shock protein binding protein [Zea mays]
 gb|AFW60589.1| heat shock protein binding protein [Zea mays]
Length=253

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 71/129 (55%), Gaps = 13/129 (10%)
 Frame = +2

Query  104  IPMASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevrIFATTQGPKPPPRQTA  283
             PMA++TA + F   L R +R    ++ AV                AT  G  P  ++T 
Sbjct  11   FPMAASTASRIFTPFLHRHQR----RTKAVVVAAASPPDAEPTP--ATADGAGPGKKKT-  63

Query  284  PPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLG  463
               VDTRIHW N DEGW+GG +     +     + +NE LG +F++++N++ +SHYQFLG
Sbjct  64   ---VDTRIHWSNPDEGWVGGKAKK---EGDGRGSSKNEPLGGRFADLINNAAESHYQFLG  117

Query  464  VGADADVEE  490
            +  +AD+EE
Sbjct  118  IAPEADIEE  126



>ref|XP_002533580.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28798.1| conserved hypothetical protein [Ricinus communis]
Length=120

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 77/123 (63%), Gaps = 11/123 (9%)
 Frame = +2

Query  110  MASTTAPQSFFSILQRCRRT-------ELRQSPAVErrrrpygcrrevrIFATTQGPKPP  268
            MASTT+PQ+ +S+L R R +       +L    A+  R +         + A  QGP+  
Sbjct  1    MASTTSPQASYSLLFRSRSSIHSSKEHQLIVRGAI-TRSKKNNGGSSFLVLAAAQGPEKK  59

Query  269  PRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENE-LLGDKFSEVLNSSTDS  445
             R  APPGVDTRIHW+N DEGWIGGSSSSSS+Q+Q  + +E + L G  F+++LN ++ S
Sbjct  60   ER--APPGVDTRIHWDNPDEGWIGGSSSSSSSQQQLNEEEEQKNLFGQNFADLLNDASGS  117

Query  446  HYQ  454
            HYQ
Sbjct  118  HYQ  120



>ref|XP_006288529.1| hypothetical protein CARUB_v10001800mg [Capsella rubella]
 gb|EOA21427.1| hypothetical protein CARUB_v10001800mg [Capsella rubella]
Length=250

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 5/68 (7%)
 Frame = +2

Query  290  GVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGD-KFSEVLNSSTDSHYQFLGV  466
            GVDTRIHWE+ DEGWIGG S+S+ + E     D+  L  D KF+E++  S DSHYQFLGV
Sbjct  59   GVDTRIHWESPDEGWIGGGSNSTKSVED----DKTNLFSDEKFAELIKDSFDSHYQFLGV  114

Query  467  GADADVEE  490
             +DAD+EE
Sbjct  115  SSDADLEE  122



>ref|XP_008786523.1| PREDICTED: dnaJ homolog subfamily C member 24 isoform X1 [Phoenix 
dactylifera]
Length=236

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHW N DEGWIGG ++ ++  E++      E+LG++F+E+++ S  SHYQFLGV A
Sbjct  49   VDTRIHWSNPDEGWIGGKTTPTTQSEKK-----EEILGERFAELIDKSAASHYQFLGVSA  103

Query  473  DADVEE  490
            +AD+EE
Sbjct  104  EADMEE  109



>ref|XP_008786524.1| PREDICTED: dnaJ homolog subfamily C member 24 isoform X2 [Phoenix 
dactylifera]
Length=210

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHW N DEGWIGG ++ ++  E++      E+LG++F+E+++ S  SHYQFLGV A
Sbjct  23   VDTRIHWSNPDEGWIGGKTTPTTQSEKK-----EEILGERFAELIDKSAASHYQFLGVSA  77

Query  473  DADVEE  490
            +AD+EE
Sbjct  78   EADMEE  83



>ref|XP_007131284.1| hypothetical protein PHAVU_011G001000g [Phaseolus vulgaris]
 gb|ESW03278.1| hypothetical protein PHAVU_011G001000g [Phaseolus vulgaris]
Length=245

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +2

Query  248  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVL  427
             Q  + PPR  APPGVDTRIHW+NEDEGWIGG      T+   + AD+     D    +L
Sbjct  43   VQSSRGPPR--APPGVDTRIHWDNEDEGWIGGGDRDKKTKSSNMFADD-----DFSDLLL  95

Query  428  NSSTDSHYQFLGVGADADVEE  490
             SS  SHY+FLGV  DAD+EE
Sbjct  96   TSSLSSHYEFLGVSPDADLEE  116



>ref|XP_010930616.1| PREDICTED: uncharacterized protein LOC105051729 [Elaeis guineensis]
Length=236

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHW N DEGWIGG ++  +  E++      E+LG +F+E+++ S  SHYQFLGV A
Sbjct  49   VDTRIHWSNPDEGWIGGKTTPKTESEKK-----EEILGGRFAELIDKSAASHYQFLGVSA  103

Query  473  DADVEE  490
             AD+EE
Sbjct  104  KADMEE  109



>ref|XP_003531831.1| PREDICTED: dnaJ homolog subfamily C member 14-like [Glycine max]
Length=246

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHWENEDEGWIG    +++  +Q  K + N L  D F + L +S  SHY+FLGV  
Sbjct  55   VDTRIHWENEDEGWIGA---TNTKHQQTHKPNNNMLQADDFPDFLTASLGSHYEFLGVSP  111

Query  473  DADVEE  490
            DADVEE
Sbjct  112  DADVEE  117



>gb|ACU17982.1| unknown [Glycine max]
Length=196

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHWENEDEGWIG +++     +Q  K + N L  D F + L +S  SHY+FLGV  
Sbjct  43   VDTRIHWENEDEGWIGATNTK---HQQTHKPNNNMLRADDFPDFLTASLGSHYEFLGVSP  99

Query  473  DADVEE  490
            DADVEE
Sbjct  100  DADVEE  105



>gb|KHM98836.1| Chaperone protein DnaJ [Glycine soja]
Length=234

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHWENEDEGWIG    +++  +Q  K + N L  D F + L +S  SHY+FLGV  
Sbjct  43   VDTRIHWENEDEGWIGA---TNTKHQQTHKPNNNMLQADDFPDFLTASLGSHYEFLGVSP  99

Query  473  DADVEE  490
            DADVEE
Sbjct  100  DADVEE  105



>ref|XP_009406485.1| PREDICTED: dnaJ homolog subfamily B member 14 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 5/66 (8%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHW + DEGW+GG      T+     +++ E LG++F++++N ST SHYQFLGV A
Sbjct  91   VDTRIHWSSPDEGWVGGK-----TKPDTGASEKKEYLGERFADLINKSTASHYQFLGVSA  145

Query  473  DADVEE  490
            +AD+EE
Sbjct  146  EADMEE  151



>ref|XP_002449374.1| hypothetical protein SORBIDRAFT_05g008750 [Sorghum bicolor]
 gb|EES08362.1| hypothetical protein SORBIDRAFT_05g008750 [Sorghum bicolor]
Length=246

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHW N DEGW+GG++             +NE LG +F++++N++++SHYQFLG+  
Sbjct  56   VDTRIHWSNPDEGWVGGNAKKEGGGSGG--GSKNEPLGGRFADLINNASESHYQFLGIAP  113

Query  473  DADVEE  490
            +AD+EE
Sbjct  114  EADIEE  119



>ref|XP_003577706.1| PREDICTED: dnaJ homolog subfamily A member 3, mitochondrial [Brachypodium 
distachyon]
Length=242

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 5/66 (8%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHW N DEGWIGG        ++     +NE LG +F++++N   +SHYQFLG+  
Sbjct  55   VDTRIHWSNPDEGWIGGKDI-----KEGESGSKNEPLGRRFADLINDPAESHYQFLGIAP  109

Query  473  DADVEE  490
            +AD+EE
Sbjct  110  EADIEE  115



>ref|XP_004979103.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Setaria italica]
Length=241

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +2

Query  275  QTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQ  454
            Q     VDTRIHW + DEGW+GG +      +   +  +NE LG +F++++N++++SHYQ
Sbjct  45   QGKKKTVDTRIHWSDPDEGWVGGKAKKEGDGDG--RRGKNEPLGGRFADLINAASESHYQ  102

Query  455  FLGVGADADVEE  490
            FLG+  +AD+EE
Sbjct  103  FLGIAPEADLEE  114



>ref|XP_006858482.1| hypothetical protein AMTR_s00071p00121290 [Amborella trichopoda]
 gb|ERN19949.1| hypothetical protein AMTR_s00071p00121290 [Amborella trichopoda]
Length=237

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 9/77 (12%)
 Frame = +2

Query  260  KPPPRQTAPPGVDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSST  439
            K   ++   PG+DTRIHW++ DEGWIGG   S   +E+Q      E   +KFS++++  T
Sbjct  43   KTAKKKNRNPGMDTRIHWDSPDEGWIGG--KSRRIEEKQ------ESFSEKFSDLID-RT  93

Query  440  DSHYQFLGVGADADVEE  490
            DSHYQFLG+  +AD EE
Sbjct  94   DSHYQFLGIPPEADQEE  110



>ref|NP_001067508.1| Os11g0216100 [Oryza sativa Japonica Group]
 gb|ABA92060.1| DNAJ heat shock N-terminal domain-containing protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF27871.1| Os11g0216100 [Oryza sativa Japonica Group]
 dbj|BAG86910.1| unnamed protein product [Oryza sativa Japonica Group]
Length=251

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 6/66 (9%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHW + DEGW+GG        ++     + E LG +F++++N+ ++SHYQFLGV  
Sbjct  65   VDTRIHWSDPDEGWVGG------NAKKDGGGRKKEPLGGRFADLINNPSESHYQFLGVEP  118

Query  473  DADVEE  490
             AD+EE
Sbjct  119  KADIEE  124



>ref|XP_006663300.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Oryza brachyantha]
Length=253

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHW + DEGW+GG++          +  E    G +F++++N+ ++SHYQFLGV A
Sbjct  63   VDTRIHWSDPDEGWVGGNAKKGGGDGGGGRKKEP--FGARFADLINNPSESHYQFLGVEA  120

Query  473  DADVEE  490
             AD+EE
Sbjct  121  KADIEE  126



>ref|XP_001768838.1| predicted protein [Physcomitrella patens]
 gb|EDQ66391.1| predicted protein [Physcomitrella patens]
Length=368

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = +2

Query  293  VDTRIHWENEDEGWIGGssssssTQEQQLKADENELLGDKFSEVLNSSTDSHYQFLGVGA  472
            VDTRIHW +  EGWIG      ++ + +         G   S +L+ ++DSHY+++G+ +
Sbjct  178  VDTRIHWGDSAEGWIGIDCDDETSSQFRSWGRR----GRSNSSLLDQASDSHYRYMGLSS  233

Query  473  DADVEE  490
            DA++EE
Sbjct  234  DAELEE  239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370