BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF006A15

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011078818.1|  PREDICTED: protein trichome birefringence-like   85.1    8e-16   Sesamum indicum [beniseed]
ref|XP_009783309.1|  PREDICTED: protein trichome birefringence-like   80.9    2e-14   Nicotiana sylvestris
ref|XP_009604045.1|  PREDICTED: protein trichome birefringence-like   80.9    2e-14   Nicotiana tomentosiformis
ref|XP_006362212.1|  PREDICTED: uncharacterized protein LOC102599885  80.9    3e-14   Solanum tuberosum [potatoes]
ref|XP_009757308.1|  PREDICTED: protein trichome birefringence-like   77.8    3e-13   Nicotiana sylvestris
ref|XP_006351351.1|  PREDICTED: uncharacterized protein LOC102598...  77.4    4e-13   Solanum tuberosum [potatoes]
ref|XP_006351352.1|  PREDICTED: uncharacterized protein LOC102598...  77.0    5e-13   Solanum tuberosum [potatoes]
ref|XP_009611858.1|  PREDICTED: protein trichome birefringence-like   76.6    7e-13   Nicotiana tomentosiformis
ref|XP_004249181.1|  PREDICTED: protein trichome birefringence        75.9    1e-12   Solanum lycopersicum
ref|XP_004249290.1|  PREDICTED: protein trichome birefringence-like   72.8    1e-11   Solanum lycopersicum
emb|CDP10159.1|  unnamed protein product                              70.5    7e-11   Coffea canephora [robusta coffee]
ref|XP_011075105.1|  PREDICTED: protein trichome birefringence-like   69.3    2e-10   Sesamum indicum [beniseed]
ref|XP_004493599.1|  PREDICTED: uncharacterized protein LOC101511851  69.3    2e-10   Cicer arietinum [garbanzo]
ref|XP_003553434.1|  PREDICTED: protein YLS7-like                     69.3    2e-10   Glycine max [soybeans]
ref|XP_007162340.1|  hypothetical protein PHAVU_001G143600g           69.3    2e-10   Phaseolus vulgaris [French bean]
ref|XP_002534536.1|  conserved hypothetical protein                   65.1    4e-09   Ricinus communis
ref|XP_004303340.1|  PREDICTED: protein trichome birefringence-like   64.7    6e-09   Fragaria vesca subsp. vesca
ref|XP_009369426.1|  PREDICTED: protein trichome birefringence        63.9    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_007204224.1|  hypothetical protein PRUPE_ppa002919mg           63.5    1e-08   Prunus persica
ref|XP_002280022.1|  PREDICTED: protein trichome birefringence        62.8    2e-08   Vitis vinifera
ref|XP_008240911.1|  PREDICTED: protein trichome birefringence        62.0    4e-08   Prunus mume [ume]
ref|XP_007029023.1|  Emb:CAB82953.1, putative                         62.0    4e-08   
ref|XP_008387218.1|  PREDICTED: protein trichome birefringence-like   61.2    7e-08   
ref|XP_008443032.1|  PREDICTED: protein trichome birefringence        60.5    1e-07   Cucumis melo [Oriental melon]
ref|XP_004161492.1|  PREDICTED: uncharacterized protein LOC101228487  60.1    2e-07   
ref|XP_004136561.1|  PREDICTED: uncharacterized protein LOC101220024  60.1    2e-07   Cucumis sativus [cucumbers]
ref|XP_003520540.1|  PREDICTED: protein YLS7-like                     59.3    3e-07   Glycine max [soybeans]
ref|XP_010672635.1|  PREDICTED: protein trichome birefringence-li...  59.3    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002308359.2|  hypothetical protein POPTR_0006s20840g           58.9    4e-07   
ref|XP_004497886.1|  PREDICTED: uncharacterized protein LOC101512080  58.5    5e-07   Cicer arietinum [garbanzo]
gb|KJB16333.1|  hypothetical protein B456_002G223800                  58.5    5e-07   Gossypium raimondii
gb|KJB76673.1|  hypothetical protein B456_012G100000                  57.4    1e-06   Gossypium raimondii
ref|XP_003535115.1|  PREDICTED: protein YLS7-like                     56.6    3e-06   Glycine max [soybeans]
ref|XP_006399144.1|  hypothetical protein EUTSA_v10012993mg           56.6    3e-06   Eutrema salsugineum [saltwater cress]
gb|KJB76674.1|  hypothetical protein B456_012G100000                  55.5    5e-06   Gossypium raimondii
gb|KJB76676.1|  hypothetical protein B456_012G100000                  55.5    6e-06   Gossypium raimondii
ref|XP_002323329.2|  hypothetical protein POPTR_0016s05930g           54.7    1e-05   
ref|XP_006399143.1|  hypothetical protein EUTSA_v10012993mg           53.5    2e-05   
ref|XP_011039468.1|  PREDICTED: protein trichome birefringence-like   53.5    2e-05   Populus euphratica
ref|XP_011005287.1|  PREDICTED: protein trichome birefringence-like   53.5    2e-05   Populus euphratica
ref|XP_007145701.1|  hypothetical protein PHAVU_007G261000g           51.2    1e-04   Phaseolus vulgaris [French bean]
ref|XP_010557950.1|  PREDICTED: protein trichome birefringence-like   50.1    3e-04   Tarenaya hassleriana [spider flower]
ref|XP_003625280.1|  hypothetical protein MTR_7g093450                50.1    3e-04   Medicago truncatula
ref|XP_006287297.1|  hypothetical protein CARUB_v10000490mg           49.3    5e-04   Capsella rubella
ref|XP_009125778.1|  PREDICTED: protein trichome birefringence-like   48.5    0.001   Brassica rapa



>ref|XP_011078818.1| PREDICTED: protein trichome birefringence-like [Sesamum indicum]
Length=634

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MAD AKYAPINGG L+S+ K HFS  +T+RT    YA VFVFIA TIFLAFSPS   SSP
Sbjct  1    MADIAKYAPINGGTLISDFKAHFSIFRTKRTVALAYAFVFVFIAITIFLAFSPSSNSSSP  60

Query  339  WFTNVFSLT  365
            WFTN+FS T
Sbjct  61   WFTNIFSTT  69



>ref|XP_009783309.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=658

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFs-pspapss  335
            MA+ AKYAPINGG L+++LK HFS +KT+R+  C Y  VFVFI  T FLAF+      SS
Sbjct  1    MAETAKYAPINGGTLVTDLKTHFSIVKTKRSIACAYGFVFVFIVVTTFLAFTPNPNNSSS  60

Query  336  pWFTNVFSLT  365
            PWFTN+FSL+
Sbjct  61   PWFTNIFSLS  70



>ref|XP_009604045.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=647

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFs-pspapss  335
            MA+ AKYAPINGG L+++LK HFS +KT+R+  C Y  VFVFI  T FLAF+      SS
Sbjct  1    MAETAKYAPINGGTLVTDLKTHFSLVKTKRSIACAYGFVFVFIVVTTFLAFTPNPNNSSS  60

Query  336  pWFTNVFSLT  365
            PWFTN+ SL+
Sbjct  61   PWFTNILSLS  70



>ref|XP_006362212.1| PREDICTED: uncharacterized protein LOC102599885 [Solanum tuberosum]
Length=691

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  159  MADAAKYAPINGG-NLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapss  335
            MAD AKY PINGG  L+++LK HFSF+KT+RT  C Y  +FVFI  T FLAFSPSP  SS
Sbjct  1    MADTAKYTPINGGKTLITDLKTHFSFLKTKRTVTCAYGFMFVFILVTFFLAFSPSPNSSS  60

Query  336  pWFTNVF  356
            PWFTN+F
Sbjct  61   PWFTNIF  67



>ref|XP_009757308.1| PREDICTED: protein trichome birefringence-like [Nicotiana sylvestris]
Length=684

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +3

Query  165  DAAKYAPINGG-NLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapsspW  341
            D AKY PINGG  L ++LK HFSF+KT+RT  C Y  +FVF+A T FLAFSPSP  SSPW
Sbjct  2    DTAKYTPINGGKTLFTDLKAHFSFLKTKRTVTCAYGFMFVFVAVTFFLAFSPSPNSSSPW  61

Query  342  FTNVF  356
            FTN+F
Sbjct  62   FTNIF  66



>ref|XP_006351351.1| PREDICTED: uncharacterized protein LOC102598735 isoform X1 [Solanum 
tuberosum]
Length=713

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MA+ AKYA INGG L +++K   S  KT+RT  C Y  VF+FI  T FLAFSPSP  SSP
Sbjct  1    MAETAKYAAINGGTLFTDMKTQLSLPKTKRTVACAYGFVFIFIVVTTFLAFSPSPNSSSP  60

Query  339  WFTNVFSLT  365
            WFTN+FSL+
Sbjct  61   WFTNIFSLS  69



>ref|XP_006351352.1| PREDICTED: uncharacterized protein LOC102598735 isoform X2 [Solanum 
tuberosum]
Length=656

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MA+ AKYA INGG L +++K   S  KT+RT  C Y  VF+FI  T FLAFSPSP  SSP
Sbjct  1    MAETAKYAAINGGTLFTDMKTQLSLPKTKRTVACAYGFVFIFIVVTTFLAFSPSPNSSSP  60

Query  339  WFTNVFSLT  365
            WFTN+FSL+
Sbjct  61   WFTNIFSLS  69



>ref|XP_009611858.1| PREDICTED: protein trichome birefringence-like [Nicotiana tomentosiformis]
Length=648

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +3

Query  165  DAAKYAPINGGN-LLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapsspW  341
            D AKY PINGG  L+++LK HFSF+KT+RT  C Y  +FVF+A T FLAFSPSP  SSPW
Sbjct  2    DTAKYTPINGGKTLITDLKAHFSFLKTKRTVTCAYGFMFVFVAVTFFLAFSPSPNSSSPW  61

Query  342  FTNVF  356
            FTN+F
Sbjct  62   FTNIF  66



>ref|XP_004249181.1| PREDICTED: protein trichome birefringence [Solanum lycopersicum]
Length=691

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +3

Query  159  MADAAKYAPINGG-NLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapss  335
            MAD AKY PINGG  L+++LK HFSF+KT+R+  C Y  +FVFI  T FLAFSPSP  SS
Sbjct  1    MADTAKYTPINGGKTLITDLKTHFSFLKTKRSVTCAYGFMFVFILVTFFLAFSPSPNSSS  60

Query  336  pWFTNV  353
            PWF+N+
Sbjct  61   PWFSNI  66



>ref|XP_004249290.1| PREDICTED: protein trichome birefringence-like [Solanum lycopersicum]
Length=578

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MA+ AKY  INGG L +++K  FS +KT+RT    Y  +F+FI  T FLAF+PS   SSP
Sbjct  1    MAETAKYEAINGGTLFTDMKTQFSLLKTKRTVGFAYGFLFIFIVVTTFLAFTPSQNSSSP  60

Query  339  WFTNVFSLT  365
            WF+N+FSLT
Sbjct  61   WFSNIFSLT  69



>emb|CDP10159.1| unnamed protein product [Coffea canephora]
Length=623

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MA+  KY PING  L++ELK  F  +K ++T    Y  +F FIAFTIFLAFSPSP  SSP
Sbjct  1    MAEITKYQPINGRTLVTELKSQFYLLKNKKTVALAYGFIFAFIAFTIFLAFSPSPNSSSP  60

Query  339  WFTNVFS  359
            WF+N+FS
Sbjct  61   WFSNIFS  67



>ref|XP_011075105.1| PREDICTED: protein trichome birefringence-like [Sesamum indicum]
Length=616

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MAD  KYAPING  L S+LK H   ++T+ T    YA VF+FIAFTIFLAF+PS   SSP
Sbjct  1    MADITKYAPINGATLFSQLKAH---LRTRPTVTLAYAFVFLFIAFTIFLAFTPSSNSSSP  57

Query  339  WFTNVF  356
            WFTN+F
Sbjct  58   WFTNIF  63



>ref|XP_004493599.1| PREDICTED: uncharacterized protein LOC101511851 [Cicer arietinum]
Length=617

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLS---ELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspap  329
            MADA KY PI GGNL +   +LK  FS +KT+ T    Y  +F+FIAFT+FLAFSPSP  
Sbjct  1    MADATKYVPIGGGNLHTTTLDLKNLFSILKTRTTLAFAYVFIFLFIAFTVFLAFSPSPNA  60

Query  330  sspWFTNVF  356
            SSPWFTN+F
Sbjct  61   SSPWFTNIF  69



>ref|XP_003553434.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN45423.1| hypothetical protein glysoja_028430 [Glycine soja]
Length=615

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MADA KY PI GGN+ ++LK     +KT++T    YA +  F+AFT+FLAFSPSP  SSP
Sbjct  1    MADATKYVPIGGGNVATDLKSLSFILKTKKTVAAAYAFILAFVAFTVFLAFSPSPNASSP  60

Query  339  WFTNVFS  359
            WFTN+FS
Sbjct  61   WFTNIFS  67



>ref|XP_007162340.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
 gb|ESW34334.1| hypothetical protein PHAVU_001G143600g [Phaseolus vulgaris]
Length=633

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MADA KY PI G NL ++LK   S +KT++T    YA +  F+AFT+FLAFSPSP  SSP
Sbjct  1    MADATKYVPIGGTNLSTDLKTLSSVLKTRKTVAFAYAFIIAFVAFTVFLAFSPSPNASSP  60

Query  339  WFTNVFSLT  365
            WFTN+FS T
Sbjct  61   WFTNIFSST  69



>ref|XP_002534536.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27846.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +3

Query  159  MADAA----KYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspa  326
            MADAA    ++  I+GGN++S+LK  FS +KT+RT    Y  +F F+AFT+FLAF+PSP 
Sbjct  1    MADAAASKQQHLSIHGGNVISDLKSLFSIVKTRRTVAFAYGFMFAFVAFTVFLAFNPSPN  60

Query  327  psspWFTNVF  356
             S+PWFTN+F
Sbjct  61   TSAPWFTNIF  70



>ref|XP_004303340.1| PREDICTED: protein trichome birefringence-like [Fragaria vesca 
subsp. vesca]
Length=610

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +3

Query  159  MADAAKY-APINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapss  335
            MA+A K+  PI GG L+S++K  FS IKT+RT    Y  +F F+AFT+FLAF+P+P   +
Sbjct  1    MAEATKHNTPIKGGTLVSDMKSLFSIIKTRRTVAFAYGFMFAFVAFTVFLAFNPNPNSGA  60

Query  336  pWFTNVF  356
            PWF+N+F
Sbjct  61   PWFSNIF  67



>ref|XP_009369426.1| PREDICTED: protein trichome birefringence [Pyrus x bretschneideri]
Length=628

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = +3

Query  159  MADAAK--YAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspaps  332
            MA+  K  + PINGG L+S+LK  FS  KT+RT    Y  +F F+AFT+FLAFSPSP  +
Sbjct  1    MAEVTKQQHLPINGGTLISDLKSLFSLFKTRRTAAFAYGFMFAFVAFTVFLAFSPSPNYT  60

Query  333  spWFTNV  353
             PWF N+
Sbjct  61   YPWFANI  67



>ref|XP_007204224.1| hypothetical protein PRUPE_ppa002919mg [Prunus persica]
 gb|EMJ05423.1| hypothetical protein PRUPE_ppa002919mg [Prunus persica]
Length=621

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 2/67 (3%)
 Frame = +3

Query  159  MADAAKY--APINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspaps  332
            MA+A K+    INGG LLS+LK  FS +KT+RT   VY  +F F+AFT+FLAFSPSP   
Sbjct  1    MAEATKHHLPTINGGTLLSDLKSLFSILKTRRTVAFVYGFMFAFVAFTVFLAFSPSPNSG  60

Query  333  spWFTNV  353
            +PWF+N+
Sbjct  61   APWFSNI  67



>ref|XP_002280022.1| PREDICTED: protein trichome birefringence [Vitis vinifera]
Length=659

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MAD  K+ P+ GG L S+    FS  +T+RT   VY  +F FI FT+FLAF      SSP
Sbjct  1    MADGTKHLPLGGGALFSDFTSLFSMARTRRTMFFVYGFMFAFIVFTVFLAF-SPANASSP  59

Query  339  WFTNVFS  359
            WFTN+F+
Sbjct  60   WFTNIFA  66



>ref|XP_008240911.1| PREDICTED: protein trichome birefringence [Prunus mume]
Length=618

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 2/67 (3%)
 Frame = +3

Query  159  MADAAKY--APINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspaps  332
            MA+A K+    INGG LLS+LK  FS +KT+RT    Y  +F F+AFT+FLAFSPSP   
Sbjct  1    MAEATKHHLPTINGGTLLSDLKSLFSILKTRRTVAFAYGFMFAFVAFTVFLAFSPSPNSG  60

Query  333  spWFTNV  353
            +PWF+N+
Sbjct  61   APWFSNI  67



>ref|XP_007029023.1| Emb:CAB82953.1, putative [Theobroma cacao]
 gb|EOY09525.1| Emb:CAB82953.1, putative [Theobroma cacao]
Length=650

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 4/67 (6%)
 Frame = +3

Query  159  MADAAKYAPINGGN-LLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapss  335
            MAD AKY PINGG  L+++ +  FS IKT+RT   V   +F F+ FT+FLAFSPS   S+
Sbjct  1    MADTAKYMPINGGTTLVTDFRSLFSIIKTRRT---VAFFMFAFVGFTVFLAFSPSSNSSA  57

Query  336  pWFTNVF  356
            PWFTN+F
Sbjct  58   PWFTNIF  64



>ref|XP_008387218.1| PREDICTED: protein trichome birefringence-like [Malus domestica]
Length=629

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = +3

Query  159  MADAAK--YAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspaps  332
            MA+  K  + PINGG L+S+LK  FS  KT+RT    Y  +  F+AFT+FLAFSPSP  +
Sbjct  1    MAEVTKQQHLPINGGTLISDLKSLFSLFKTRRTAAFAYGFMVAFVAFTVFLAFSPSPNYT  60

Query  333  spWFTNV  353
            SPWF N+
Sbjct  61   SPWFANI  67



>ref|XP_008443032.1| PREDICTED: protein trichome birefringence [Cucumis melo]
Length=614

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLA  308
            MA+  KY PINGGNL+S++K  FS +KT+RT    Y  +F F+ FT FLA
Sbjct  1    MAEVTKYQPINGGNLVSDVKSLFSILKTKRTMAFAYGFMFAFVVFTAFLA  50



>ref|XP_004161492.1| PREDICTED: uncharacterized protein LOC101228487 [Cucumis sativus]
Length=613

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLA  308
            MA+  KY PINGGNL+S++K  FS +KT+RT    Y  +F F+ FT FLA
Sbjct  1    MAEVTKYQPINGGNLVSDVKSLFSILKTKRTMAFAYGFMFAFVVFTAFLA  50



>ref|XP_004136561.1| PREDICTED: uncharacterized protein LOC101220024 [Cucumis sativus]
 gb|KGN59288.1| hypothetical protein Csa_3G800710 [Cucumis sativus]
Length=613

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLA  308
            MA+  KY PINGGNL+S++K  FS +KT+RT    Y  +F F+ FT FLA
Sbjct  1    MAEVTKYQPINGGNLVSDVKSLFSILKTKRTMAFAYGFMFAFVVFTAFLA  50



>ref|XP_003520540.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN07442.1| hypothetical protein glysoja_012740 [Glycine soja]
Length=622

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 7/69 (10%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MADA KY PI G N+        S +KT++T    Y+ +  F+AFT+FLAFSPS   SSP
Sbjct  1    MADATKYVPIAGTNV-------SSILKTRKTVAAAYSFILAFVAFTVFLAFSPSSNASSP  53

Query  339  WFTNVFSLT  365
            WFTN+FS T
Sbjct  54   WFTNIFSPT  62



>ref|XP_010672635.1| PREDICTED: protein trichome birefringence-like 1 [Beta vulgaris 
subsp. vulgaris]
Length=602

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAF-spspapss  335
            M++  KY  +   N++++ + HFSF +++++   VY  VFVFIAFT+FLAF   S   SS
Sbjct  1    MSEVTKYQLVPNNNIVTDFRSHFSFFRSKKSSAFVYGVVFVFIAFTVFLAFSPSSSTSSS  60

Query  336  pWFTNVFSL  362
             WF N F++
Sbjct  61   TWFINFFTV  69



>ref|XP_002308359.2| hypothetical protein POPTR_0006s20840g [Populus trichocarpa]
 gb|EEE91882.2| hypothetical protein POPTR_0006s20840g [Populus trichocarpa]
Length=611

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 3/69 (4%)
 Frame = +3

Query  159  MAD--AAKY-APINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspap  329
            MAD  A+K+ + I+GGN+++++K   S +KT+RT    Y  +F F+AFTIFLAFSPSP  
Sbjct  1    MADTTASKHLSSISGGNIITDMKNLSSLLKTRRTVTFAYGFMFAFVAFTIFLAFSPSPNS  60

Query  330  sspWFTNVF  356
            SSPWFTN+F
Sbjct  61   SSPWFTNIF  69



>ref|XP_004497886.1| PREDICTED: uncharacterized protein LOC101512080 [Cicer arietinum]
Length=529

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +3

Query  159  MADAAKYAPIN-GGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapss  335
            MA+  KY P+N  GNL S++K  FSF+KT++     YA    F++FT+FLAFSPS   SS
Sbjct  1    MAETTKYVPLNVSGNLNSDIKSFFSFLKTRKRITFAYAFTLAFVSFTLFLAFSPSSNASS  60

Query  336  pWFTNVFS  359
            PWF N F+
Sbjct  61   PWFNNSFT  68



>gb|KJB16333.1| hypothetical protein B456_002G223800 [Gossypium raimondii]
Length=620

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 4/68 (6%)
 Frame = +3

Query  159  MADAAKYAPINGGNLL-SELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapss  335
            MAD AKY P+NGG  + +++K  FS IKT+RT   V   +F F+ FT+ LAF PS   SS
Sbjct  1    MADIAKYVPVNGGTTVGTDIKNLFSVIKTRRT---VALFMFAFVGFTLLLAFCPSSNTSS  57

Query  336  pWFTNVFS  359
            PW TN+FS
Sbjct  58   PWVTNIFS  65



>gb|KJB76673.1| hypothetical protein B456_012G100000 [Gossypium raimondii]
Length=652

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = +3

Query  159  MADAAKYAPINGGN---LLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspap  329
            MAD AKY PINGG    + +E    FS IKT+RT   V   +F F+ FT+FLAFSPS   
Sbjct  1    MADIAKYTPINGGTTTAVTAEFNYLFSIIKTRRT---VAFFMFAFVGFTVFLAFSPSSNS  57

Query  330  sspWFTNVF  356
            SSPW TN+F
Sbjct  58   SSPWVTNIF  66



>ref|XP_003535115.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN35654.1| hypothetical protein glysoja_041356 [Glycine soja]
Length=588

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MAD+ KY PI GG L S LK  F   KT++T    YA  F F+AFT+FLAF PSP  SSP
Sbjct  1    MADSTKYIPI-GGTLKSNLKTLFPIFKTRKTLTFAYAFSFTFVAFTVFLAFCPSPNTSSP  59

Query  339  WFTNVF  356
            +FTN+F
Sbjct  60   FFTNIF  65



>ref|XP_006399144.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
 gb|ESQ40597.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
Length=613

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = +3

Query  162  ADAAKYAPINGGNLLS-----ELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspa  326
            +DA KY PI+GG   +     E+K  FS +K ++T    YA V  F+AFT+F AFSPSP 
Sbjct  3    SDAVKYMPIHGGTTTTTAAAAEIKSFFSAVKPRKTSTFAYAFVITFVAFTLFFAFSPSPN  62

Query  327  psspWFTNVF  356
             SSPWF+N+F
Sbjct  63   SSSPWFSNIF  72



>gb|KJB76674.1| hypothetical protein B456_012G100000 [Gossypium raimondii]
 gb|KJB76675.1| hypothetical protein B456_012G100000 [Gossypium raimondii]
Length=485

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = +3

Query  159  MADAAKYAPINGGN---LLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspap  329
            MAD AKY PINGG    + +E    FS IKT+RT   V   +F F+ FT+FLAFSPS   
Sbjct  1    MADIAKYTPINGGTTTAVTAEFNYLFSIIKTRRT---VAFFMFAFVGFTVFLAFSPSSNS  57

Query  330  sspWFTNVF  356
            SSPW TN+F
Sbjct  58   SSPWVTNIF  66



>gb|KJB76676.1| hypothetical protein B456_012G100000 [Gossypium raimondii]
Length=531

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = +3

Query  159  MADAAKYAPINGGN---LLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspap  329
            MAD AKY PINGG    + +E    FS IKT+RT   V   +F F+ FT+FLAFSPS   
Sbjct  1    MADIAKYTPINGGTTTAVTAEFNYLFSIIKTRRT---VAFFMFAFVGFTVFLAFSPSSNS  57

Query  330  sspWFTNVF  356
            SSPW TN+F
Sbjct  58   SSPWVTNIF  66



>ref|XP_002323329.2| hypothetical protein POPTR_0016s05930g [Populus trichocarpa]
 gb|EEF05090.2| hypothetical protein POPTR_0016s05930g [Populus trichocarpa]
Length=592

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +3

Query  159  MAD--AAKY-APINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspap  329
            MAD  A+K+ +  NGGN+++++K   S +KT+ T    Y  +  F+AFTIFLAFSPSP  
Sbjct  1    MADTTASKHLSSTNGGNIITDMKNLSSLLKTRTTVTFAYGFMLAFVAFTIFLAFSPSPNS  60

Query  330  sspWFTNVF  356
            SSPWFTN+F
Sbjct  61   SSPWFTNIF  69



>ref|XP_006399143.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
 gb|ESQ40596.1| hypothetical protein EUTSA_v10012993mg [Eutrema salsugineum]
Length=443

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = +3

Query  162  ADAAKYAPINGGNLLS-----ELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspa  326
            +DA KY PI+GG   +     E+K  FS +K ++T    YA V  F+AFT+F AFSPSP 
Sbjct  3    SDAVKYMPIHGGTTTTTAAAAEIKSFFSAVKPRKTSTFAYAFVITFVAFTLFFAFSPSPN  62

Query  327  psspWFTNVF  356
             SSPWF+N+F
Sbjct  63   SSSPWFSNIF  72



>ref|XP_011039468.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=619

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  189  NGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapsspWFTNVF  356
            NGGN+++++K   S +KT+ T    Y  +  F+AFTIFLAFSPSP  SSPWFTN+F
Sbjct  14   NGGNIITDIKNLSSLLKTRTTVTFAYGFMLAFVAFTIFLAFSPSPNSSSPWFTNIF  69



>ref|XP_011005287.1| PREDICTED: protein trichome birefringence-like [Populus euphratica]
Length=624

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 3/69 (4%)
 Frame = +3

Query  159  MAD--AAKY-APINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspap  329
            MAD  A+K+ + I+G N+++++K   S +KT+RT    Y  +F F+AFTIFLAFSPSP  
Sbjct  1    MADTTASKHLSSISGRNIITDIKNLSSLLKTRRTVTFAYGFMFAFVAFTIFLAFSPSPNS  60

Query  330  sspWFTNVF  356
            SSPWF N+F
Sbjct  61   SSPWFANIF  69



>ref|XP_007145701.1| hypothetical protein PHAVU_007G261000g [Phaseolus vulgaris]
 gb|ESW17695.1| hypothetical protein PHAVU_007G261000g [Phaseolus vulgaris]
Length=670

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspapssp  338
            MADA KY PI G  L S+LK  FS  KT++T    YA  F F+ FT+FLAF PSP  SSP
Sbjct  58   MADA-KYIPIEG-TLNSDLKTLFSISKTRKTLTFAYAFTFAFVVFTVFLAFCPSPNTSSP  115

Query  339  WFTNVF  356
            +FTN+F
Sbjct  116  FFTNIF  121



>ref|XP_010557950.1| PREDICTED: protein trichome birefringence-like [Tarenaya hassleriana]
Length=626

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 5/71 (7%)
 Frame = +3

Query  162  ADAAKYAPINGGNLLS-----ELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspa  326
            +D+ KY P++GG   +     ++K   + +K ++     Y  V  F+AFT+FLAFSPS  
Sbjct  3    SDSVKYMPVHGGGGATTASSADIKSLLAAVKPRKASAFAYVSVLAFVAFTVFLAFSPSRN  62

Query  327  psspWFTNVFS  359
             SSPWF N+FS
Sbjct  63   TSSPWFANIFS  73



>ref|XP_003625280.1| hypothetical protein MTR_7g093450 [Medicago truncatula]
 gb|AES81498.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=601

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 33/56 (59%), Gaps = 5/56 (9%)
 Frame = +3

Query  159  MADAAKYAPINGGNLLSEL-----KPHFSFIKTQRTKVCVYACVFVFIAFTIFLAF  311
            MAD  KY PI GG     L     K  F+ +KT+ T   VYA + VFIAFT+FLAF
Sbjct  1    MADTTKYVPIGGGTTNGNLHKLDFKNIFTILKTKTTLAFVYAFMLVFIAFTLFLAF  56



>ref|XP_006287297.1| hypothetical protein CARUB_v10000490mg [Capsella rubella]
 gb|EOA20195.1| hypothetical protein CARUB_v10000490mg [Capsella rubella]
Length=613

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 3/68 (4%)
 Frame = +3

Query  162  ADAAKYAPINGGNLL---SELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLAFspspaps  332
            +DA KY PI+GG      +++K  FS +K ++T    YA V  F++FT+F AFSPSP  S
Sbjct  3    SDAVKYMPIHGGGTTTTTADIKSFFSALKPKKTSTFAYAFVITFVSFTLFFAFSPSPNSS  62

Query  333  spWFTNVF  356
            SPWF+N+F
Sbjct  63   SPWFSNIF  70



>ref|XP_009125778.1| PREDICTED: protein trichome birefringence-like [Brassica rapa]
Length=525

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  162  ADAAKYAPINGGNLLSELKPHFSFIKTQRTKVCVYACVFVFIAFTIFLA  308
            ++A KY PI+GG   +E +  FS +K ++T   VYA V  F++FT+FLA
Sbjct  3    SNAVKYMPIHGGTTPAETRSFFSAVKPRKTSTLVYAFVITFVSFTLFLA  51



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490