BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005O16

Length=481
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR90846.1|  lipoxygenase                                            132   8e-36   Capsicum annuum
emb|CAD10740.1|  lipoxygenase                                           135   1e-35   Corylus avellana [European hazelnut]
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    139   1e-34   Nicotiana sylvestris
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    138   1e-34   Nicotiana tomentosiformis
emb|CAA58859.1|  lipoxygenase                                           138   2e-34   Nicotiana tabacum [American tobacco]
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    136   4e-34   Fragaria vesca subsp. vesca
ref|NP_001268178.1|  lipoxygenase                                       130   9e-34   Vitis vinifera
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1                 130   1e-33   
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    130   1e-33   Pyrus x bretschneideri [bai li]
gb|AGU28274.1|  lipoxygenase 1                                          130   1e-33   Vitis vinifera
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g             130   1e-33   Populus trichocarpa [western balsam poplar]
emb|CBI36801.3|  unnamed protein product                                130   1e-33   Vitis vinifera
gb|KCW61797.1|  hypothetical protein EUGRSUZ_H04495                     132   2e-33   Eucalyptus grandis [rose gum]
gb|ACO57136.1|  lipoxygenase 1                                          135   3e-33   Capsicum annuum
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5               128   6e-33   
gb|KCW61796.1|  hypothetical protein EUGRSUZ_H04495                     132   6e-33   Eucalyptus grandis [rose gum]
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    128   6e-33   
gb|AGI16379.1|  lipoxygenase                                            128   6e-33   Malus domestica [apple tree]
gb|AGK82798.1|  lipoxygenase                                            128   6e-33   Malus domestica [apple tree]
gb|AGI16380.1|  lipoxygenase                                            128   7e-33   Malus domestica [apple tree]
gb|AGI16382.1|  lipoxygenase                                            128   7e-33   Malus domestica [apple tree]
gb|AGI16378.1|  lipoxygenase                                            128   7e-33   Malus domestica [apple tree]
gb|AGI16377.1|  lipoxygenase                                            127   8e-33   Malus domestica [apple tree]
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    127   9e-33   Populus euphratica
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    132   2e-32   Eucalyptus grandis [rose gum]
gb|AGL96414.1|  9-lipoxygenase                                          131   5e-32   Nicotiana benthamiana
ref|NP_001281026.1|  probable linoleate 9S-lipoxygenase 5               126   6e-32   Malus domestica [apple tree]
ref|XP_009376681.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    125   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_009376680.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    125   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_009376660.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    125   1e-31   
gb|ABW75772.2|  lipoxygenase                                            126   1e-31   Camellia sinensis [black tea]
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg             123   3e-31   
ref|XP_008246452.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    123   4e-31   Prunus mume [ume]
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    123   4e-31   Prunus mume [ume]
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    123   4e-31   Prunus mume [ume]
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    122   4e-31   Sesamum indicum [beniseed]
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    125   5e-31   Eucalyptus grandis [rose gum]
gb|ACG56281.1|  lipoxygenase                                            125   6e-31   Olea europaea
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    124   1e-30   Eucalyptus grandis [rose gum]
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                   120   1e-30   Citrus sinensis [apfelsine]
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg             120   1e-30   Citrus clementina [clementine]
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5               124   3e-30   Solanum tuberosum [potatoes]
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    119   3e-30   Vitis vinifera
emb|CBI36802.3|  unnamed protein product                                119   3e-30   Vitis vinifera
ref|XP_006419897.1|  hypothetical protein CICLE_v10004281mg             121   4e-30   
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    120   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_006419896.1|  hypothetical protein CICLE_v10004281mg             120   4e-30   
gb|KDO74649.1|  hypothetical protein CISIN_1g002776mg                   120   5e-30   Citrus sinensis [apfelsine]
gb|KDO74650.1|  hypothetical protein CISIN_1g002776mg                   120   6e-30   Citrus sinensis [apfelsine]
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg             120   6e-30   Citrus clementina [clementine]
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                   119   7e-30   Citrus sinensis [apfelsine]
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    121   7e-30   
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg             120   8e-30   
ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    122   1e-29   Solanum lycopersicum
ref|XP_002512386.1|  lipoxygenase, putative                             116   1e-29   Ricinus communis
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g             116   1e-29   
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5               118   1e-29   Malus domestica [apple tree]
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    120   2e-29   Prunus mume [ume]
gb|KDP23508.1|  hypothetical protein JCGZ_23341                         115   2e-29   Jatropha curcas
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    121   2e-29   Nelumbo nucifera [Indian lotus]
gb|KCW44986.1|  hypothetical protein EUGRSUZ_L01433                     122   3e-29   Eucalyptus grandis [rose gum]
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    120   3e-29   Populus euphratica
ref|XP_010040715.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    122   3e-29   
ref|XP_008388961.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    118   3e-29   
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    120   4e-29   Fragaria vesca subsp. vesca
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                    114   4e-29   Glycine soja [wild soybean]
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    114   4e-29   Glycine max [soybeans]
dbj|BAE44117.1|  lipoxigenase                                           113   5e-29   Nicotiana tabacum [American tobacco]
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    121   6e-29   Populus euphratica
gb|KJB80989.1|  hypothetical protein B456_013G124500                    114   6e-29   Gossypium raimondii
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase                114   6e-29   Gossypium hirsutum [American cotton]
ref|XP_004494612.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    113   7e-29   Cicer arietinum [garbanzo]
ref|XP_008246455.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    118   8e-29   Prunus mume [ume]
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg             117   8e-29   Prunus persica
gb|KDP40158.1|  hypothetical protein JCGZ_02156                         117   1e-28   Jatropha curcas
emb|CAB94852.1|  lipoxygenase                                           117   1e-28   Prunus dulcis [sweet almond]
ref|XP_009376663.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    115   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_002311617.1|  lipoxygenase family protein                        118   1e-28   Populus trichocarpa [western balsam poplar]
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                    112   1e-28   Glycine soja [wild soybean]
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...    112   1e-28   Glycine max [soybeans]
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    118   1e-28   Nicotiana sylvestris
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    118   1e-28   Nicotiana sylvestris
ref|XP_007208174.1|  hypothetical protein PRUPE_ppa001016mg             114   1e-28   Prunus persica
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    119   2e-28   Populus euphratica
gb|ABV32552.1|  lipoxygenase                                            114   2e-28   Prunus persica
gb|ABF19102.2|  9-lipoxygenase                                          120   2e-28   Capsicum annuum
emb|CAD10779.2|  lipoxygenase                                           116   2e-28   Prunus dulcis [sweet almond]
gb|ACD43483.1|  lipoxygenase 1                                          115   3e-28   Olea europaea
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    117   3e-28   Populus euphratica
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        120   3e-28   Cucumis melo [Oriental melon]
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    120   4e-28   Solanum tuberosum [potatoes]
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    120   5e-28   Cucumis sativus [cucumbers]
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g             117   5e-28   
ref|XP_004156417.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    120   5e-28   
emb|CDP20618.1|  unnamed protein product                                114   6e-28   Coffea canephora [robusta coffee]
gb|ACH91370.1|  lipoxygenase LOX-3                                      112   7e-28   Prunus persica
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    114   9e-28   Nelumbo nucifera [Indian lotus]
ref|NP_001280815.1|  probable linoleate 9S-lipoxygenase 5               113   1e-27   Malus domestica [apple tree]
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                        119   1e-27   Solanum lycopersicum
ref|XP_008359870.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    113   1e-27   
ref|XP_008246454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    111   1e-27   Prunus mume [ume]
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg             114   1e-27   
ref|XP_004247367.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    111   1e-27   Solanum lycopersicum
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...    112   1e-27   Gossypium arboreum [tree cotton]
ref|XP_002516771.1|  lipoxygenase, putative                             114   2e-27   
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    111   2e-27   Eucalyptus grandis [rose gum]
ref|XP_006359922.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    110   2e-27   Solanum tuberosum [potatoes]
gb|AAP83135.1|  lipoxygenase                                            117   4e-27   Nicotiana attenuata
gb|AGI16414.1|  lipoxygenase                                            110   4e-27   Malus domestica [apple tree]
gb|AGI16415.1|  lipoxygenase                                            110   4e-27   Malus domestica [apple tree]
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                        112   4e-27   Morus notabilis
ref|NP_001281022.1|  probable linoleate 9S-lipoxygenase 5               110   4e-27   Malus domestica [apple tree]
gb|ABF19103.2|  9-lipoxygenase                                          112   4e-27   Capsicum annuum
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    109   4e-27   
gb|AEQ30071.1|  lipoxygenase                                            108   5e-27   Litchi chinensis [litchi]
gb|AAZ04411.1|  lipoxygenase                                            111   5e-27   Cynanchum gracillimum
ref|XP_007030817.1|  Lipoxygenase 1                                     111   6e-27   
gb|AGI16416.1|  lipoxygenase                                            109   7e-27   Malus domestica [apple tree]
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    115   7e-27   Populus euphratica
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    111   9e-27   Phoenix dactylifera
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g             106   1e-26   Phaseolus vulgaris [French bean]
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    112   1e-26   Nicotiana tomentosiformis
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    112   1e-26   Nicotiana tomentosiformis
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    116   1e-26   Solanum tuberosum [potatoes]
emb|CDP15504.1|  unnamed protein product                                116   1e-26   Coffea canephora [robusta coffee]
gb|KJB38136.1|  hypothetical protein B456_006G238200                    109   1e-26   Gossypium raimondii
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    111   1e-26   Solanum tuberosum [potatoes]
gb|KJB38135.1|  hypothetical protein B456_006G238200                    109   1e-26   Gossypium raimondii
gb|KJB38137.1|  hypothetical protein B456_006G238200                    108   2e-26   Gossypium raimondii
gb|AAP83134.1|  lipoxygenase                                            115   2e-26   Nicotiana attenuata
gb|KJB38138.1|  hypothetical protein B456_006G238200                    108   2e-26   Gossypium raimondii
emb|CAA64767.1|  lipoxygenase                                           113   2e-26   Solanum tuberosum [potatoes]
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    110   2e-26   Solanum tuberosum [potatoes]
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6             115   2e-26   Nicotiana sylvestris
gb|KJB28315.1|  hypothetical protein B456_005G041900                    108   3e-26   Gossypium raimondii
gb|AGI16413.1|  lipoxygenase                                            107   4e-26   Malus domestica [apple tree]
ref|XP_007030814.1|  Lipoxygenase 1                                     112   5e-26   
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    109   6e-26   
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    109   6e-26   Solanum lycopersicum
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    111   6e-26   Populus euphratica
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6             113   7e-26   Nicotiana tomentosiformis
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    112   8e-26   Solanum tuberosum [potatoes]
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    107   8e-26   Sesamum indicum [beniseed]
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    107   9e-26   Sesamum indicum [beniseed]
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                  103   1e-25   Medicago truncatula
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg             107   2e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006838255.1|  hypothetical protein AMTR_s00103p00053790          108   3e-25   
ref|XP_003626279.1|  Chalcone synthase                                  102   3e-25   
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg                104   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_002315780.1|  lipoxygenase family protein                        109   3e-25   
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    109   4e-25   Nicotiana sylvestris
gb|KJB80990.1|  hypothetical protein B456_013G124500                    102   4e-25   Gossypium raimondii
gb|AAO03558.1|  lipoxygenase 1                                          105   4e-25   Brassica napus [oilseed rape]
emb|CDY43490.1|  BnaA01g21450D                                          105   4e-25   Brassica napus [oilseed rape]
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              102   4e-25   Glycine soja [wild soybean]
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1             105   5e-25   Brassica rapa
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    102   5e-25   
gb|EYU41500.1|  hypothetical protein MIMGU_mgv1a001165mg                102   5e-25   Erythranthe guttata [common monkey flower]
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        102   7e-25   Tarenaya hassleriana [spider flower]
emb|CDO99039.1|  unnamed protein product                                107   7e-25   Coffea canephora [robusta coffee]
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    111   7e-25   Elaeis guineensis
gb|AAD09861.1|  lipoxygenase                                            108   9e-25   Persea americana
gb|ACU20079.1|  unknown                                                 103   1e-24   Glycine max [soybeans]
ref|XP_006607065.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    102   1e-24   
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    109   1e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|AGN75068.1|  lipoxygenase 2                                          102   1e-24   Momordica charantia [balsam pear]
ref|XP_006850111.1|  hypothetical protein AMTR_s00022p00225700          105   2e-24   
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    109   2e-24   Eucalyptus grandis [rose gum]
gb|AHX56187.1|  lipoxygenase                                            103   2e-24   Diospyros kaki [Japanese persimmon]
gb|ADN92993.2|  lipoxygenase LOX1                                       109   2e-24   Ipomoea nil [qian niu]
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    104   3e-24   Populus euphratica
ref|NP_001275351.1|  5-lipoxygenase                                     107   5e-24   Solanum tuberosum [potatoes]
ref|NP_001234098.1|  lipoxygenase                                       105   5e-24   Solanum lycopersicum
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    108   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    102   5e-24   
gb|AEZ50136.1|  lipoxygenase                                            100   6e-24   
gb|ADL41189.1|  lipoxygenase                                            101   7e-24   Camellia sinensis [black tea]
gb|ABF60002.1|  lipoxygenase 2                                          100   7e-24   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        103   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004156418.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    102   8e-24   
gb|AFU51542.1|  lipoxygenase 3                                          107   9e-24   Capsicum annuum
gb|AIC82456.1|  lipoxygenase                                            102   1e-23   Cocos nucifera
dbj|BAH57745.1|  lipoxygenase                                           102   1e-23   Actinidia arguta
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like        107   1e-23   Solanum tuberosum [potatoes]
ref|XP_002319014.2|  lipoxygenase family protein                        101   1e-23   
ref|XP_003591120.1|  Lipoxygenase                                       102   2e-23   Medicago truncatula
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like      99.8    2e-23   Tarenaya hassleriana [spider flower]
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                    100   2e-23   Arabis alpina [alpine rockcress]
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1                 105   2e-23   
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  97.1    3e-23   
ref|XP_010667400.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    102   3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g             101   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  97.4    3e-23   Fragaria vesca subsp. vesca
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    100   3e-23   Cucumis sativus [cucumbers]
ref|XP_010674744.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    101   3e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN60916.1|  hypothetical protein Csa_2G023340                     99.8    3e-23   Cucumis sativus [cucumbers]
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...    105   4e-23   
emb|CAE17327.1|  lipoxygenase                                           100   4e-23   Fragaria x ananassa
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg              97.4    4e-23   Erythranthe guttata [common monkey flower]
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        100   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004495725.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    100   5e-23   Cicer arietinum [garbanzo]
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  99.4    6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004296897.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  99.8    8e-23   Fragaria vesca subsp. vesca
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        105   8e-23   Phoenix dactylifera
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    103   8e-23   Solanum tuberosum [potatoes]
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    103   8e-23   Solanum tuberosum [potatoes]
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    101   9e-23   Solanum tuberosum [potatoes]
gb|AGK82779.1|  lipoxygenase                                          97.8    9e-23   Malus domestica [apple tree]
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    103   1e-22   Solanum tuberosum [potatoes]
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1           99.8    1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    105   1e-22   Elaeis guineensis
ref|XP_010556753.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    102   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_002278007.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    101   1e-22   Vitis vinifera
gb|AAD09202.1|  lipoxygenase                                          97.8    1e-22   Solanum tuberosum [potatoes]
ref|XP_008388563.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  98.2    1e-22   
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic            94.4    1e-22   Glycine soja [wild soybean]
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    103   1e-22   Solanum tuberosum [potatoes]
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like          103   1e-22   Solanum tuberosum [potatoes]
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg           99.0    1e-22   Capsella rubella
emb|CBI26229.3|  unnamed protein product                                101   1e-22   Vitis vinifera
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  94.4    1e-22   Glycine max [soybeans]
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g           99.4    1e-22   Phaseolus vulgaris [French bean]
emb|CCD74473.1|  lipoxygenase 1                                         101   2e-22   Arabidopsis halleri subsp. halleri
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                        102   2e-22   
gb|AAA74393.1|  lipoxygenase                                            102   2e-22   Solanum lycopersicum
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  97.1    2e-22   Nicotiana sylvestris
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                  97.1    2e-22   Arabis alpina [alpine rockcress]
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  97.1    3e-22   Camelina sativa [gold-of-pleasure]
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                        101   3e-22   Solanum tuberosum [potatoes]
ref|XP_003592410.1|  Lipoxygenase                                     94.4    3e-22   
ref|XP_010511294.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  96.7    3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  99.8    4e-22   Cucumis melo [Oriental melon]
ref|XP_010470260.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  96.3    5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010530359.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    100   5e-22   Tarenaya hassleriana [spider flower]
ref|XP_007030815.1|  Lipoxygenase 1                                   99.4    5e-22   
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  99.0    5e-22   
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  96.3    5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  93.6    5e-22   Sesamum indicum [beniseed]
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776           99.4    8e-22   
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg           96.7    9e-22   Capsella rubella
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  95.1    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg           95.1    1e-21   Eutrema salsugineum [saltwater cress]
ref|XP_009376662.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  94.0    1e-21   Pyrus x bretschneideri [bai li]
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                  95.9    1e-21   Arabis alpina [alpine rockcress]
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  96.3    1e-21   
gb|AAG00881.1|AC064840_12  lipoxygenase - partial coding sequence     98.6    1e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38326.1|  BnaC05g30190D                                        94.4    2e-21   Brassica napus [oilseed rape]
ref|XP_010431179.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  95.9    2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002883361.1|  lipoxygenase                                     94.4    2e-21   
ref|XP_004169780.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...  96.3    2e-21   
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  95.1    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  93.6    3e-21   Brassica rapa
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  90.9    3e-21   Sesamum indicum [beniseed]
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  95.9    3e-21   Cucumis sativus [cucumbers]
ref|XP_007030816.1|  Lipoxygenase 1-like protein                      95.9    3e-21   
ref|NP_175900.1|  lipoxygenase 1                                      95.9    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g           94.0    4e-21   Phaseolus vulgaris [French bean]
ref|XP_006344625.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  91.3    5e-21   Solanum tuberosum [potatoes]
ref|XP_004230207.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  91.3    5e-21   Solanum lycopersicum
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...  95.5    9e-21   
dbj|BAB01777.1|  lipoxygenase                                         91.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188879.2|  lipoxygenase 5                                      91.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CAA64765.1|  lipoxygenase                                         96.3    1e-20   Solanum tuberosum [potatoes]
emb|CAC19365.1|  lipoxygenase                                         91.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009626060.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  90.5    2e-20   Nicotiana tomentosiformis
gb|AHX56188.1|  lipoxygenase                                          89.0    2e-20   Diospyros kaki [Japanese persimmon]
emb|CDY46325.1|  BnaC01g31590D                                        94.4    2e-20   Brassica napus [oilseed rape]
ref|XP_008370473.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  89.7    2e-20   
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  95.9    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006344624.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  88.6    3e-20   Solanum tuberosum [potatoes]
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5             91.3    3e-20   Malus domestica [apple tree]
ref|XP_008340967.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  92.8    4e-20   
gb|AGK82774.1|  lipoxygenase                                          90.9    4e-20   Malus domestica [apple tree]
gb|AGK82776.1|  lipoxygenase                                          90.9    4e-20   Malus domestica [apple tree]
gb|AGK82783.1|  lipoxygenase                                          90.9    5e-20   Malus domestica [apple tree]
gb|KHG06114.1|  putative linoleate 9S-lipoxygenase 5                  93.2    1e-19   Gossypium arboreum [tree cotton]
gb|AGK82775.1|  lipoxygenase                                          90.1    1e-19   Malus domestica [apple tree]
gb|KJB26432.1|  hypothetical protein B456_004G241300                  93.2    1e-19   Gossypium raimondii
gb|AFG54206.1|  hypothetical protein 2_6308_02                        90.1    2e-19   Pinus taeda
gb|AEW08315.1|  hypothetical protein 2_6308_02                        90.1    2e-19   
gb|AHG59316.1|  lipoxygenase                                          91.3    2e-19   
gb|AEB70991.1|  lipoxygenase 4                                        91.3    2e-19   
gb|AEB70990.1|  lipoxygenase 3                                        91.3    2e-19   
gb|AFG54211.1|  hypothetical protein 2_6308_02                        89.7    2e-19   
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2               92.0    2e-19   
gb|ADR71859.1|  lipoxygenase-1                                        91.3    3e-19   
emb|CAA64764.1|  lipoxygenase                                         92.8    3e-19   
gb|AAB41791.1|  lipoxygenase isoenzyme 1                              90.1    3e-19   
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  89.7    3e-19   
gb|EMS61315.1|  Lipoxygenase 1                                        92.0    4e-19   
gb|KJB26433.1|  hypothetical protein B456_004G241400                  90.9    4e-19   
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3               91.7    4e-19   
gb|KJB26434.1|  hypothetical protein B456_004G241400                  90.9    4e-19   
gb|KHG15901.1|  putative linoleate 9S-lipoxygenase 5                  90.9    5e-19   
gb|EAZ28267.1|  hypothetical protein OsJ_12238                        92.0    5e-19   
gb|AEI71780.1|  bacterial-induced lipoxygenase                        90.5    5e-19   
dbj|BAJ97226.1|  predicted protein                                    94.4    5e-19   
gb|ADR71857.1|  lipoxygenase-1                                        90.1    6e-19   
gb|AGQ04460.1|  lipoxygenase 1.1                                      89.0    6e-19   
ref|NP_001050993.1|  Os03g0700400                                     91.3    8e-19   
gb|AFG54207.1|  hypothetical protein 2_6308_02                        88.2    9e-19   
gb|AAB70865.1|  lipoxygenase 2                                        88.2    1e-18   
gb|AAB60715.1|  lipoxygenase                                          93.2    1e-18   
dbj|BAJ87153.1|  predicted protein                                    88.2    1e-18   
sp|P29114.2|LOX1_HORVU  RecName: Full=Linoleate 9S-lipoxygenase 1...  89.4    1e-18   
ref|XP_002466614.1|  hypothetical protein SORBIDRAFT_01g011050        87.0    2e-18   
gb|ADR71858.1|  lipoxygenase-1                                        87.8    3e-18   
gb|ADR71856.1|  lipoxygenase-1                                        87.8    3e-18   
gb|ACV84249.1|  LOX1                                                  87.0    3e-18   
emb|CAP59449.1|  lipoxygenase                                         85.1    3e-18   
ref|XP_006650443.1|  PREDICTED: putative linoleate 9S-lipoxygenas...  87.4    4e-18   
gb|AHG59315.1|  lipoxygenase                                          87.4    4e-18   
gb|EAY91529.1|  hypothetical protein OsI_13162                        88.6    4e-18   
ref|XP_009407000.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4  91.7    5e-18   
gb|AAG61118.1|  lipoxygenase                                          86.7    5e-18   
ref|NP_001105515.1|  lipoxygenase                                     86.7    5e-18   
gb|EMT09206.1|  Lipoxygenase 1                                        86.7    7e-18   
ref|NP_001051212.1|  Os03g0738600                                     85.9    9e-18   
gb|EAY91797.1|  hypothetical protein OsI_13441                        85.9    9e-18   
gb|ADR71860.1|  lipoxygenase-1                                        88.2    9e-18   
gb|AGQ04459.1|  lipoxygenase 1.1                                      85.9    9e-18   
gb|AGQ04454.1|  lipoxygenase 1.1                                      85.9    1e-17   
gb|EMT18292.1|  Putative lipoxygenase 3                               86.3    1e-17   
gb|ACS34908.1|  lipoxygenase 2                                        85.9    1e-17   
gb|AGQ04458.1|  lipoxygenase 1.1                                      85.5    1e-17   
gb|KDP23726.1|  hypothetical protein JCGZ_23559                       81.6    1e-17   
gb|AGQ04450.1|  lipoxygenase 1.1                                      85.5    1e-17   
gb|AGQ04449.1|  lipoxygenase 1.1                                      85.5    1e-17   
gb|ADP02185.1|  putative lipoxygenase                                 85.9    1e-17   
ref|XP_006650444.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  87.8    1e-17   
ref|XP_003560916.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4  89.7    2e-17   
emb|CAA45738.1|  lipoxygenase                                         84.3    2e-17   
gb|ACS34909.1|  lipoxygenase 1                                        84.3    3e-17   
ref|XP_009387657.1|  PREDICTED: linoleate 9S-lipoxygenase A-like      87.8    3e-17   
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  77.4    3e-17   
ref|XP_008224534.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...  84.7    3e-17   
ref|XP_009406999.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4  89.0    3e-17   
ref|XP_004139170.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...  83.6    3e-17   
ref|XP_004982083.1|  PREDICTED: putative linoleate 9S-lipoxygenas...  86.7    3e-17   
ref|XP_004156415.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      82.0    4e-17   
emb|CAA63483.1|  lipoxygenase                                         82.0    4e-17   
gb|AAC61785.1|  lipoxygenase 1                                        82.0    4e-17   
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g           78.2    4e-17   
gb|AGQ04451.1|  lipoxygenase 1.1                                      84.0    5e-17   
ref|XP_009406047.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      87.4    6e-17   
ref|XP_009406046.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      87.0    6e-17   
gb|AGQ04452.1|  lipoxygenase 1.1                                      83.6    7e-17   
emb|CDY64191.1|  BnaA01g36630D                                        81.6    9e-17   
gb|EAY91532.1|  hypothetical protein OsI_13165                        85.1    1e-16   
sp|Q53RB0.1|LOX4_ORYSJ  RecName: Full=Probable linoleate 9S-lipox...  85.1    1e-16   
gb|EMS64854.1|  Putative lipoxygenase 3                               82.4    2e-16   
ref|XP_004970879.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like      80.9    2e-16   
gb|AEL03787.1|  lipoxygenase                                          87.0    2e-16   
ref|XP_006650559.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like      82.0    2e-16   
gb|EMS61461.1|  Lipoxygenase 2                                        80.9    2e-16   
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg           82.0    2e-16   
ref|XP_003559944.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like      80.1    2e-16   
ref|XP_002458905.1|  hypothetical protein SORBIDRAFT_03g042440        80.1    2e-16   
ref|XP_010674737.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  81.3    2e-16   
ref|XP_010674740.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  77.8    3e-16   
gb|ACL53637.1|  unknown                                               84.7    3e-16   
ref|XP_004156414.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  82.0    3e-16   
ref|NP_001105975.1|  lipoxygenase                                     84.7    3e-16   
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  73.6    4e-16   
gb|ABD47523.1|  dual positional specificity lipoxygenase              82.8    4e-16   
gb|AFW67907.1|  hypothetical protein ZEAMMB73_739462                  85.1    4e-16   
dbj|BAJ91632.1|  predicted protein                                    79.0    5e-16   
ref|XP_007030813.1|  Lipoxygenase 1                                   79.0    5e-16   
emb|CDP20619.1|  unnamed protein product                              79.3    5e-16   
ref|XP_003560911.1|  PREDICTED: linoleate 9S-lipoxygenase 1           82.8    7e-16   
ref|XP_007030811.1|  Lipoxygenase 1                                   78.6    7e-16   
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...  79.0    7e-16   
gb|ABB82552.1|  13S-lipoxygenase                                      77.0    8e-16   
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...  79.0    8e-16   
gb|AAA79186.1|  lipoxygenase                                          76.6    1e-15   
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      76.6    1e-15   
gb|ACU81176.1|  13S-lipoxygenase                                      76.6    1e-15   
ref|XP_004139169.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  82.4    1e-15   
gb|ADZ31265.1|  lipoxygenase 3                                        84.3    2e-15   
gb|AEO13837.1|  lipoxygenase                                          81.3    2e-15   
gb|EMT25349.1|  Lipoxygenase 2                                        77.0    2e-15   
gb|AGH13205.1|  lipoxygenase                                          70.9    2e-15   
ref|XP_004970878.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like      76.6    2e-15   
ref|NP_001105974.1|  lipoxygenase                                     81.6    3e-15   
gb|ACN29156.1|  unknown                                               81.6    3e-15   
ref|XP_003559938.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like      76.3    3e-15   
ref|XP_002521992.1|  lipoxygenase, putative                           70.1    5e-15   
tpg|DAA56392.1|  TPA: lipoxygenase1                                   74.7    8e-15   
ref|XP_004972287.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like      75.1    8e-15   
ref|NP_001105973.1|  lipoxygenase                                     74.7    1e-14   
tpg|DAA56391.1|  TPA: lipoxygenase1                                   74.7    1e-14   
emb|CDP20621.1|  unnamed protein product                              75.1    2e-14   
gb|AAL73498.1|AF465642_1  lipoxygenase                                74.7    2e-14   
gb|AGI37654.1|  lipoxygenase                                          72.4    3e-14   
ref|XP_002458908.1|  hypothetical protein SORBIDRAFT_03g042450        72.8    3e-14   
gb|ACG43480.1|  lipoxygenase 2                                        72.4    4e-14   
gb|ACL53478.1|  unknown                                               72.0    5e-14   
ref|NP_001105003.1|  lipoxygenase                                     72.0    5e-14   
ref|XP_002466613.1|  hypothetical protein SORBIDRAFT_01g011040        78.6    5e-14   
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like        79.3    7e-14   
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  79.3    8e-14   
gb|AHI86055.1|  lipoxygenase                                          79.0    8e-14   
ref|XP_004158761.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  70.5    2e-13   
gb|ADG03094.1|  mutant lipoxygenase 1                                 77.4    2e-13   
ref|XP_004144826.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  70.5    2e-13   
ref|XP_010674738.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  67.0    3e-13   
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                 75.9    3e-13   
gb|ABX60408.1|  lipoxygenase L-3                                      75.9    3e-13   
gb|ADG03095.1|  lipoxygenase 3                                        75.9    3e-13   
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...  75.9    3e-13   
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                      75.9    3e-13   
ref|XP_008379872.1|  PREDICTED: receptor-like protein kinase FERONIA  76.6    3e-13   
ref|XP_010025191.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  62.0    4e-13   
pdb|3BNC|A  Chain A, Lipoxygenase-1 (Soybean) I553g Mutant            77.0    4e-13   
pdb|1Y4K|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694g Mutant   77.0    4e-13   
pdb|1FGR|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697e Mutant   77.0    4e-13   
pdb|1FGQ|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495e Mutant   77.0    4e-13   
ref|NP_001236153.1|  seed linoleate 13S-lipoxygenase-1                77.0    4e-13   
gb|ADG03093.1|  lipoxygenase 1                                        77.0    4e-13   
pdb|3PZW|A  Chain A, Soybean Lipoxygenase-1 - Re-Refinement           77.0    4e-13   
pdb|1FGT|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697n Mutant   77.0    4e-13   
pdb|4WHA|A  Chain A, Lipoxygenase-1 (soybean) L546a/l754a Mutant      77.0    4e-13   
pdb|3BNB|A  Chain A, Lipoxygenase-1 (Soybean) I553l Mutant            77.0    4e-13   
pdb|1FGM|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694h Mutant   77.0    4e-13   
pdb|3BND|A  Chain A, Lipoxygenase-1 (Soybean), I553v Mutant           77.0    4e-13   
pdb|1FGO|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495a Mutant   77.0    4e-13   
pdb|3BNE|A  Chain A, Lipoxygenase-1 (Soybean) I553a Mutant            77.0    4e-13   
gb|KCW61804.1|  hypothetical protein EUGRSUZ_H04500                   62.8    5e-13   
ref|XP_008356243.1|  PREDICTED: receptor-like protein 12              76.6    5e-13   
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  60.8    6e-13   
ref|XP_010108215.1|  hypothetical protein L484_000244                 72.0    7e-13   
ref|XP_004982082.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  71.2    1e-12   
ref|XP_003597559.1|  Seed lipoxygenase-3                              75.1    2e-12   
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...  74.3    3e-12   
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      65.9    3e-12   
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g           72.0    4e-12   
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like      65.5    4e-12   
ref|XP_009387658.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  69.7    4e-12   
emb|CAQ58078.1|  lipoxygenase                                         68.6    4e-12   
gb|ADG03092.1|  lipoxygenase 2                                        70.9    5e-12   
ref|NP_001237685.1|  seed linoleate 9S-lipoxygenase-2                 70.9    5e-12   
gb|ABX60407.1|  lipoxygease L-2                                       70.9    5e-12   
gb|AFK32352.1|  lipoxygenase-2                                        70.9    5e-12   
sp|P09439.1|LOX2_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...  71.2    5e-12   
gb|ADG03091.1|  lipoxygenase 2                                        70.9    5e-12   
ref|XP_004169568.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...  65.1    5e-12   
ref|XP_010674739.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  63.5    5e-12   
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...  73.2    8e-12   
ref|XP_009621679.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  66.2    9e-12   
prf||1502333A  lipoxygenase 3                                         72.8    1e-11
emb|CAA31664.1|  unnamed protein product                              72.8    1e-11   
gb|KGN60917.1|  hypothetical protein Csa_2G023840                     67.4    1e-11   
ref|XP_003627174.1|  Lipoxygenase                                     72.0    2e-11   
ref|XP_010094673.1|  putative linoleate 9S-lipoxygenase 5             71.6    2e-11   
ref|XP_007150486.1|  hypothetical protein PHAVU_005G156700g           72.0    2e-11   
ref|XP_009604140.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  66.2    2e-11   
gb|AHH24969.2|  lipoxygenase                                          71.6    2e-11   
gb|ABR16535.1|  unknown                                               65.5    3e-11   
ref|XP_006650442.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like      67.0    4e-11   
gb|AAG42354.1|  lipoxygenase                                          70.9    4e-11   
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...  70.1    7e-11   
gb|EPS66745.1|  lipoxygenase                                          62.4    7e-11   
gb|EPS73035.1|  hypothetical protein M569_01717                       60.5    1e-10   
ref|XP_010094672.1|  putative linoleate 9S-lipoxygenase 5             55.1    1e-10   
ref|XP_009779646.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  62.0    2e-10   
ref|XP_009779645.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  62.0    2e-10   
gb|ACF74339.1|  lipoxygenase 1                                        66.2    2e-10   
ref|XP_008454442.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  60.8    2e-10   
ref|XP_009415714.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  63.9    2e-10   
emb|CAA55318.1|  lipoxygenase                                         68.6    2e-10   
sp|P14856.1|LOX2_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...  68.6    2e-10   
ref|XP_004510413.1|  PREDICTED: linoleate 9S-lipoxygenase-like        68.6    2e-10   
ref|XP_003597558.1|  Lipoxygenase                                     65.1    3e-10   
gb|KHN11253.1|  Seed linoleate 9S-lipoxygenase-2                      65.1    3e-10   
ref|XP_004982080.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  68.2    4e-10   
ref|XP_010086772.1|  hypothetical protein L484_000135                 63.2    4e-10   
gb|KHN30070.1|  Linoleate 9S-lipoxygenase-4                           63.5    4e-10   
ref|XP_004982081.1|  PREDICTED: probable linoleate 9S-lipoxygenas...  67.8    5e-10   
ref|NP_001237338.1|  lipoxygenase-10                                  67.8    5e-10   
sp|P38417.1|LOX4_SOYBN  RecName: Full=Linoleate 9S-lipoxygenase-4...  63.2    5e-10   
gb|KHN11255.1|  Linoleate 9S-lipoxygenase                             67.8    5e-10   
gb|ABX60409.1|  lipoxygease L-4                                       63.2    5e-10   
ref|XP_004486858.1|  PREDICTED: seed linoleate 9S-lipoxygenase-2-...  67.4    6e-10   
gb|KCW61800.1|  hypothetical protein EUGRSUZ_H044982                  62.0    8e-10   
gb|KDO74648.1|  hypothetical protein CISIN_1g002776mg                 52.4    8e-10   
gb|KHN11251.1|  Seed linoleate 9S-lipoxygenase-2                      67.0    9e-10   
gb|ABQ10187.1|  lipoxygenase                                          67.0    9e-10   
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3      67.0    9e-10   
ref|XP_006387349.1|  hypothetical protein POPTR_1202s00195g           62.0    1e-09   
ref|XP_006387350.1|  hypothetical protein POPTR_1202s002002g          54.3    1e-09   
gb|AAY87057.1|  13-lipoxygenase                                       66.2    2e-09   
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5  66.2    2e-09   
gb|AGS94394.3|  lipoxygenase                                          66.2    2e-09   
ref|XP_003627185.1|  Lipoxygenase                                     64.7    2e-09   
gb|AAY87056.1|  13-lipoxygenase                                       65.5    2e-09   
gb|EAZ28259.1|  hypothetical protein OsJ_12231                        60.1    3e-09   
gb|AEU04517.1|  lipoxygenase 2                                        60.5    3e-09   
ref|XP_003627310.1|  Lipoxygenase                                     65.1    3e-09   
gb|AET01657.2|  seed linoleate 9S-lipoxygenase                        64.3    4e-09   
ref|XP_007135516.1|  hypothetical protein PHAVU_010G135900g           65.1    4e-09   



>gb|AAR90846.1| lipoxygenase [Capsicum annuum]
Length=136

 Score =   132 bits (332),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 84/114 (74%), Gaps = 6/114 (5%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M+L KIV  I+GK+D       K +KGTVVL KKNALD  D+ AS LD V E +G++VS 
Sbjct  1    MLLEKIVDVISGKNDDG-----KKMKGTVVLXKKNALDFNDVNASFLDGVLEFLGKRVSL  55

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +LIS+V+ DP  GLQGKR K +YLENW +  TPL AGESA++VTF+WDE IGVP
Sbjct  56   QLISSVHGDPANGLQGKRSKPAYLENWLTTRTPLVAGESAFDVTFDWDEDIGVP  109



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score =   135 bits (339),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 88/122 (72%), Gaps = 10/122 (8%)
 Frame = +3

Query  96   ILGKIVGAITG--------KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHEL  251
            +L  I+ A+TG        K + AA EK + I+G+VVLMKKN LD  D  ASVLD VHEL
Sbjct  1    MLQNIINAVTGDDDGNKKMKRETAAAEKCRKIEGSVVLMKKNVLDFNDFNASVLDRVHEL  60

Query  252  VGQKVSFELISAVNADPE-KGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIG  425
            +GQKVS +LISAVNADP   GLQGK G ++YLE+W S  TPL AGESA++VTF+WDE I 
Sbjct  61   LGQKVSLQLISAVNADPSANGLQGKLGNLAYLEHWISTITPLIAGESAFKVTFDWDEDIA  120

Query  426  VP  431
            +P
Sbjct  121  IP  122


 Score = 41.2 bits (95),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 16/19 (84%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
            A PGAF+I NNHHSEFYLK
Sbjct  120  AIPGAFLIRNNHHSEFYLK  138



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 85/115 (74%), Gaps = 8/115 (7%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M LGKIV AITGK D       K +KGTVVLMKKN LD  DI ASVLD V E +G++VS 
Sbjct  1    MFLGKIVDAITGKDDG------KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSL  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEW-DESIGVP  431
            ELIS+V+ADP  GLQGKR K +YLENW +  TP+AAGESA+ VTF+W DE  GVP
Sbjct  55   ELISSVHADPANGLQGKRSKAAYLENWLTNNTPIAAGESAFRVTFDWDDEEFGVP  109



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 84/119 (71%), Gaps = 8/119 (7%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M L KIV AITGK D       K +KGTVVLMKKN LD  DI ASVLD V E +G++VS 
Sbjct  1    MFLEKIVDAITGKDDG------KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSL  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEW-DESIGVPRGVC  443
            ELIS+VNADP  GLQGKR K +YLENW +  TP+AAGESA+ VTF+W DE  GVP    
Sbjct  55   ELISSVNADPANGLQGKRSKAAYLENWLTNSTPIAAGESAFRVTFDWDDEEFGVPEAFI  113



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 8/115 (7%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M L KIV AITGK D       K +KGTVVLMKKN LD  DI ASVLD V E +G++VS 
Sbjct  1    MFLEKIVDAITGKDDG------KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSL  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEW-DESIGVP  431
            ELIS+VNADP  GLQGKR K +YLENW +  TP+AAGESA+ VTF+W DE  GVP
Sbjct  55   ELISSVNADPANGLQGKRSKAAYLENWLTNSTPIAAGESAFRVTFDWDDEEFGVP  109



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=863

 Score =   136 bits (342),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 84/117 (72%), Gaps = 3/117 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++ AITG H      K   I GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLHNLLDAITGHHHNGGSTKQ--ITGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  58

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            LISAVNAD + GL+GK GK +YLE+W S  TPL AG+SAY+VTF+WD+ IGVP  + 
Sbjct  59   LISAVNADSDNGLKGKLGKPAYLEDWISTITPLTAGDSAYKVTFDWDDEIGVPGAIL  115


 Score = 35.0 bits (79),  Expect(2) = 4e-34, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNHHS+FYLK
Sbjct  111  PGAILIKNNHHSQFYLK  127



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score =   130 bits (328),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 7/113 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++  IVGAITG++D       K IKGTVVLMKKN LD  D  ASVLD VHEL+GQ VS +
Sbjct  1    MIHSIVGAITGENDK------KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQ  54

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            L+SAV+ DP  GLQGK GK +YLE+W +  T L AGESA++VTF+WDE IG P
Sbjct  55   LVSAVHGDPANGLQGKLGKPAYLEDWITTITSLTAGESAFKVTFDWDEEIGEP  107


 Score = 39.3 bits (90),  Expect(2) = 9e-34, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYL+
Sbjct  107  PGAFIIRNNHHSEFYLR  123



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score =   130 bits (327),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 7/113 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++  IVGAITG++D       K IKGTVVLMKKN LD  D  ASVLD VHEL+GQ VS +
Sbjct  1    MIHSIVGAITGENDK------KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQ  54

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            L+SAV+ DP  GLQGK GK +YLE+W +  T L AGESA++VTF+WDE IG P
Sbjct  55   LVSAVHGDPANGLQGKLGKPAYLEDWITTITSLTAGESAFKVTFDWDEEIGEP  107


 Score = 39.3 bits (90),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYL+
Sbjct  107  PGAFIIRNNHHSEFYLR  123



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score =   130 bits (328),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++G ITG+         KI  GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLHNLLGKITGQQQDGESNIGKI-NGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  59

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            LISAV+ DP+ GL+GK GK +YLE+W S  TPL AGESA++VTF+W+E +GVP     Q 
Sbjct  60   LISAVHGDPDNGLKGKLGKQAYLEDWISTITPLTAGESAFKVTFDWEEEVGVPGAFIIQN  119

Query  453  Q  455
             
Sbjct  120  N  120


 Score = 38.9 bits (89),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  112  PGAFIIQNNHHSEFFLK  128



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score =   130 bits (327),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 7/113 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++  IVGAITG++D       K IKGTVVLMKKN LD  D  ASVLD VHEL+GQ VS +
Sbjct  1    MIHSIVGAITGENDK------KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQ  54

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            L+SAV+ DP  GLQGK GK +YLE+W +  T L AGESA++VTF+WDE IG P
Sbjct  55   LVSAVHGDPANGLQGKLGKPAYLEDWITTITSLTAGESAFKVTFDWDEEIGEP  107


 Score = 39.3 bits (90),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYL+
Sbjct  107  PGAFIIRNNHHSEFYLR  123



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score =   130 bits (327),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  I+ AITG H    ++  K IKGTVVLMKKN LD  D  ASVLD VHE +GQ+VS +
Sbjct  1    MLHSIIDAITGDHSNGTKKMVKKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQRVSLQ  60

Query  276  LISAVNADP-EKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            L+SAVN+DP E  L+GK G+ +YLE W +  T L AGESA++VTF+WDE IGVP
Sbjct  61   LVSAVNSDPSENDLKGKLGEPAYLEEWITTITSLTAGESAFKVTFDWDEEIGVP  114


 Score = 39.3 bits (90),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  114  PGAFLIRNNHHSEFYLK  130



>emb|CBI36801.3| unnamed protein product [Vitis vinifera]
Length=738

 Score =   130 bits (327),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 7/113 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++  IVGAITG++D       K IKGTVVLMKKN LD  D  ASVLD VHEL+GQ VS +
Sbjct  1    MIHSIVGAITGENDK------KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQ  54

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            L+SAV+ DP  GLQGK GK +YLE+W +  T L AGESA++VTF+WDE IG P
Sbjct  55   LVSAVHGDPANGLQGKLGKPAYLEDWITTITSLTAGESAFKVTFDWDEEIGEP  107


 Score = 38.9 bits (89),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYL+
Sbjct  107  PGAFIIRNNHHSEFYLR  123



>gb|KCW61797.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=443

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 87/121 (72%), Gaps = 4/121 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++  I  A  G ++A   +K   +KGTVVLMKKN LD  D  ASVLD VHEL GQK+S +
Sbjct  4    VIRGIRHAFDGGNEAGGSKK---VKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            L+SAV+ DPEKGL+GK GK +YLE+W +  TPL AG+SA++VTF+WDE +GVP  +  Q 
Sbjct  61   LVSAVHGDPEKGLRGKLGKPAYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQN  120

Query  453  Q  455
            +
Sbjct  121  K  121



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 85/114 (75%), Gaps = 6/114 (5%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M+L KIV  I+GK+D       K +KGTVVLMKKNALD  D+ AS LD V E +G++VS 
Sbjct  1    MLLEKIVDVISGKNDDG-----KKMKGTVVLMKKNALDFNDVNASFLDGVLEFLGKRVSL  55

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +LIS+V+ DP  GLQGKR K +YLENW +  TPL AGESA++VTF+WDE IGVP
Sbjct  56   QLISSVHGDPANGLQGKRSKPAYLENWLTTRTPLVAGESAFDVTFDWDEDIGVP  109



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score =   128 bits (321),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 84/113 (74%), Gaps = 2/113 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  I+ AITG  +   ++K KIIKG+VVLMKKN LD  D  AS+LD VHEL+GQ+VS +
Sbjct  1    MLHNIINAITGDQNHENDKK-KIIKGSVVLMKKNVLDFNDFHASILDRVHELLGQRVSLQ  59

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LISAVNAD   GL+G  GK +YLE+W +   PL  G+SA++V+FEW++ IGVP
Sbjct  60   LISAVNADRANGLKGMLGKAAYLEDWITTIAPLTPGDSAFKVSFEWEDEIGVP  112


 Score = 39.3 bits (90),  Expect(2) = 6e-33, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  112  PGAFLIRNNHHSEFYLK  128



>gb|KCW61796.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=614

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 87/121 (72%), Gaps = 4/121 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++  I  A  G ++A   +K   +KGTVVLMKKN LD  D  ASVLD VHEL GQK+S +
Sbjct  4    VIRGIRHAFDGGNEAGGSKK---VKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            L+SAV+ DPEKGL+GK GK +YLE+W +  TPL AG+SA++VTF+WDE +GVP  +  Q 
Sbjct  61   LVSAVHGDPEKGLRGKLGKPAYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQN  120

Query  453  Q  455
            +
Sbjct  121  K  121



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score =   128 bits (321),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++G ITG+         KI  GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLHNLLGKITGQQQDGESNIGKI-NGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  59

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            LISAV+ DP+ GL+G  GK +YLE+W +  TPL AGESA++VTF+W+E +GVP     Q 
Sbjct  60   LISAVHGDPDNGLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQN  119

Query  453  Q  455
             
Sbjct  120  N  120


 Score = 38.9 bits (89),  Expect(2) = 6e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  112  PGAFIIQNNHHSEFFLK  128



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score =   128 bits (321),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++G ITG+         KI  GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLHNLLGKITGQQQDGESNIGKI-NGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  59

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            LISAV+ DP+ GL+G  GK +YLE+W +  TPL AGESA++VTF+W+E +GVP     Q 
Sbjct  60   LISAVHGDPDNGLKGNLGKQAYLEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQN  119

Query  453  Q  455
             
Sbjct  120  N  120


 Score = 38.9 bits (89),  Expect(2) = 6e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  112  PGAFIIQNNHHSEFFLK  128



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score =   128 bits (321),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++G ITG+         KI  GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLHNLLGKITGQQQDGESNIGKI-NGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  59

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            LISAV+ DP+ GL+G  GK +YLE+W +  TPL AGESA++VTF+W+E +GVP     Q 
Sbjct  60   LISAVHGDPDNGLKGNLGKQAYLEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQN  119

Query  453  Q  455
             
Sbjct  120  N  120


 Score = 38.9 bits (89),  Expect(2) = 6e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  112  PGAFIIQNNHHSEFFLK  128



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score =   128 bits (321),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++G ITG+         KI  GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLHNLLGKITGQQQDGESNIGKI-NGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  59

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            LISAV+ DP+ GL+G  GK +YLE+W +  TPL AGESA++VTF+W+E +GVP     Q 
Sbjct  60   LISAVHGDPDNGLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQN  119

Query  453  Q  455
             
Sbjct  120  N  120


 Score = 38.9 bits (89),  Expect(2) = 7e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  112  PGAFIIQNNHHSEFFLK  128



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score =   128 bits (321),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++G ITG+         KI  GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLHNLLGKITGQQQDGESNIGKI-NGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  59

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            LISAV+ DP+ GL+G  GK +YLE+W +  TPL AGESA++VTF+W+E +GVP     Q 
Sbjct  60   LISAVHGDPDNGLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQN  119

Query  453  Q  455
             
Sbjct  120  N  120


 Score = 38.9 bits (89),  Expect(2) = 7e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  112  PGAFIIQNNHHSEFFLK  128



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score =   128 bits (321),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++G ITG+         KI  GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLHNLLGKITGQQQDGESNIGKI-NGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  59

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            LISAV+ DP+ GL+G  GK +YLE+W +  TPL AGESA++VTF+W+E +GVP     Q 
Sbjct  60   LISAVHGDPDNGLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQN  119

Query  453  Q  455
             
Sbjct  120  N  120


 Score = 38.9 bits (89),  Expect(2) = 7e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  112  PGAFIIQNNHHSEFFLK  128



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score =   127 bits (320),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++G ITG+         KI  GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLHNLLGKITGQQQDGESNIGKI-NGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  59

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            LISAV+ DP+ GL+G  GK +YLE+W +  TPL AGESA+++TF+W+E +GVP     Q 
Sbjct  60   LISAVHGDPDNGLKGNLGKQAYLEDWITTITPLTAGESAFKITFDWEEEVGVPGAFIIQN  119

Query  453  Q  455
             
Sbjct  120  N  120


 Score = 38.9 bits (89),  Expect(2) = 8e-33, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  112  PGAFIIQNNHHSEFFLK  128



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score =   127 bits (319),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +   I+ AITG H    ++  K IKGTVVLMKKN LD  D  ASVLD VHEL+G  VS +
Sbjct  1    MFHSIIDAITGDHSNGTKKMVKKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGHGVSLQ  60

Query  276  LISAVNADP-EKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            L+SAVN+DP E  L+GK G+ +YLE W +  T L AGESA++VTF+WDE IGVP
Sbjct  61   LVSAVNSDPSENDLKGKLGEPAYLEEWITTITSLTAGESAFKVTFDWDEEIGVP  114


 Score = 39.3 bits (90),  Expect(2) = 9e-33, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  114  PGAFLIRNNHHSEFYLK  130



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score =   132 bits (332),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 87/121 (72%), Gaps = 4/121 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++  I  A  G ++A   +K   +KGTVVLMKKN LD  D  ASVLD VHEL GQK+S +
Sbjct  4    VIRGIRHAFDGGNEAGGSKK---VKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            L+SAV+ DPEKGL+GK GK +YLE+W +  TPL AG+SA++VTF+WDE +GVP  +  Q 
Sbjct  61   LVSAVHGDPEKGLRGKLGKPAYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQN  120

Query  453  Q  455
            +
Sbjct  121  K  121


 Score = 33.5 bits (75),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA ++ N HHS+FYLK
Sbjct  113  PGAIIVQNKHHSQFYLK  129



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 83/115 (72%), Gaps = 8/115 (7%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M L KIV AI+GK D       K +KGTVVLMKKN LD  DI ASVLD V E +G++VS 
Sbjct  1    MSLEKIVDAISGKDDG------KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSL  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEW-DESIGVP  431
            ELIS+V+ DP  GLQGKR K +YLENW +  TP+AAGESA+ VTF+W DE  GVP
Sbjct  55   ELISSVHVDPANGLQGKRSKAAYLENWLTNKTPIAAGESAFRVTFDWDDEEFGVP  109



>ref|NP_001281026.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82794.1| lipoxygenase [Malus domestica]
Length=933

 Score =   126 bits (316),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D   ++  K IKGTVVLMKKN L+L D+ AS LD  HEL G+KVS +LIS+VN DPE GL
Sbjct  80   DHHPKDDDKKIKGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGL  139

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            QGK GK +YLE+W +K TPL A E+A+++TF+WDE IGVP
Sbjct  140  QGKVGKAAYLEDWITKITPLTAEENAFDITFDWDEEIGVP  179


 Score = 37.7 bits (86),  Expect(2) = 6e-32, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHSEFYLK
Sbjct  179  PGAFIIRNEHHSEFYLK  195



>ref|XP_009376681.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Pyrus 
x bretschneideri]
Length=927

 Score =   125 bits (314),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D   ++  K I+GTVVLMKKN L+L D+ AS LD  HEL G+KVS +LIS+VN DPE GL
Sbjct  78   DHHPKDDDKKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGL  137

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            QGK GK +YLE+W +K TPL A E+A+++TF+WDE IGVP
Sbjct  138  QGKVGKAAYLEDWITKITPLTAEENAFDITFDWDEEIGVP  177


 Score = 37.7 bits (86),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHSEFYLK
Sbjct  177  PGAFIIRNEHHSEFYLK  193



>ref|XP_009376680.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Pyrus 
x bretschneideri]
Length=931

 Score =   125 bits (314),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D   ++  K I+GTVVLMKKN L+L D+ AS LD  HEL G+KVS +LIS+VN DPE GL
Sbjct  78   DHHPKDDDKKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGL  137

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            QGK GK +YLE+W +K TPL A E+A+++TF+WDE IGVP
Sbjct  138  QGKVGKAAYLEDWITKITPLTAEENAFDITFDWDEEIGVP  177


 Score = 37.7 bits (86),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHSEFYLK
Sbjct  177  PGAFIIRNEHHSEFYLK  193



>ref|XP_009376660.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=931

 Score =   125 bits (313),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D   ++  K I+GTVVLMKKN L+L D+ AS LD  HEL G+KVS +LIS+VN DPE GL
Sbjct  78   DHHPKDDDKKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGL  137

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            QGK GK +YLE+W +K TPL A E+A+++TF+WDE IGVP
Sbjct  138  QGKVGKAAYLEDWITKITPLTAEENAFDITFDWDEEIGVP  177


 Score = 37.7 bits (86),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHSEFYLK
Sbjct  177  PGAFIIRNEHHSEFYLK  193



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score =   126 bits (316),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 7/114 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L ++V  I G      +   K IKGTVVLMKKN LD  D  AS+LD VHEL+GQKVS +
Sbjct  1    MLHRVVEGIKGN-----DGNDKKIKGTVVLMKKNVLDFNDFNASILDRVHELLGQKVSLQ  55

Query  276  LISAVNADPE-KGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LISAVNAD   KGL+GK GK +YLE+W +  TPL AG+SAY+VTF+WDE IGVP
Sbjct  56   LISAVNADLTVKGLKGKLGKPAYLEDWITTITPLTAGDSAYDVTFDWDEEIGVP  109


 Score = 36.6 bits (83),  Expect(2) = 1e-31, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHSEFYLK
Sbjct  109  PGAFIIRNFHHSEFYLK  125



>ref|XP_007208102.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
 gb|EMJ09301.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
Length=879

 Score =   123 bits (308),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKG VVLMKKN LDL D+ ASVLD V ELVG+ VS +LIS+VN DPEKG  GK GK +
Sbjct  34   KKIKGRVVLMKKNVLDLNDLTASVLDRVDELVGKAVSLQLISSVNGDPEKGSPGKVGKPA  93

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLENW +  TPL AG+SA+++TF+WDE IGVP
Sbjct  94   YLENWITTITPLTAGDSAFDITFDWDEEIGVP  125


 Score = 38.5 bits (88),  Expect(2) = 3e-31, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHSEFYLK
Sbjct  125  PGAFIIRNDHHSEFYLK  141



>ref|XP_008246452.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=896

 Score =   123 bits (308),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKG VVLMKKN LDL D+ ASVLD V ELVG+ VS +LIS+VN DPEKG  GK GK +YL
Sbjct  80   IKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAYL  139

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            ENW +  TPL AG+SA+++TF+WDE IGVP
Sbjct  140  ENWITTITPLTAGDSAFDITFDWDEEIGVP  169


 Score = 38.1 bits (87),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHSEFYLK
Sbjct  169  PGAFIIRNDHHSEFYLK  185



>ref|XP_008245950.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   123 bits (308),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKG VVLMKKN LDL D+ ASVLD V ELVG+ VS +LIS+VN DPEKG  GK GK +YL
Sbjct  80   IKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAYL  139

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            ENW +  TPL AG+SA+++TF+WDE IGVP
Sbjct  140  ENWITTITPLTAGDSAFDITFDWDEEIGVP  169


 Score = 38.1 bits (87),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHSEFYLK
Sbjct  169  PGAFIIRNDHHSEFYLK  185



>ref|XP_008246451.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   123 bits (308),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKG VVLMKKN LDL D+ ASVLD V ELVG+ VS +LIS+VN DPEKG  GK GK +YL
Sbjct  80   IKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAYL  139

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            ENW +  TPL AG+SA+++TF+WDE IGVP
Sbjct  140  ENWITTITPLTAGDSAFDITFDWDEEIGVP  169


 Score = 38.1 bits (87),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHSEFYLK
Sbjct  169  PGAFIIRNDHHSEFYLK  185



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score =   122 bits (306),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 2/114 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEE-KPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            +LG+IV  + G+ D   E+ K +IIKG VVLMKKN LD  D+ ASVLD  HELVG KVS 
Sbjct  1    MLGEIVETLVGRKDEDDEQQKKRIIKGRVVLMKKNVLDFNDLAASVLDRFHELVGHKVSL  60

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +LIS+VN D E  ++GK GK +YLE W +  T L  G+SA++V+F+W+E +GVP
Sbjct  61   QLISSVNTDSENRVKGKVGKAAYLEKWITTFTSLTPGDSAFDVSFDWEEEVGVP  114


 Score = 38.9 bits (89),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+INN HHSEFYLK
Sbjct  114  PGAFIINNLHHSEFYLK  130



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score =   125 bits (313),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 83/115 (72%), Gaps = 3/115 (3%)
 Frame = +3

Query  114  GAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVN  293
            G+  G+   AA  K K+I GTVVLMKK  LD  D  ASVLDT+HEL+G+KVS  L+SAV+
Sbjct  15   GSKAGRQRKAAGSK-KVI-GTVVLMKKYVLDFNDFNASVLDTIHELLGEKVSLRLVSAVH  72

Query  294  ADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQQ  455
            +DPE GLQGK GK +YLE W +  TPL AG+SA++VTF+WD+ +GVP  +  Q  
Sbjct  73   SDPENGLQGKLGKPAYLEKWITTITPLTAGDSAFKVTFDWDKEVGVPGAIIVQNN  127


 Score = 36.2 bits (82),  Expect(2) = 5e-31, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA ++ NNHHS+FYLK
Sbjct  119  PGAIIVQNNHHSQFYLK  135



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score =   125 bits (313),  Expect(2) = 6e-31, Method: Composition-based stats.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 5/114 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  IV A TGK++   EE  K IKG VVLMKKN LD  D G SVLD VHEL+GQKVS +
Sbjct  1    MLSHIVEAFTGKNE---EENKKKIKGKVVLMKKNVLDFNDFGGSVLDRVHELLGQKVSLQ  57

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEW-DESIGVP  431
            LIS++N DPE  L+GK G+ +YLE+W +  T L  G+SA+ VTF+W +E IG+P
Sbjct  58   LISSINGDPENKLKGKLGRAAYLEDWITTFTSLTPGDSAFHVTFDWEEEEIGIP  111


 Score = 35.4 bits (80),  Expect(2) = 6e-31, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HH+EFYLK
Sbjct  111  PGAFIIQNFHHTEFYLK  127



>ref|XP_010025193.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61802.1| hypothetical protein EUGRSUZ_H04499 [Eucalyptus grandis]
Length=871

 Score =   124 bits (310),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = +3

Query  150  EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRG  329
            ++ K +KGTVVLMKK  LD  D  ASVLD V EL+G+KVS  L+SAV+ DPEKGL+GK G
Sbjct  25   DRSKKVKGTVVLMKKYVLDFNDFNASVLDNVAELLGKKVSLRLVSAVHGDPEKGLRGKLG  84

Query  330  KVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQQ  455
            K +YLE W +  TPLAAG+SA++VTF+WDE +GVP  +  Q  
Sbjct  85   KPAYLEEWITTITPLAAGDSAFKVTFDWDEEVGVPGAIIVQNN  127


 Score = 36.2 bits (82),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA ++ NNHHS+FYLK
Sbjct  119  PGAIIVQNNHHSQFYLK  135



>gb|KDO56302.1| hypothetical protein CISIN_1g002839mg [Citrus sinensis]
Length=874

 Score =   120 bits (301),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 85/126 (67%), Gaps = 14/126 (11%)
 Frame = +3

Query  96   ILGKIVGAIT----------GKHDAAAEE-KPKIIKGTVVLMKKNALDLKDIGASVLDTV  242
            +LG I+ AIT          G      E+ K K IKGTVVLMKKN LD  D  AS LD  
Sbjct  1    MLGHIIDAITCCGDDRDDNNGNKKMKCEKGKCKKIKGTVVLMKKNVLDFNDFNASFLDRF  60

Query  243  HELVGQKVSFELISAVNADP-EKGLQ-GKRGKVSYLENW-SKPTPLAAGESAYEVTFEWD  413
            HEL+G+KV+ +LISAV+ +P E GLQ GK GK++++E W  K TPLAAGESA+ VTFEWD
Sbjct  61   HELLGRKVTLQLISAVHGEPAENGLQAGKIGKLAHIEGWIPKCTPLAAGESAFNVTFEWD  120

Query  414  ESIGVP  431
            E IGVP
Sbjct  121  EDIGVP  126


 Score = 39.3 bits (90),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  126  PGAFLIRNNHHSEFYLK  142



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score =   120 bits (300),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 85/126 (67%), Gaps = 14/126 (11%)
 Frame = +3

Query  96   ILGKIVGAIT----------GKHDAAAEE-KPKIIKGTVVLMKKNALDLKDIGASVLDTV  242
            +LG I+ AIT          G      E+ K K IKGTVVLMKKN LD  D  AS LD  
Sbjct  1    MLGHIIDAITCCGDDRDDNNGNKKMKCEKGKCKKIKGTVVLMKKNVLDFNDFNASFLDRF  60

Query  243  HELVGQKVSFELISAVNADP-EKGLQ-GKRGKVSYLENW-SKPTPLAAGESAYEVTFEWD  413
            HEL+G+KV+ +LISAV+ +P E GLQ GK GK++++E W  K TPLAAGESA+ VTFEWD
Sbjct  61   HELLGRKVTLQLISAVHGEPAENGLQAGKIGKLAHIEGWIPKCTPLAAGESAFNVTFEWD  120

Query  414  ESIGVP  431
            E IGVP
Sbjct  121  EDIGVP  126


 Score = 39.3 bits (90),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  126  PGAFLIRNNHHSEFYLK  142



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score =   124 bits (311),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 83/114 (73%), Gaps = 5/114 (4%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M+L KIV AI+G+    +E+  K +KGT+VLMKKN LD  D+ AS+LD V E +G++VS 
Sbjct  1    MLLEKIVEAISGR----SEDNGKKVKGTIVLMKKNVLDFNDVNASLLDGVLEFLGKRVSL  56

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +LIS V+ADP   LQGKR   +YLE W +  T L AGESA++VTF+WDE IGVP
Sbjct  57   QLISVVHADPGNSLQGKRSNPAYLEKWLTTGTSLVAGESAFDVTFDWDEDIGVP  110


 Score = 34.3 bits (77),  Expect(2) = 3e-30, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+INN H +EFYLK
Sbjct  110  PGAFIINNFHFNEFYLK  126



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score =   119 bits (298),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 76/109 (70%), Gaps = 7/109 (6%)
 Frame = +3

Query  108  IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISA  287
            IV AITG++D       K I+GT+VLMKKN LD  D  A V D VHEL GQ VS +L+SA
Sbjct  21   IVSAITGENDK------KKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSA  74

Query  288  VNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            V+ DP  GLQGK GK +YLE+W    T L AGESA++VTF+WDE IG P
Sbjct  75   VHGDPANGLQGKIGKPAYLEDWIITITSLTAGESAFKVTFDWDEEIGEP  123


 Score = 39.3 bits (90),  Expect(2) = 3e-30, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYL+
Sbjct  123  PGAFIIRNNHHSEFYLR  139



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   119 bits (298),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 76/109 (70%), Gaps = 7/109 (6%)
 Frame = +3

Query  108  IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISA  287
            IV AITG++D       K I+GT+VLMKKN LD  D  A V D VHEL GQ VS +L+SA
Sbjct  46   IVSAITGENDK------KKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSA  99

Query  288  VNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            V+ DP  GLQGK GK +YLE+W    T L AGESA++VTF+WDE IG P
Sbjct  100  VHGDPANGLQGKIGKPAYLEDWIITITSLTAGESAFKVTFDWDEEIGEP  148


 Score = 38.9 bits (89),  Expect(2) = 3e-30, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYL+
Sbjct  148  PGAFIIRNNHHSEFYLR  164



>ref|XP_006419897.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33137.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=656

 Score =   121 bits (303),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +3

Query  120  ITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNAD  299
            ITG      +E    IKGTVVLMKKN LD  D+ AS LD +HEL+G+ VS +LISAVNAD
Sbjct  22   ITGTKTKGVDESKTKIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNAD  81

Query  300  PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            P   L+G+ GKV+YLE W +  TPL A E+ + +TF+WDE++GVP
Sbjct  82   PANELRGRLGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVP  126


 Score = 37.0 bits (84),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  418  ASAFPGAFVINNNHHSEFYLK  480
            A   PGAF+I N+HHS+FYLK
Sbjct  122  AMGVPGAFIIRNHHHSQFYLK  142



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score =   120 bits (300),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 81/114 (71%), Gaps = 5/114 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  IV  +TG     +  K   I GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLQNIVEKLTGHQQNGSHGK---INGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  57

Query  276  LISAVNA-DPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LISAV A D E GL+GK GK +YLE+W +  TPL AGESA++VTF+++E +GVP
Sbjct  58   LISAVRADDSENGLKGKLGKPAYLEDWITTITPLTAGESAFKVTFDYEEEVGVP  111


 Score = 37.7 bits (86),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  111  PGAFLIKNNHHSEFFLK  127



>ref|XP_006419896.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33136.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=627

 Score =   120 bits (302),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +3

Query  120  ITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNAD  299
            ITG      +E    IKGTVVLMKKN LD  D+ AS LD +HEL+G+ VS +LISAVNAD
Sbjct  22   ITGTKTKGVDESKTKIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNAD  81

Query  300  PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            P   L+G+ GKV+YLE W +  TPL A E+ + +TF+WDE++GVP
Sbjct  82   PANELRGRLGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVP  126


 Score = 37.0 bits (84),  Expect(2) = 4e-30, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  418  ASAFPGAFVINNNHHSEFYLK  480
            A   PGAF+I N+HHS+FYLK
Sbjct  122  AMGVPGAFIIRNHHHSQFYLK  142



>gb|KDO74649.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=627

 Score =   120 bits (302),  Expect(2) = 5e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +3

Query  120  ITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNAD  299
            ITG      +E    IKGTVVLMKKN LD  D+ AS LD +HEL+G+ VS +LISAVNAD
Sbjct  22   ITGTKTKGVDESKTKIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNAD  81

Query  300  PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            P   L+G+ GKV+YLE W +  TPL A E+ + +TF+WDE++GVP
Sbjct  82   PANELRGRLGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVP  126


 Score = 37.0 bits (84),  Expect(2) = 5e-30, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  418  ASAFPGAFVINNNHHSEFYLK  480
            A   PGAF+I N+HHS+FYLK
Sbjct  122  AMGVPGAFIIRNHHHSQFYLK  142



>gb|KDO74650.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
 gb|KDO74651.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=555

 Score =   120 bits (300),  Expect(2) = 6e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +3

Query  120  ITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNAD  299
            ITG      +E    IKGTVVLMKKN LD  D+ AS LD +HEL+G+ VS +LISAVNAD
Sbjct  22   ITGTKTKGVDESKTKIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNAD  81

Query  300  PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            P   L+G+ GKV+YLE W +  TPL A E+ + +TF+WDE++GVP
Sbjct  82   PANELRGRLGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVP  126


 Score = 37.0 bits (84),  Expect(2) = 6e-30, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  418  ASAFPGAFVINNNHHSEFYLK  480
            A   PGAF+I N+HHS+FYLK
Sbjct  122  AMGVPGAFIIRNHHHSQFYLK  142



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score =   120 bits (300),  Expect(2) = 6e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +3

Query  120  ITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNAD  299
            ITG      +E    IKGTVVLMKKN LD  D+ AS LD +HEL+G+ VS +LISAVNAD
Sbjct  22   ITGTKTKGVDESKTKIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNAD  81

Query  300  PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            P   L+G+ GKV+YLE W +  TPL A E+ + +TF+WDE++GVP
Sbjct  82   PANELRGRLGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVP  126


 Score = 37.4 bits (85),  Expect(2) = 6e-30, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  418  ASAFPGAFVINNNHHSEFYLK  480
            A   PGAF+I N+HHS+FYLK
Sbjct  122  AMGVPGAFIIRNHHHSQFYLK  142



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score =   119 bits (299),  Expect(2) = 7e-30, Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = +3

Query  120  ITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNAD  299
            ITG      +E    IKGTVVLMKKN LD  D+ AS LD +HEL+G+ VS +LISAVNAD
Sbjct  22   ITGTKTKGVDESKTKIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNAD  81

Query  300  PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            P   L+G+ GKV+YLE W +  TPL A E+ + +TF+WDE++GVP
Sbjct  82   PANELRGRLGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVP  126


 Score = 37.4 bits (85),  Expect(2) = 7e-30, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  418  ASAFPGAFVINNNHHSEFYLK  480
            A   PGAF+I N+HHS+FYLK
Sbjct  122  AMGVPGAFIIRNHHHSQFYLK  142



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score =   121 bits (303),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKG VVLMKKN LDL D  ASVLD VHEL+G+ VS  LIS+V  +PEKG QGK GK +
Sbjct  105  KKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGEPEKGFQGKLGKPA  164

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +  TPL AGESA++VTF+W++ IGVP
Sbjct  165  YLEDWITTITPLTAGESAFKVTFDWEDEIGVP  196


 Score = 35.8 bits (81),  Expect(2) = 7e-30, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHH+EF+LK
Sbjct  196  PGAFLIINNHHTEFFLK  212



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score =   120 bits (302),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKG VVLMKKN LDL D  ASVLD VHEL+G+ VS  LIS+V  DPEKG QGK G  +
Sbjct  15   KKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGDPEKGFQGKLGNPA  74

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +  TPL AGESA++VTF+W++ IGVP
Sbjct  75   YLEDWITTITPLTAGESAFKVTFDWEDEIGVP  106


 Score = 35.8 bits (81),  Expect(2) = 8e-30, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHH+EF+LK
Sbjct  106  PGAFLIINNHHTEFFLK  122



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score =   122 bits (306),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 6/114 (5%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M+L KIV  I+GK      E  K +KGTVVLMKKN LD  D+ AS+LD V E +G++VS 
Sbjct  1    MLLEKIVEVISGK-----SENVKKVKGTVVLMKKNVLDFNDVNASLLDGVLEFLGKRVSL  55

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +LISAV+ADP   LQGKR   +YLE W +  T L AGESA++VTF+WD+ IGVP
Sbjct  56   QLISAVHADPGNTLQGKRSNPAYLEKWLTTGTSLVAGESAFDVTFDWDDDIGVP  109


 Score = 34.3 bits (77),  Expect(2) = 1e-29, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+INN H +EFYLK
Sbjct  109  PGAFIINNFHFNEFYLK  125



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score =   116 bits (290),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 78/118 (66%), Gaps = 6/118 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKP-----KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQ  260
            +   IV AITG  +   + K      K IKGTVVLMKKN LD  D  AS LD +HEL G 
Sbjct  1    MFQNIVDAITGDSNGNKKMKCVSGDCKKIKGTVVLMKKNVLDFNDFNASFLDGIHELAGH  60

Query  261  KVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             VS +LIS+VN++PE GLQGK G+ + LE+W +  TP   G+SA+ VTF+WD+ IG+P
Sbjct  61   GVSLQLISSVNSEPENGLQGKVGEPALLEDWITTFTPATPGDSAFRVTFDWDDEIGIP  118


 Score = 40.0 bits (92),  Expect(2) = 1e-29, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  118  PGAFIIRNNHHSEFYLK  134



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score =   116 bits (291),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADP-EKGLQGKRGKV  335
            K IKGTVVLMKKN LD  D  ASVLD VHE +GQ VS +L+SAVN+DP E  L+GK G+ 
Sbjct  3    KKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQGVSLQLVSAVNSDPSENDLKGKLGEP  62

Query  336  SYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +YLE W +  T L AGESA++VTF+WDE IGVP
Sbjct  63   AYLEEWITTITSLTAGESAFKVTFDWDEEIGVP  95


 Score = 39.3 bits (90),  Expect(2) = 1e-29, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  95   PGAFLIRNNHHSEFYLK  111



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score =   118 bits (295),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 5/114 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  IV  +TG        K   I GTVVLMKKN LD  D  ASVLD VHELVGQ+VS +
Sbjct  1    MLQNIVEKLTGHQQNENHGK---INGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQ  57

Query  276  LISAVNA-DPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LISAV+A D E GL+GK G+ +YLE+W +  TPL AGESA++VTF+++E +GVP
Sbjct  58   LISAVHADDSENGLKGKLGQPAYLEDWITTITPLTAGESAFKVTFDYEEEVGVP  111


 Score = 37.7 bits (86),  Expect(2) = 1e-29, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  111  PGAFLIKNNHHSEFFLK  127



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score =   120 bits (300),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 90/137 (66%), Gaps = 15/137 (11%)
 Frame = +3

Query  69   VVFSRK-----LRMILGK-------IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLK  212
            ++FSRK     L ++LG+       +   ITG+       +   IKGTVVL+KKN LD  
Sbjct  33   LLFSRKKDHKILCLLLGQPNKMLHNLFDKITGQEQNGKNSRK--IKGTVVLIKKNVLDFN  90

Query  213  DIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESA  389
            DI ASVLD VHEL+GQ+VS +LISA + D E G +GK G+ +YLE+W +  TPL  G+SA
Sbjct  91   DINASVLDRVHELLGQRVSLQLISADHGDSENGFKGKLGEPAYLEDWITTITPLTVGDSA  150

Query  390  YEVTFEWDESIGVPRGV  440
            Y+VTF+W+E IGVP  +
Sbjct  151  YKVTFDWEEEIGVPGAI  167


 Score = 35.4 bits (80),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNHHSEF+LK
Sbjct  164  PGAILIKNNHHSEFFLK  180



>gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score =   115 bits (287),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 6/118 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKP-----KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQ  260
            +L  IVGAITG  + + + K      K I G+VVLMKKN LD  D  AS+LD VHEL G 
Sbjct  1    MLQNIVGAITGDSNGSKKIKCVSGECKKITGSVVLMKKNVLDFNDFHASLLDRVHELFGH  60

Query  261  KVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             VS +LIS+V ++ E GLQGK G+ +YLE+W +   PL  G+SA++VTF+W+E IG+P
Sbjct  61   GVSLQLISSVTSESENGLQGKVGEPAYLEDWITTIAPLTPGDSAFKVTFDWNEEIGIP  118


 Score = 40.0 bits (92),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  118  PGAFIIKNNHHSEFYLK  134



>ref|XP_010277584.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nelumbo 
nucifera]
Length=883

 Score =   121 bits (304),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = +3

Query  69   VVFSRKLRM--ILGKIVGAITGKHD--AAAEEKPKIIKGTVVLMKKNALDLKDIGASVLD  236
            V+FS   ++  +  KI+ ++TGK     A     K IKGTVVLMKKN LD  D+ ASVLD
Sbjct  3    VLFSALFKIPGMFHKIMDSVTGKETRLNAGVGGKKKIKGTVVLMKKNVLDFNDLHASVLD  62

Query  237  TVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWD  413
             VHELVG+ V+ +LIS+VN DP  GL+GK GK +YLE W +  TPL+AGES++ +TF+WD
Sbjct  63   RVHELVGKGVALQLISSVNTDPANGLRGKLGKEAYLEEWITTITPLSAGESSFNITFDWD  122

Query  414  ESIGVP  431
            E IGVP
Sbjct  123  EGIGVP  128


 Score = 33.5 bits (75),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+F+LK
Sbjct  128  PGAFIIRNFHHSQFFLK  144



>gb|KCW44986.1| hypothetical protein EUGRSUZ_L01433 [Eucalyptus grandis]
Length=636

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 82/117 (70%), Gaps = 4/117 (3%)
 Frame = +3

Query  108  IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISA  287
            I+ A  G  +A   +K   +KGTVVLMKKN L+  D  ASVLD V EL GQKVS +L+SA
Sbjct  8    ILPAFDGGDEAGGSKK---VKGTVVLMKKNVLNFNDFNASVLDLVFELFGQKVSLQLVSA  64

Query  288  VNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQQ  455
            V+ DPEKGL+GK GK +YLE+W +  T L AG+SA+ VTF+WDE +GVP  +  Q +
Sbjct  65   VHGDPEKGLRGKLGKPAYLEDWITTSTLLKAGDSAFMVTFDWDEEVGVPGAIIVQNK  121



>ref|XP_011026284.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   120 bits (301),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = +3

Query  150  EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRG  329
            E  + IKGTVVLMKKN LD  DI AS LD VHEL+G+ VS +L+SAV+ DP  GL+GK G
Sbjct  31   EGRRKIKGTVVLMKKNVLDFTDIKASFLDRVHELLGKGVSMQLVSAVHQDPADGLRGKLG  90

Query  330  KVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGV  440
            KV+YLE W +  TPL AGE+ + +TFEWDES+G P  +
Sbjct  91   KVAYLEKWVATITPLTAGETMFTITFEWDESMGFPGAI  128


 Score = 34.7 bits (78),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             FPGA +I N+HHS+ YLK
Sbjct  123  GFPGAIIIKNHHHSQLYLK  141



>ref|XP_010040715.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=656

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 82/117 (70%), Gaps = 4/117 (3%)
 Frame = +3

Query  108  IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISA  287
            I+ A  G  +A   +K   +KGTVVLMKKN L+  D  ASVLD V EL GQKVS +L+SA
Sbjct  8    ILPAFDGGDEAGGSKK---VKGTVVLMKKNVLNFNDFNASVLDLVFELFGQKVSLQLVSA  64

Query  288  VNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQQ  455
            V+ DPEKGL+GK GK +YLE+W +  T L AG+SA+ VTF+WDE +GVP  +  Q +
Sbjct  65   VHGDPEKGLRGKLGKPAYLEDWITTSTLLKAGDSAFMVTFDWDEEVGVPGAIIVQNK  121



>ref|XP_008388961.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=922

 Score =   118 bits (295),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKG VVLMKK  LDL D+ AS+LD VHEL+G+ VS  LIS+VN+DPE    GK GK +
Sbjct  78   KKIKGRVVLMKKIVLDLNDLKASILDRVHELLGKAVSLRLISSVNSDPENESTGKVGKPA  137

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLENW +  TPL AGE+A++VTF+WDE IGVP
Sbjct  138  YLENWVTTITPLTAGETAFDVTFDWDEEIGVP  169


 Score = 36.6 bits (83),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF++ N HHSEFYLK
Sbjct  169  PGAFIVRNYHHSEFYLK  185



>ref|XP_004302419.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=919

 Score =   120 bits (301),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKGTVVLMKKN L+L D+GAS +D VHEL+G+ VS  L+SAVN DP  G +GK GK +YL
Sbjct  77   IKGTVVLMKKNLLELNDLGASFIDRVHELLGKAVSLRLVSAVNTDPANGNRGKIGKAAYL  136

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            ENW SK TPL A E A++V F WDE IGVP
Sbjct  137  ENWISKVTPLTAAECAFKVNFVWDEKIGVP  166


 Score = 33.9 bits (76),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H SEFYLK
Sbjct  166  PGAFIIRNEHASEFYLK  182



>gb|KHN16119.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=852

 Score =   114 bits (284),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADP--EKGLQGKRGKVS  338
            +KGTVVLMKKN LD  D  AS LD +HE VG++VS +L+S+VN DP    GL+GK GK +
Sbjct  23   VKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKLGKPA  82

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +   PL AGE+A++VTFEWDE IG P
Sbjct  83   YLEDWITTIAPLTAGEAAFKVTFEWDEEIGTP  114


 Score = 40.4 bits (93),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  114  PGAFIIRNNHHSEFYLK  130



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score =   114 bits (284),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 3/92 (3%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADP--EKGLQGKRGKVS  338
            +KGTVVLMKKN LD  D  AS LD +HE VG++VS +L+S+VN DP    GL+GK GK +
Sbjct  23   VKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKLGKPA  82

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +   PL AGE+A++VTFEWDE IG P
Sbjct  83   YLEDWITTIAPLTAGEAAFKVTFEWDEEIGTP  114


 Score = 40.4 bits (93),  Expect(2) = 4e-29, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  114  PGAFIIRNNHHSEFYLK  130



>dbj|BAE44117.1| lipoxigenase [Nicotiana tabacum]
Length=96

 Score =   113 bits (283),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKGTVVLMKKN LDLKD+GAS LD VHE+ G+ VS +LISA +A+P  G +GK GK ++L
Sbjct  1    IKGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPAFL  60

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            E W S  T ++AG++ + VTF+WDES+GVP
Sbjct  61   EKWMSTLTSISAGDATFNVTFDWDESMGVP  90



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score =   121 bits (303),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 7/119 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKP-----KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQ  260
            +   I+ AITG  D + + K      K IKGTVVLMKKN L   D  AS+LD VHEL+GQ
Sbjct  1    MFQSIIDAITGNSDGSKKLKRGDGECKKIKGTVVLMKKNVLSFNDFHASILDRVHELLGQ  60

Query  261  KVSFELISAVNAD-PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +VS +LISAVN+D  E  L+GK G+ +YLE W +  TPL AGE+A++VTF+WDE IGVP
Sbjct  61   RVSLQLISAVNSDRSENDLKGKLGEPAYLEEWVTTVTPLTAGEAAFKVTFDWDEEIGVP  119


 Score = 32.7 bits (73),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNH +EFYL+
Sbjct  119  PGAFLIRNNHLNEFYLR  135



>gb|KJB80989.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=865

 Score =   114 bits (286),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 56/113 (50%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++ A+ G  +   + KP+ IKGTV+LMKKN LD  D  AS LD  HEL+G++VSF+
Sbjct  1    MLSHLLHAVAGDDNGNEKMKPEKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+ + D + GLQGK GK +YLE+W S  T   AGES ++V F+++E IG+P
Sbjct  61   LISSQHVDADNGLQGKLGKEAYLEDWNSTETSAVAGESKFDVNFDFEEEIGLP  113


 Score = 39.3 bits (90),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGAF+I NNHHSEFYLK
Sbjct  111  GLPGAFLIKNNHHSEFYLK  129



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score =   114 bits (286),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 56/113 (50%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++ A+ G  +   + KP+ IKGTV+LMKKN LD  D  AS LD  HEL+G++VSF+
Sbjct  1    MLSHLLHAVAGDDNGNKKMKPEKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+ + D + GLQGK GK +YLE+W S  T   AGES ++V F+++E IG+P
Sbjct  61   LISSQHVDADNGLQGKLGKEAYLEDWNSTETSAVAGESKFDVNFDFEEEIGLP  113


 Score = 39.3 bits (90),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGAF+I NNHHSEFYLK
Sbjct  111  GLPGAFLIKNNHHSEFYLK  129



>ref|XP_004494612.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=863

 Score =   113 bits (282),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = +3

Query  162  IIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSY  341
            +I+G VVLMKKN LD  D+ AS LD +HE VG++VS +L+SAV  DP   ++GK GK  Y
Sbjct  21   MIRGKVVLMKKNVLDFNDLSASFLDDLHEFVGKRVSLQLVSAVKVDPGNDMKGKVGKAEY  80

Query  342  LENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LE+W +  TPL AGES + VTF+WDE IG P
Sbjct  81   LEDWITTSTPLIAGESTFSVTFDWDEDIGTP  111


 Score = 40.4 bits (93),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  111  PGAFIIKNNHHSEFYLK  127



>ref|XP_008246455.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=849

 Score =   118 bits (295),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  +   ITG+       +   IKGT+VLMKKN LD  D  ASVLD VHEL+GQ+VS +
Sbjct  1    MLHNLFDKITGQEQNGKNSRK--IKGTLVLMKKNVLDFNDFNASVLDGVHELLGQRVSLQ  58

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            LISA + D E G +GK G+ +YLE+W +  TPL  G+SAY+VTF+W+E IGVP  + 
Sbjct  59   LISADHGDSENGFKGKLGEPAYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAIL  115


 Score = 35.4 bits (80),  Expect(2) = 8e-29, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNHHSEF+LK
Sbjct  111  PGAILIKNNHHSEFFLK  127



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score =   117 bits (294),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  +   ITG+       +   IKGTVVLMKKN LD  D  ASVLD VHEL+GQ VS +
Sbjct  1    MLHNLFDKITGQEQNGKNSRK--IKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQ  58

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            LISA + D E G +GK G+ +YLE+W +  TPL  G+SAY+VTF+W+E IGVP  + 
Sbjct  59   LISADHGDSENGFKGKLGEPAYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAIL  115


 Score = 35.4 bits (80),  Expect(2) = 8e-29, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNHHSEF+LK
Sbjct  111  PGAILIKNNHHSEFFLK  127



>gb|KDP40158.1| hypothetical protein JCGZ_02156 [Jatropha curcas]
Length=867

 Score =   117 bits (293),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = +3

Query  129  KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEK  308
            K    AEE+ KI KG VVLMKKN LD  D+ AS  D +HEL G+ VS +LISAVN DPE 
Sbjct  11   KAKGMAEERFKI-KGKVVLMKKNVLDFNDVTASCFDRIHELFGKGVSIQLISAVNPDPEN  69

Query  309  GLQGKRGKVSYLENWSKP-TPLAAGESAYEVTFEWDESIGVP  431
             L+GK GKV++LE+W K  TP+AA E+ + +TF+WDES+ VP
Sbjct  70   DLRGKHGKVAFLESWVKKITPMAAQETEFNITFDWDESMAVP  111


 Score = 35.8 bits (81),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
            A PGAF+I N+HHS+ YLK
Sbjct  109  AVPGAFIIRNHHHSQLYLK  127



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score =   117 bits (293),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  +   ITG+       +   IKGTVVLMKKN LD  D  ASVLD VHEL+GQ VS +
Sbjct  1    MLHNLFDKITGQEQNGKNSRK--IKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQ  58

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            LISA + D E G +GK G+ +YLE+W +  TPL  G+SAY+VTF+W+E IGVP  + 
Sbjct  59   LISADHGDSENGFKGKLGEPAYLEDWITTITPLTIGDSAYKVTFDWEEEIGVPGAIL  115


 Score = 35.4 bits (80),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNHHSEF+LK
Sbjct  111  PGAILIKNNHHSEFFLK  127



>ref|XP_009376663.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376684.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=868

 Score =   115 bits (287),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 76/108 (70%), Gaps = 5/108 (5%)
 Frame = +3

Query  123  TGKHDAAAEEKPKI----IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAV  290
            T   D   + +PK     IKG VVLMKK  LD+ D+ AS+LD V EL+G+ VS  LIS+V
Sbjct  8    TSSQDTTVDTQPKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSV  67

Query  291  NADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            N DPE  L+GK GK +YLENW +  TPL AGE+A++VTF+WD+ IGVP
Sbjct  68   NGDPENELKGKVGKPAYLENWVTTITPLTAGEAAFDVTFDWDKEIGVP  115


 Score = 37.7 bits (86),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAFV+ N HHSEFYLK
Sbjct  115  PGAFVVRNEHHSEFYLK  131



>ref|XP_002311617.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE88984.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   118 bits (295),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKGTVVLMKKN LD  DI AS LD VHEL+G+ VS +L+SAV+ DP+ GL+GK GKV+YL
Sbjct  36   IKGTVVLMKKNVLDFNDIKASFLDRVHELLGKGVSMQLVSAVHQDPD-GLRGKLGKVAYL  94

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVPRGV  440
            E W +  TPL AGE+ + +TFEWDES+G P  +
Sbjct  95   EKWVTTITPLTAGETMFTITFEWDESMGFPGAI  127


 Score = 34.7 bits (78),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             FPGA +I N+HHS+ YLK
Sbjct  122  GFPGAIIIKNHHHSQLYLK  140



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score =   112 bits (280),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +3

Query  162  IIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSY  341
            II+GTV++ KKN LD  D+ AS+LD +HE VG++VS +LISAV ADP  G++GK GK +Y
Sbjct  15   IIRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNGMKGKLGKPAY  74

Query  342  LENW-SKPTPLAAGESAYEVTFEW--DESIGVP  431
            LE+W +  TPL AGESA+ V F+W  DE IG P
Sbjct  75   LEDWITTITPLTAGESAFRVAFDWNGDEDIGTP  107


 Score = 40.4 bits (93),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  406  NGTRASAFPGAFVINNNHHSEFYLK  480
            NG      PGAF++ NNHHSEFYLK
Sbjct  99   NGDEDIGTPGAFLVRNNHHSEFYLK  123



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score =   112 bits (280),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +3

Query  162  IIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSY  341
            II+GTV++ KKN LD  D+ AS+LD +HE VG++VS +LISAV ADP  G++GK GK +Y
Sbjct  15   IIRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNGMKGKLGKPAY  74

Query  342  LENW-SKPTPLAAGESAYEVTFEW--DESIGVP  431
            LE+W +  TPL AGESA+ V F+W  DE IG P
Sbjct  75   LEDWITTITPLTAGESAFRVAFDWNGDEDIGTP  107


 Score = 40.4 bits (93),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  406  NGTRASAFPGAFVINNNHHSEFYLK  480
            NG      PGAF++ NNHHSEFYLK
Sbjct  99   NGDEDIGTPGAFLVRNNHHSEFYLK  123



>ref|XP_009763870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=883

 Score =   118 bits (296),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 61/118 (52%), Positives = 84/118 (71%), Gaps = 6/118 (5%)
 Frame = +3

Query  96   ILGKIVGAITGK-HDAAAEEKP----KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQ  260
            +L K++  + GK HD   E+      K ++GTVVLMKKN LDLKD+GAS LD VHE+ G+
Sbjct  11   MLDKLLQVVCGKNHDPTIEDNNHTNGKKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGK  70

Query  261  KVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             VS +LISA +A+P  G +GK GK ++LE W S  T ++AG++ + VTF+WDES+GVP
Sbjct  71   GVSLQLISADHAEPGNGCKGKLGKPAFLEKWMSTLTSISAGDATFNVTFDWDESMGVP  128


 Score = 34.3 bits (77),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYL+
Sbjct  128  PGAFIIKNYHHSQFYLR  144



>ref|XP_009763875.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=873

 Score =   118 bits (296),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 61/118 (52%), Positives = 84/118 (71%), Gaps = 6/118 (5%)
 Frame = +3

Query  96   ILGKIVGAITGK-HDAAAEEKP----KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQ  260
            +L K++  + GK HD   E+      K ++GTVVLMKKN LDLKD+GAS LD VHE+ G+
Sbjct  1    MLDKLLQVVCGKNHDPTIEDNNHTNGKKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGK  60

Query  261  KVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             VS +LISA +A+P  G +GK GK ++LE W S  T ++AG++ + VTF+WDES+GVP
Sbjct  61   GVSLQLISADHAEPGNGCKGKLGKPAFLEKWMSTLTSISAGDATFNVTFDWDESMGVP  118


 Score = 34.3 bits (77),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYL+
Sbjct  118  PGAFIIKNYHHSQFYLR  134



>ref|XP_007208174.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
 gb|EMJ09373.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
Length=933

 Score =   114 bits (285),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 70/92 (76%), Gaps = 2/92 (2%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKG VVLMKKN L+L D+ AS LD VHEL G+ VS +LIS+VN DPE G +GK GK +
Sbjct  89   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENG-RGKVGKPA  147

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +  TPL AGE  +EVTF+WDE IGVP
Sbjct  148  YLEDWVTTITPLTAGECTFEVTFDWDEEIGVP  179


 Score = 38.5 bits (88),  Expect(2) = 1e-28, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHSEFYLK
Sbjct  179  PGAFIIRNDHHSEFYLK  195



>ref|XP_011023611.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=861

 Score =   119 bits (298),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 5/110 (5%)
 Frame = +3

Query  108  IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISA  287
            I+ AITG      ++K   I+GTVVLMKKN LDL D+ AS+ D VHE +GQ VS +L+SA
Sbjct  5    IIDAITGCCTGDCKKK---IRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSA  61

Query  288  VNADPEKG-LQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            VN+DP    L+GK GK +YLE W +  TPL AGE+A++VTF WDE IG+P
Sbjct  62   VNSDPSANDLKGKLGKPAYLEKWITTVTPLTAGETAFQVTFNWDEEIGIP  111


 Score = 33.1 bits (74),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA ++ NNH SEFYLK
Sbjct  111  PGALLVKNNHQSEFYLK  127



>gb|ABV32552.1| lipoxygenase [Prunus persica]
Length=933

 Score =   114 bits (284),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 70/92 (76%), Gaps = 2/92 (2%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKG VVLMKKN L+L D+ AS LD VHEL G+ VS +LIS+VN DPE G +GK GK +
Sbjct  89   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENG-RGKVGKPA  147

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +  TPL AGE  +EVTF+WDE IGVP
Sbjct  148  YLEDWVTTITPLTAGECTFEVTFDWDEEIGVP  179


 Score = 38.1 bits (87),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHSEFYLK
Sbjct  179  PGAFIIRNDHHSEFYLK  195



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score =   120 bits (302),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 83/115 (72%), Gaps = 9/115 (8%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M+L KIV AITGK D    EK   +KG VVLMKKN LD  D+ ASVLD V E +GQ+VSF
Sbjct  1    MVLDKIVDAITGKDDG---EK---VKGRVVLMKKNVLDFTDVTASVLDGVLEFLGQRVSF  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWD-ESIGVP  431
            ELIS    D E GL+GKR K +YLE+W +  TP+AAGESA+ VTF+WD E +GVP
Sbjct  55   ELISTSLHD-ENGLEGKRSKPAYLEHWLTNITPIAAGESAFSVTFDWDHEELGVP  108


 Score = 31.6 bits (70),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H SEF+LK
Sbjct  108  PGAFIIKNLHFSEFFLK  124



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score =   116 bits (291),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 3/117 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  +   ITG+       +   IKGTVVLMKKN LD  D  ASVLD VHEL+GQ VS +
Sbjct  1    MLHNLFDKITGQEQNGKNGRK--IKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQ  58

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            LISA + D E G +GK G+ +YLE+W +  TPL  G+SAY VTF+W+E IGVP  + 
Sbjct  59   LISADHGDSENGFKGKLGEPAYLEDWITTITPLTVGDSAYNVTFDWEEEIGVPGAIL  115


 Score = 35.4 bits (80),  Expect(2) = 2e-28, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNHHSEF+LK
Sbjct  111  PGAILIKNNHHSEFFLK  127



>gb|ACD43483.1| lipoxygenase 1 [Olea europaea]
Length=869

 Score =   115 bits (288),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L K++G++ GK     + + + I+GTV+LMKKN +++ D+GAS LD VHE+VG+ V+ +
Sbjct  1    MLEKLLGSVCGKTREEPKTEERKIRGTVLLMKKNVMEMTDVGASFLDRVHEIVGKGVTLQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESA-YEVTFEWDESIGVP  431
            LISA +ADP  G +GK GK +YLE+W +K T L+A + A + +TF+WDES+GVP
Sbjct  61   LISASHADPANGSRGKLGKEAYLEHWVTKFTSLSAKDDAMFNITFDWDESMGVP  114


 Score = 36.6 bits (83),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHS+FYLK
Sbjct  114  PGAFIIRNHHHSQFYLK  130



>ref|XP_011026291.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   117 bits (292),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  150  EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRG  329
            E  + IKGTVVLMKKN LD  DI AS LD VHEL+G+ VS +L+SAV+ DP+ GL+GK G
Sbjct  31   EGRRKIKGTVVLMKKNVLDFTDIKASFLDRVHELLGKGVSMQLVSAVHQDPD-GLRGKLG  89

Query  330  KVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGV  440
            KV+YLE W +  TPL AGE+ + +TFEWDES+G P  +
Sbjct  90   KVAYLEKWVATITPLTAGETMFTITFEWDESMGFPGAI  127


 Score = 34.7 bits (78),  Expect(2) = 3e-28, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             FPGA +I N+HHS+ YLK
Sbjct  122  GFPGAIIIKNHHHSQLYLK  140



>ref|XP_008454481.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=863

 Score =   120 bits (302),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 9/116 (8%)
 Frame = +3

Query  93   MILGKIVGAITG-KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVS  269
            M++G IVGAI+G KH        K I GTVVLM+ N LD  D G++VLD +HEL+G  VS
Sbjct  1    MLIGSIVGAISGLKHGG------KKIHGTVVLMRDNVLDFNDFGSTVLDNLHELLGGGVS  54

Query  270  FELISAVNADPEKGLQGKRGKVSYLENWSKPT--PLAAGESAYEVTFEWDESIGVP  431
             +L+SA + DP K  QGK G+ +YLENW   T  P+ AGE+A+ +TF+WDE IG+P
Sbjct  55   LQLVSAQHGDPSKEFQGKVGEAAYLENWIGNTILPIFAGETAFSITFDWDEEIGIP  110



>sp|Q43190.1|LOX14_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 4; AltName: 
Full=Root lipoxygenase [Solanum tuberosum]
 gb|AAB67860.1| lipoxygenase [Solanum tuberosum]
Length=860

 Score =   120 bits (301),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 6/113 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +LG+IVG + G H        K +KGTVV+MKKNALD  D+  S+ D + E +GQKVSF+
Sbjct  1    MLGQIVGGLIGGH-----HDSKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+V +DP  GLQGK    +YLEN+    TPLAAGE+A+ VTF+W+E  GVP
Sbjct  56   LISSVQSDPANGLQGKHSNPAYLENFLFTLTPLAAGETAFGVTFDWNEEFGVP  108



>ref|XP_004139172.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=864

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 9/116 (8%)
 Frame = +3

Query  93   MILGKIVGAITG-KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVS  269
            M++G IVGAI+G KH        K I GTVVL++ N LD  D G++VLD +HEL+G  VS
Sbjct  1    MLIGSIVGAISGLKHGG------KKINGTVVLVRDNVLDFNDFGSTVLDNLHELLGGGVS  54

Query  270  FELISAVNADPEKGLQGKRGKVSYLENWSKPT--PLAAGESAYEVTFEWDESIGVP  431
             +L+SA + DP KG +GK G+ +YLENW   T  P+ AGE+A+ +TF+WDE IGVP
Sbjct  55   LQLVSAQHGDPSKGFKGKVGEAAYLENWIGNTIIPIFAGETAFSITFDWDEEIGVP  110



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score =   117 bits (293),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 5/110 (5%)
 Frame = +3

Query  108  IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISA  287
            I+ AITG      ++K   I+GTVVLMKKN LDL D+ AS+ D VHE +GQ VS +L+SA
Sbjct  5    IIDAITGCCTGDCKKK---IRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSA  61

Query  288  VNADPEKG-LQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            VN+DP     +GK GK +YLE W +  TPL AGE+A++VTF WDE IG+P
Sbjct  62   VNSDPSANDFKGKLGKPAYLEKWITTVTPLTAGETAFKVTFNWDEEIGIP  111


 Score = 33.1 bits (74),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA ++ NNH SEFYLK
Sbjct  111  PGALLVKNNHQSEFYLK  127



>ref|XP_004156417.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=864

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 9/116 (8%)
 Frame = +3

Query  93   MILGKIVGAITG-KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVS  269
            M++G IVGAI+G KH        K I GTVVL++ N LD  D G++VLD +HEL+G  VS
Sbjct  1    MLIGSIVGAISGLKHGG------KKINGTVVLVRDNVLDFNDFGSTVLDNLHELLGGGVS  54

Query  270  FELISAVNADPEKGLQGKRGKVSYLENWSKPT--PLAAGESAYEVTFEWDESIGVP  431
             +L+SA + DP KG +GK G+ +YLENW   T  P+ AGE+A+ +TF+WDE IGVP
Sbjct  55   LQLVSAQHGDPSKGFKGKVGEAAYLENWIGNTIIPIFAGETAFSITFDWDEEIGVP  110



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score =   114 bits (284),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = +3

Query  117  AITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNA  296
            ++ GKH  A ++K   IKGTVVLMKKN LD  D  AS+ D VHEL+G+KVS +L+S+VN 
Sbjct  3    SLAGKHGEANKKK---IKGTVVLMKKNVLDFTDFNASIADEVHELLGKKVSLQLVSSVNG  59

Query  297  DPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            DPEKG QGK G  +YLE W +    L  GES + +TF+W+E + VP
Sbjct  60   DPEKGQQGKLGSPAYLEGWITTNHRLTVGESVFNITFDWEEEVEVP  105


 Score = 37.0 bits (84),  Expect(2) = 6e-28, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHSEF+LK
Sbjct  105  PGAFIIKNHHHSEFFLK  121



>gb|ACH91370.1| lipoxygenase LOX-3 [Prunus persica]
Length=933

 Score =   112 bits (279),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 2/92 (2%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKG VVLMKKN L+L D+ AS LD VHEL G+ VS +LIS+VN DPE G +GK GK +
Sbjct  89   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGKVVSLQLISSVNGDPENG-RGKVGKPA  147

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +   PL AGE  +EVTF+WDE IGVP
Sbjct  148  YLEDWVTTIIPLTAGECTFEVTFDWDEEIGVP  179


 Score = 38.5 bits (88),  Expect(2) = 7e-28, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHSEFYLK
Sbjct  179  PGAFIIRNDHHSEFYLK  195



>ref|XP_010256003.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256004.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256005.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
Length=874

 Score =   114 bits (286),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 15/122 (12%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKI---------IKGTVVLMKKNALDLKDIGASVLDTVHE  248
            ++ KIV  I GK     E + K+         I+GTVVLMKKN LD  D+ ASVLD   E
Sbjct  1    MIHKIVDTIAGK-----ETQTKLNDEMGGKTKIRGTVVLMKKNLLDFNDLHASVLDRFDE  55

Query  249  LVGQKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIG  425
            L+G+ V+ +LIS+VNADP  G++GK GK +YLE W +  TPL AG S+++VTF+WD  IG
Sbjct  56   LLGEGVALQLISSVNADPVNGMRGKVGKAAYLEEWITTVTPLTAGASSFKVTFDWDADIG  115

Query  426  VP  431
            VP
Sbjct  116  VP  117


 Score = 35.0 bits (79),  Expect(2) = 9e-28, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHSEF+LK
Sbjct  117  PGAFIIKNFHHSEFFLK  133



>ref|NP_001280815.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82793.1| lipoxygenase [Malus domestica]
Length=885

 Score =   113 bits (283),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K ++GTVVLMKKN L+L D+ ASV D   EL G++V  +LIS+VN DPE G QGK GK +
Sbjct  44   KKLRGTVVLMKKNVLELNDLKASVHDRFDELRGKRVLLQLISSVNCDPENGWQGKVGKPA  103

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +K TPL A E+A++VTF+WDE IGVP
Sbjct  104  YLEDWITKITPLTAEETAFDVTFDWDEEIGVP  135


 Score = 36.6 bits (83),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HH+EFYLK
Sbjct  135  PGAFIIRNEHHNEFYLK  151



>ref|NP_001234856.1| linoleate 9S-lipoxygenase A [Solanum lycopersicum]
 sp|P38415.1|LOXA_SOLLC RecName: Full=Linoleate 9S-lipoxygenase A; AltName: Full=Lipoxygenase 
A [Solanum lycopersicum]
 gb|AAA53184.1| lipoxygenase [Solanum lycopersicum]
Length=860

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 6/113 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +LG++VG + G H  +     K +KGTVV+MKKNALD  D+  S+ D + E +GQKVSF+
Sbjct  1    MLGQLVGGLIGGHHDS-----KKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENWSKP-TPLAAGESAYEVTFEWDESIGVP  431
            LIS+V +DP  GLQGK    +YLEN+    TPLAAGE+A+ VTF+W+E  GVP
Sbjct  56   LISSVQSDPANGLQGKHSNPAYLENFLLTLTPLAAGETAFGVTFDWNEEFGVP  108



>ref|XP_008359870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=885

 Score =   113 bits (282),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K ++GTVVLMKKN L+L D+ ASV D   EL G++V  +LIS+VN DPE G QGK GK +
Sbjct  44   KKLRGTVVLMKKNVLELNDLKASVHDRFDELRGKRVLLQLISSVNCDPENGWQGKVGKPA  103

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +K TPL A E+A++VTF+WDE IGVP
Sbjct  104  YLEDWITKITPLTAEETAFDVTFDWDEEIGVP  135


 Score = 36.6 bits (83),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HH+EFYLK
Sbjct  135  PGAFIIRNEHHNEFYLK  151



>ref|XP_008246454.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=934

 Score =   111 bits (277),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 2/92 (2%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKG VVLMKKN L+L D+ AS LD VHEL G+ VS +LIS+VN DPE G +GK GK +
Sbjct  90   KKIKGRVVLMKKNVLELNDLKASFLDRVHELWGEVVSLQLISSVNGDPENG-RGKVGKPA  148

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE+W +  TPL A E  +EVTF+WDE IGVP
Sbjct  149  YLEDWVTTITPLTAEECTFEVTFDWDEEIGVP  180


 Score = 38.5 bits (88),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHSEFYLK
Sbjct  180  PGAFIIRNDHHSEFYLK  196



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score =   114 bits (284),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 3/117 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  +   ITG+       +   IKGTVVLMKKN LD  D  ASVLD VHEL+GQ VS +
Sbjct  1    MLHNLFDKITGQEQNGKNGRK--IKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQ  58

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            LISA + D E   +GK G+ +YLE+W +  TPL  G+SAY+VTF+W+E IGVP  + 
Sbjct  59   LISADHGDSENRFKGKLGEPAYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAIL  115


 Score = 35.4 bits (80),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNHHSEF+LK
Sbjct  111  PGAILIKNNHHSEFFLK  127



>ref|XP_004247367.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=854

 Score =   111 bits (277),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 56/113 (50%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +3

Query  96   ILGKIVGAITGKH-DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            IL K++  + GK  D   E     IKGTVVLMKKN L+ KD G++ LD +HEL G++V+ 
Sbjct  6    ILEKLLETVCGKQRDVPVERDAVKIKGTVVLMKKNVLNFKDAGSAFLDRMHELFGKRVTI  65

Query  273  ELISAVNADPEKGLQGKRGKVSYLENWSKPTPLAAGESAYEVTFEWDESIGVP  431
            +L+SA +ADPE G +GK GK + LE  S  T ++  E+A+ +TF+WDES+GVP
Sbjct  66   QLVSAEHADPENGSKGKLGKPATLEWASSKTWISVEEAAFNITFDWDESLGVP  118


 Score = 38.1 bits (87),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF++ NNHHS+FYLK
Sbjct  118  PGAFIVKNNHHSQFYLK  134



>gb|KHG03761.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG17470.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
Length=873

 Score =   112 bits (281),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEE--KPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVS  269
              GK  G    K     EE  +   IKGTVVLMKKN +D+ D+ AS LD V+EL G+ VS
Sbjct  3    FCGKFCGKPKTKDKGIMEEDDEKMKIKGTVVLMKKNVMDMNDLTASFLDRVYELFGRGVS  62

Query  270  FELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             +LISAV  DP   ++GK GK + LE W +K TPL AGE  + VTFEWDESIGVP
Sbjct  63   LQLISAVYTDPANEMRGKLGKPANLEKWITKITPLTAGEITFSVTFEWDESIGVP  117


 Score = 36.6 bits (83),  Expect(2) = 1e-27, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYLK
Sbjct  117  PGAFIIKNRHHSQFYLK  133



>ref|XP_002516771.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF45385.1| lipoxygenase, putative [Ricinus communis]
Length=868

 Score =   114 bits (286),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKGTVVLMKKN LD  DI AS LD VHEL+G+ VS +LISAV+ DP   L+GK GKV+YL
Sbjct  23   IKGTVVLMKKNVLDFSDIKASFLDRVHELLGKGVSMQLISAVHHDPANKLRGKLGKVAYL  82

Query  345  ENWSKP-TPLAAGESAYEVTFEWDESIGVP  431
            E W +  TP+ A ++ + +TF+WDES+GVP
Sbjct  83   EKWVRSITPITAVDTVFNITFDWDESMGVP  112


 Score = 34.3 bits (77),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HHS+ YLK
Sbjct  112  PGAFIIRNHHHSQLYLK  128



>ref|XP_010024349.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW60798.1| hypothetical protein EUGRSUZ_H03535 [Eucalyptus grandis]
Length=899

 Score =   111 bits (277),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K I+GTV LMKKN LD+ D+ AS+LD +HEL G+ VS +L+SAV++DP  G +GK GKV+
Sbjct  51   KKIRGTVKLMKKNVLDMNDMKASLLDRIHELFGKGVSLQLVSAVHSDPSNGSRGKLGKVA  110

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE W  K T L AGE+ + VTF+WD+S+G+P
Sbjct  111  YLEKWIRKITSLTAGEAEFGVTFDWDKSMGIP  142


 Score = 37.4 bits (85),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  415  RASAFPGAFVINNNHHSEFYLK  480
            ++   PGAF+I N+HHS+FYLK
Sbjct  137  KSMGIPGAFIIRNHHHSQFYLK  158



>ref|XP_006359922.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=854

 Score =   110 bits (274),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +3

Query  96   ILGKIVGAITGKH-DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            IL K++  + GK  D   E     IKGTVVLMKKN L+ KD G + LD +HEL G++V+ 
Sbjct  6    ILEKLLETVCGKQRDVPVESGTIKIKGTVVLMKKNVLNFKDAGCAFLDRMHELFGKRVTI  65

Query  273  ELISAVNADPEKGLQGKRGKVSYLENWSKPTPLAAGESAYEVTFEWDESIGVP  431
            +L+SA +ADPE G +GK GK + LE  S  T ++  E+A+ +TF+WDES+GVP
Sbjct  66   QLVSAEHADPENGSKGKLGKPAILEWASSKTWISVEEAAFNITFDWDESLGVP  118


 Score = 38.1 bits (87),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF++ NNHHS+FYLK
Sbjct  118  PGAFIVKNNHHSQFYLK  134



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   117 bits (294),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = +3

Query  108  IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISA  287
            IV  + G +D+      K +KG VV+MKKNALD  DI  SV+D V E VGQKVS +LIS+
Sbjct  7    IVDGLIGHNDS------KKVKGIVVMMKKNALDFTDIAGSVVDGVLEFVGQKVSLQLISS  60

Query  288  VNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             + DP   LQGK   ++YLENW +  TPL AGESAY VTF+WDE  G+P
Sbjct  61   AHGDPANDLQGKHSNLAYLENWLTTITPLTAGESAYGVTFDWDEEFGLP  109



>gb|AGI16414.1| lipoxygenase [Malus domestica]
Length=868

 Score =   110 bits (274),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D   + + K IKG VVLMKK  LD+ D+ AS+LD V EL+G+ VS  LIS+VN DPE  L
Sbjct  16   DTQHKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENEL  75

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +GK GK +YLENW +   PL AGE+A++VTF+W++ IGVP
Sbjct  76   KGKVGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVP  115


 Score = 37.7 bits (86),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAFV+ N HHSEFYLK
Sbjct  115  PGAFVVRNEHHSEFYLK  131



>gb|AGI16415.1| lipoxygenase [Malus domestica]
Length=868

 Score =   110 bits (274),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D   + + K IKG VVLMKK  LD+ D+ AS+LD V EL+G+ VS  LIS+VN DPE  L
Sbjct  16   DTQHKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENEL  75

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +GK GK +YLENW +   PL AGE+A++VTF+W++ IGVP
Sbjct  76   KGKVGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVP  115


 Score = 37.7 bits (86),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAFV+ N HHSEFYLK
Sbjct  115  PGAFVVRNEHHSEFYLK  131



>ref|XP_010108010.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXC17575.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=884

 Score =   112 bits (279),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKGTVVLMKKN LD  DI AS+LD +HEL G+ VS ++IS+V  DPE G +GK GKV+
Sbjct  37   KKIKGTVVLMKKNVLDFNDIKASLLDRIHELFGKVVSMQIISSVLPDPENGFRGKLGKVA  96

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLE W S  +P AA E+ + VTFEW E++G+P
Sbjct  97   YLEKWISTISPTAARETQFTVTFEWGETMGLP  128


 Score = 35.8 bits (81),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGAF+I N+HHS+F+LK
Sbjct  126  GLPGAFIIKNHHHSQFFLK  144



>ref|NP_001281022.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGI16411.1| lipoxygenase [Malus domestica]
 gb|AGI16412.1| lipoxygenase [Malus domestica]
 gb|AGK82792.1| lipoxygenase [Malus domestica]
Length=868

 Score =   110 bits (274),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D   + + K IKG VVLMKK  LD+ D+ AS+LD V EL+G+ VS  LIS+VN DPE  L
Sbjct  16   DTQHKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENEL  75

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +GK GK +YLENW +   PL AGE+A++VTF+W++ IGVP
Sbjct  76   KGKVGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVP  115


 Score = 37.7 bits (86),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAFV+ N HHSEFYLK
Sbjct  115  PGAFVVRNEHHSEFYLK  131



>gb|ABF19103.2| 9-lipoxygenase [Capsicum annuum]
Length=876

 Score =   112 bits (281),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 58/121 (48%), Positives = 82/121 (68%), Gaps = 9/121 (7%)
 Frame = +3

Query  96   ILGKIVGAITGK-HDAAAEEKP-------KIIKGTVVLMKKNALDLKDIGASVLDTVHEL  251
            +L K++  + G+ HD   E          K ++GTVVLMKKN LDL D+GAS LD VHE+
Sbjct  1    MLEKLLNVVCGRNHDTTDENNCNNNHTNGKKVRGTVVLMKKNVLDLTDVGASFLDRVHEV  60

Query  252  VGQKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGV  428
             G+ VS +LISA +A+P  G +GK GK +++ENW S  T ++AG++ + VTF+WDES+G 
Sbjct  61   FGKGVSLQLISADHAEPGNGCKGKLGKPAFMENWVSTLTSISAGDATFNVTFDWDESMGF  120

Query  429  P  431
            P
Sbjct  121  P  121


 Score = 35.0 bits (79),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             FPGAF+I N HHS+ YL+
Sbjct  119  GFPGAFIIKNYHHSQLYLR  137



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =   109 bits (273),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 5/117 (4%)
 Frame = +3

Query  87   LRMILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKV  266
            L  ++  IV  +TG        K   I GTVVLMKKN LD  D+ ASVLD V+ELVGQ V
Sbjct  99   LLRVIENIVEKLTGHQQNGNHGK---INGTVVLMKKNVLDFNDLNASVLDGVYELVGQGV  155

Query  267  SFELISAVNADPEK-GLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            S +LISAV+AD  K G +GK G+ +YLE+W +  TPL  GESA++VTF+++E +GVP
Sbjct  156  SLQLISAVHADDSKNGWKGKLGQPAYLEDWITTITPLTTGESAFKVTFDYEEEVGVP  212


 Score = 37.7 bits (86),  Expect(2) = 4e-27, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  212  PGAFLIKNNHHSEFFLK  228



>gb|AEQ30071.1| lipoxygenase [Litchi chinensis]
Length=872

 Score =   108 bits (271),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPE-KGLQGKRGKVSY  341
            I+GTVVLMKKN LD  D  AS+LD VHEL+G+ VS +L+SAV+AD +  GL GK G+ +Y
Sbjct  30   IQGTVVLMKKNVLDFNDFHASLLDRVHELLGKGVSLQLVSAVHADSQANGLGGKVGEPAY  89

Query  342  LENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            L++W +K TPLAAGESA++VTF+ DE IGVP
Sbjct  90   LKDWITKITPLAAGESAFKVTFDADEEIGVP  120


 Score = 38.9 bits (89),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF++ NNHHSEFYLK
Sbjct  120  PGAFIVKNNHHSEFYLK  136



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score =   111 bits (277),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 80/119 (67%), Gaps = 13/119 (11%)
 Frame = +3

Query  87   LRMILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKV  266
            L+ IL  + G   G+ D       K IKG VVLMKKN LD  D  A++LD VHEL GQKV
Sbjct  2    LKQILESVAG---GRQDG------KKIKGRVVLMKKNVLDFNDFHANILDGVHELFGQKV  52

Query  267  SFELISAVNAD---PEKGLQGKRGKVSYLENWSKP-TPLAAGESAYEVTFEWDESIGVP  431
            S +L++AV+ D   P+KGL+G+ G  +YLE+W +  T L AGESA++V F+WDE +GVP
Sbjct  53   SLQLVTAVHGDGHHPDKGLEGRLGNPAYLEDWVRTGTILDAGESAFDVEFDWDEELGVP  111


 Score = 36.2 bits (82),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF++ N HHSEFYLK
Sbjct  111  PGAFIVKNFHHSEFYLK  127



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score =   111 bits (278),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 78/119 (66%), Gaps = 4/119 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAA-AEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            +L  ++ A+TG   +   E     IKGTVVLMKKN LD  D  ASVLD VHEL+G++VS 
Sbjct  1    MLSHLLNAVTGDDGSKEMESSSGKIKGTVVLMKKNVLDFNDFQASVLDGVHELLGKRVSL  60

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW--SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            +LISA   D   GLQGK GK +YL+NW  +  +P+ AGES + V F+WDE IG P G+ 
Sbjct  61   QLISAEKGDAANGLQGKLGKPAYLDNWTLTDASPV-AGESKFSVNFDWDEEIGTPGGLL  118


 Score = 35.4 bits (80),  Expect(2) = 6e-27, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PG  +I NNHHSEFYLK
Sbjct  114  PGGLLIKNNHHSEFYLK  130



>gb|AGI16416.1| lipoxygenase [Malus domestica]
Length=868

 Score =   109 bits (272),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D   + + K IKG VVLMKK  LD+ D+ AS+LD V EL+G+ VS  LIS+VN DPE  L
Sbjct  16   DTQHKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKVVSLRLISSVNGDPENEL  75

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +GK GK +YLENW +   PL AGE+A++VTF+W++ IGVP
Sbjct  76   KGKVGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVP  115


 Score = 37.7 bits (86),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAFV+ N HHSEFYLK
Sbjct  115  PGAFVVRNEHHSEFYLK  131



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   115 bits (287),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKGTVVLMKKN LD  DI AS LD VHEL+G+ VS +L+SAV+ DP   L+G  GKV+Y+
Sbjct  36   IKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQDPADSLRGTLGKVAYV  95

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVPRGV  440
            E W +  TPL AGE+ + +TFEWDE++G+P  +
Sbjct  96   EKWVTSRTPLTAGETIFTITFEWDENMGLPGAI  128


 Score = 32.0 bits (71),  Expect(2) = 7e-27, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGA +I N+HHS+ YLK
Sbjct  123  GLPGAIIIKNHHHSQLYLK  141



>ref|XP_008801705.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Phoenix dactylifera]
Length=867

 Score =   111 bits (278),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 75/116 (65%), Gaps = 3/116 (3%)
 Frame = +3

Query  99   LGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFEL  278
            +     AI GKH      K   IKGTVVLMKKN LD  D+ AS+LD +HE++G+ +SF+L
Sbjct  1    MQNFFDAILGKHPEGG--KGTKIKGTVVLMKKNVLDFNDLHASLLDRMHEVLGKGISFQL  58

Query  279  ISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            +SA   DP  G +GK G  +YLE W +  T L+AGES + VTF+WDES G+P  V 
Sbjct  59   VSATVGDPNNGKRGKVGPAAYLEEWITTLTSLSAGESRFNVTFDWDESQGIPGAVI  114


 Score = 35.0 bits (79),  Expect(2) = 9e-27, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  418  ASAFPGAFVINNNHHSEFYLK  480
            +   PGA ++ N+HHSEFYLK
Sbjct  106  SQGIPGAVIVKNSHHSEFYLK  126



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score =   106 bits (264),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 72/115 (63%), Gaps = 8/115 (7%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +   IV   TG+           +KGTVVLMKKN LD  D  AS LD +HE VG++VS +
Sbjct  1    MFQNIVNVFTGEDKLRHR-----VKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQ  55

Query  276  LISAVNADP--EKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            L+SAVN D     GL+GK GK ++LE+W +   PL  GE+A++VTFEWDE I  P
Sbjct  56   LVSAVNVDSGDSNGLKGKLGKPAHLEDWITTIAPLTVGETAFKVTFEWDEEIRTP  110


 Score = 40.4 bits (93),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  110  PGAFIIRNNHHSEFYLK  126



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score =   112 bits (279),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 59/121 (49%), Positives = 83/121 (69%), Gaps = 9/121 (7%)
 Frame = +3

Query  96   ILGKIVGAITGK-HDAAAEEKP-------KIIKGTVVLMKKNALDLKDIGASVLDTVHEL  251
            +L K++  + GK H+   E+         K ++GTVVLMKKN LDLKD+GAS LD VHE+
Sbjct  11   MLDKLLQVVCGKNHEPTIEDNNFNNNTNGKKVRGTVVLMKKNVLDLKDVGASFLDRVHEV  70

Query  252  VGQKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGV  428
             G+ VS +LISA +A+   G +GK GK ++LE W S  T ++AG++ + VTF+WDES+GV
Sbjct  71   FGKGVSLQLISADHAESGNGCKGKLGKPAFLEKWMSTLTSISAGDATFNVTFDWDESMGV  130

Query  429  P  431
            P
Sbjct  131  P  131


 Score = 34.3 bits (77),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYL+
Sbjct  131  PGAFIIKNYHHSQFYLR  147



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score =   112 bits (279),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 59/121 (49%), Positives = 83/121 (69%), Gaps = 9/121 (7%)
 Frame = +3

Query  96   ILGKIVGAITGK-HDAAAEEKP-------KIIKGTVVLMKKNALDLKDIGASVLDTVHEL  251
            +L K++  + GK H+   E+         K ++GTVVLMKKN LDLKD+GAS LD VHE+
Sbjct  1    MLDKLLQVVCGKNHEPTIEDNNFNNNTNGKKVRGTVVLMKKNVLDLKDVGASFLDRVHEV  60

Query  252  VGQKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGV  428
             G+ VS +LISA +A+   G +GK GK ++LE W S  T ++AG++ + VTF+WDES+GV
Sbjct  61   FGKGVSLQLISADHAESGNGCKGKLGKPAFLEKWMSTLTSISAGDATFNVTFDWDESMGV  120

Query  429  P  431
            P
Sbjct  121  P  121


 Score = 34.3 bits (77),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYL+
Sbjct  121  PGAFIIKNYHHSQFYLR  137



>sp|Q41238.1|LOX16_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 6; AltName: Full=Lipoxygenase 
1-5; Short=StLOX1; Short=lox1:St:3, partial [Solanum 
tuberosum]
 gb|AAB31252.1| linoleate:oxygen oxidoreductase, partial [Solanum tuberosum]
Length=857

 Score =   116 bits (290),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = +3

Query  105  KIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELIS  284
            +IVG + G H  +     K +KGTVV+MKKNALD  D+  S+ D + E +GQKVSF+LIS
Sbjct  1    QIVGGLIGGHHDS-----KKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLIS  55

Query  285  AVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +V +DP  GLQGK    +YLEN+    TPLAAGE+A+ VTF+W+E  GVP
Sbjct  56   SVQSDPANGLQGKHSNPAYLENFLFTLTPLAAGETAFGVTFDWNEEFGVP  105


 Score = 30.0 bits (66),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  105  PGAFIIKNTHINEFFLK  121



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 83/126 (66%), Gaps = 10/126 (8%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +  KIV A++G +        K IKGTVVLMKKN LDL D  AS LD +HEL+GQKVS +
Sbjct  1    MFQKIVDALSGNN--------KKIKGTVVLMKKNVLDLNDFNASFLDGIHELLGQKVSLQ  52

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQ  452
            LISAVN D +  L+GK GK +YLE+W +  T LAAGE+A ++TF+WDE  G+P     + 
Sbjct  53   LISAVNVD-QGTLKGKLGKAAYLEDWITTNTFLAAGETAADITFDWDEDQGIPGAFIIKN  111

Query  453  QSPQRV  470
              P + 
Sbjct  112  NHPTQF  117



>gb|KJB38136.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=645

 Score =   109 bits (273),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +3

Query  147  EEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKR  326
            +EK KI KGTVVLMKKN +D+ D+ AS LD V+EL  + VS +LISAV  DP   ++GK 
Sbjct  50   DEKMKI-KGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKL  108

Query  327  GKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            GK + LE W +K TPL AGE  + VTFEWDESIGVP
Sbjct  109  GKPANLEKWITKFTPLTAGEITFSVTFEWDESIGVP  144


 Score = 36.2 bits (82),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYLK
Sbjct  144  PGAFIIKNRHHSQFYLK  160



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score =   111 bits (277),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K ++GTVVLMKKN LDL D+GAS+LD  HE++G+ VS +LISA +A+P  G  GK GK +
Sbjct  31   KKVRGTVVLMKKNVLDLTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPA  90

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +LE W S  T ++AG++ + VTF+WDES+GVP
Sbjct  91   FLEKWISTLTSISAGDATFNVTFDWDESMGVP  122


 Score = 34.7 bits (78),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYL+
Sbjct  122  PGAFIIKNYHHSQFYLR  138



>gb|KJB38135.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=570

 Score =   109 bits (272),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +3

Query  147  EEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKR  326
            +EK KI KGTVVLMKKN +D+ D+ AS LD V+EL  + VS +LISAV  DP   ++GK 
Sbjct  50   DEKMKI-KGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKL  108

Query  327  GKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            GK + LE W +K TPL AGE  + VTFEWDESIGVP
Sbjct  109  GKPANLEKWITKFTPLTAGEITFSVTFEWDESIGVP  144


 Score = 36.6 bits (83),  Expect(2) = 1e-26, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYLK
Sbjct  144  PGAFIIKNRHHSQFYLK  160



>gb|KJB38137.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=900

 Score =   108 bits (271),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +3

Query  147  EEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKR  326
            +EK KI KGTVVLMKKN +D+ D+ AS LD V+EL  + VS +LISAV  DP   ++GK 
Sbjct  50   DEKMKI-KGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKL  108

Query  327  GKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            GK + LE W +K TPL AGE  + VTFEWDESIGVP
Sbjct  109  GKPANLEKWITKFTPLTAGEITFSVTFEWDESIGVP  144


 Score = 36.6 bits (83),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYLK
Sbjct  144  PGAFIIKNRHHSQFYLK  160



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   115 bits (287),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 59/109 (54%), Positives = 73/109 (67%), Gaps = 7/109 (6%)
 Frame = +3

Query  108  IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISA  287
            IV  + G +D+      K +KG VV+MKKNALD  DI  +V+D V E VGQKVS +LIS+
Sbjct  7    IVDGLIGHNDS------KKVKGIVVMMKKNALDFTDIAGAVVDGVLEFVGQKVSLQLISS  60

Query  288  VNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             + DP   LQGK    +YLENW +  TPL AGESAY VTF+WDE  G+P
Sbjct  61   AHGDPANDLQGKHSNPAYLENWLTTITPLTAGESAYGVTFDWDEEFGLP  109


 Score = 30.4 bits (67),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGAF+I N H +EF+LK
Sbjct  107  GLPGAFIIKNLHFTEFFLK  125



>gb|KJB38138.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=869

 Score =   108 bits (271),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKGTVVLMKKN +D+ D+ AS LD V+EL  + VS +LISAV  DP   ++GK GK + L
Sbjct  24   IKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPANL  83

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            E W +K TPL AGE  + VTFEWDESIGVP
Sbjct  84   EKWITKFTPLTAGEITFSVTFEWDESIGVP  113


 Score = 36.6 bits (83),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYLK
Sbjct  113  PGAFIIKNRHHSQFYLK  129



>emb|CAA64767.1| lipoxygenase [Solanum tuberosum]
Length=454

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G+IVG + G H  +     K +KGTVV+MKKNALD  D+  S+ D + E++GQKVSF+
Sbjct  1    MIGQIVGGLIGGHHDS-----KKVKGTVVMMKKNALDFTDLAGSLTDKMFEVLGQKVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLEN-WSKPTPLAAG-ESAYEVTFEWDESIGVP  431
            LIS+V  DP  GLQGK+   +YLEN     TPL AG E+A+ VTF+W+E  GVP
Sbjct  56   LISSVQGDPTNGLQGKQSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVP  109



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score =   110 bits (275),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 85/130 (65%), Gaps = 10/130 (8%)
 Frame = +3

Query  72   VFSRKLRMILGKIVGAITGKHDAAAEEKP---------KIIKGTVVLMKKNALDLKDIGA  224
             FS     +L K +G + GK++    ++          K ++GTVVLMKKN LDL D+GA
Sbjct  3    FFSPCCTEMLEKWLGVVCGKNNIDTIDENNCNNIHINGKKVRGTVVLMKKNVLDLTDVGA  62

Query  225  SVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVT  401
            S+LD  HE++G+ VS +LISA +A+P  G  GK GK ++LE W S  T ++AG++ + VT
Sbjct  63   SLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPAFLEKWISTLTSISAGDATFNVT  122

Query  402  FEWDESIGVP  431
            F+WDES+GVP
Sbjct  123  FDWDESMGVP  132


 Score = 34.7 bits (78),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYL+
Sbjct  132  PGAFIIKNYHHSQFYLR  148



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score =   115 bits (287),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 59/109 (54%), Positives = 73/109 (67%), Gaps = 7/109 (6%)
 Frame = +3

Query  108  IVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISA  287
            IV  + G +D+      K +KG VV+MKKNALD  DI  SV+D V E +GQKVS +LIS+
Sbjct  7    IVDGLIGHNDS------KKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLISS  60

Query  288  VNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             + DP   LQGK    +YLENW +  TPL AGESAY VTF+WDE  G+P
Sbjct  61   AHGDPANDLQGKHSNPAYLENWLTTITPLTAGESAYGVTFDWDEEFGLP  109


 Score = 30.4 bits (67),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGAF+I N H +EF+LK
Sbjct  107  GLPGAFIIKNLHFTEFFLK  125



>gb|KJB28315.1| hypothetical protein B456_005G041900 [Gossypium raimondii]
Length=877

 Score =   108 bits (271),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +3

Query  171  GTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYLEN  350
            G +VLMKKN LD+ D+ +S+LD VHEL+G+ VS +LISAV+ DP  GL+GK GK  YLE 
Sbjct  32   GALVLMKKNVLDVSDLKSSLLDRVHELLGKGVSLQLISAVHTDPANGLRGKLGKPVYLEK  91

Query  351  W-SKPTPLAAGESAYEVTFEWDESIGVP  431
            W +  TPL AGE+  +V FEWDES+GVP
Sbjct  92   WVTTNTPLTAGETKLDVEFEWDESMGVP  119


 Score = 36.2 bits (82),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYL  477
            PGAF+I NNHHS+FYL
Sbjct  119  PGAFMIKNNHHSQFYL  134



>gb|AGI16413.1| lipoxygenase [Malus domestica]
Length=868

 Score =   107 bits (266),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D   + + K IKG VVLMKK  LD+ D+ AS+LD V EL+G+ VS  LIS+VN  PE  L
Sbjct  16   DTQHKNEGKKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGAPENEL  75

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +GK GK +YLENW +   PL AGE+A++VTF+W++ IGVP
Sbjct  76   KGKVGKPAYLENWVTTIAPLTAGEAAFDVTFDWEKEIGVP  115


 Score = 37.7 bits (86),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAFV+ N HHSEFYLK
Sbjct  115  PGAFVVRNEHHSEFYLK  131



>ref|XP_007030814.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11316.1| Lipoxygenase 1 [Theobroma cacao]
Length=835

 Score =   112 bits (280),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 7/117 (6%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            MILG ++  +TGK      +K + IKGTVVLMKKN LD   IG+S +D V ELVGQ+V+ 
Sbjct  1    MILGGVLNELTGK------KKSQTIKGTVVLMKKNVLDFNAIGSSAVDNVLELVGQQVTL  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENWS-KPTPLAAGESAYEVTFEWDESIGVPRGV  440
            +L+SA NADP     GK GK++ LE+W+   TP  AGE+ Y+V+FEWDE  G P  +
Sbjct  55   QLVSAQNADPANENAGKLGKLAALESWNLTFTPPIAGETQYKVSFEWDEQFGAPGAI  111


 Score = 32.0 bits (71),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNH +EFYLK
Sbjct  108  PGAIIIRNNHAAEFYLK  124



>ref|XP_010326548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326550.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
Length=891

 Score =   109 bits (272),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 55/119 (46%), Positives = 81/119 (68%), Gaps = 7/119 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKI------IKGTVVLMKKNALDLKDIGASVLDTVHELVG  257
            +L K +G + GK++    +   I      ++GTVVLMKKN LD  D+GAS+LD  HE++G
Sbjct  18   MLEKWLGVVCGKNNIDTIDDNNIHINGQKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIG  77

Query  258  QKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            + VS +LISA +A+P  G  GK G+ ++LE W S  T ++AG++ + VTF+WDES+GVP
Sbjct  78   KGVSLQLISADHAEPGNGCTGKLGQPAFLEKWISTLTSISAGDATFNVTFDWDESMGVP  136


 Score = 34.7 bits (78),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYL+
Sbjct  136  PGAFIIKNYHHSQFYLR  152



>ref|XP_010326551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326552.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score =   109 bits (272),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 55/119 (46%), Positives = 81/119 (68%), Gaps = 7/119 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKI------IKGTVVLMKKNALDLKDIGASVLDTVHELVG  257
            +L K +G + GK++    +   I      ++GTVVLMKKN LD  D+GAS+LD  HE++G
Sbjct  1    MLEKWLGVVCGKNNIDTIDDNNIHINGQKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIG  60

Query  258  QKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            + VS +LISA +A+P  G  GK G+ ++LE W S  T ++AG++ + VTF+WDES+GVP
Sbjct  61   KGVSLQLISADHAEPGNGCTGKLGQPAFLEKWISTLTSISAGDATFNVTFDWDESMGVP  119


 Score = 34.7 bits (78),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYL+
Sbjct  119  PGAFIIKNYHHSQFYLR  135



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   111 bits (278),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKGTVVLMKKN LD  DI AS LD VHEL+G+ VS +L+SAV+ DP+  L+G  GKV+Y+
Sbjct  36   IKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQDPD-SLRGTLGKVAYV  94

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVPRGV  440
            E W +  TPL AGE+ + +TFEWDE++G+P  +
Sbjct  95   EKWVTSRTPLTAGETIFTITFEWDENMGLPGAI  127


 Score = 32.0 bits (71),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGA +I N+HHS+ YLK
Sbjct  122  GLPGAIIIKNHHHSQLYLK  140



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score =   113 bits (283),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 73/110 (66%), Gaps = 7/110 (6%)
 Frame = +3

Query  105  KIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELIS  284
             IV  +TG +D+      K +KG VV+MKKNALD  DI  SV+D V E +GQKVS +LIS
Sbjct  6    NIVDRLTGHNDS------KKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLIS  59

Query  285  AVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            + + DP   LQGK    +YLE W +  TPL AGESAY VTF+W+E  GVP
Sbjct  60   SAHGDPANDLQGKHSNPAYLEKWLTTITPLTAGESAYSVTFDWEEEFGVP  109


 Score = 30.4 bits (67),  Expect(2) = 7e-26, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  109  PGAFIIKNLHFTEFFLK  125



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score =   112 bits (279),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 77/115 (67%), Gaps = 9/115 (8%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M L KIV AITGK D       K +KGTVVLMKKN LD  D+ AS++D V + +G++VSF
Sbjct  1    MFLNKIVDAITGKDDG------KKVKGTVVLMKKNVLDFTDVNASIVDGVLDFLGRRVSF  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEW-DESIGVP  431
            +LIS    D   GL+GK  K +YLENW +  TP+ AGES + VTFEW DE  GVP
Sbjct  55   QLISNSVHD-ANGLEGKLSKPAYLENWITNITPVVAGESTFSVTFEWDDEEFGVP  108


 Score = 31.6 bits (70),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H SEF+LK
Sbjct  108  PGAFIIKNLHFSEFFLK  124



>ref|XP_011090735.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=870

 Score =   107 bits (267),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L K +G++ GK     + + K I+G VVLMKKN +D  D+GASVLD +HE+ G+ VSF+
Sbjct  1    MLEKFLGSVCGKTRDEPKIQEKKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAA-GESAYEVTFEWDESIGVP  431
            LISA   D   G +GK GK +YLE W SK T L A  E+ ++V+F+WDES+GVP
Sbjct  61   LISAEKTDLANGKRGKLGKEAYLEGWVSKFTSLTAEAEATFDVSFKWDESLGVP  114


 Score = 36.2 bits (82),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF++ N+HHS+FYLK
Sbjct  114  PGAFIVRNHHHSQFYLK  130



>ref|XP_011090733.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=881

 Score =   107 bits (267),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L K +G++ GK     + + K I+G VVLMKKN +D  D+GASVLD +HE+ G+ VSF+
Sbjct  12   MLEKFLGSVCGKTRDEPKIQEKKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQ  71

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAA-GESAYEVTFEWDESIGVP  431
            LISA   D   G +GK GK +YLE W SK T L A  E+ ++V+F+WDES+GVP
Sbjct  72   LISAEKTDLANGKRGKLGKEAYLEGWVSKFTSLTAEAEATFDVSFKWDESLGVP  125


 Score = 35.8 bits (81),  Expect(2) = 9e-26, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF++ N+HHS+FYLK
Sbjct  125  PGAFIVRNHHHSQFYLK  141



>gb|AES82497.2| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=867

 Score =   103 bits (258),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +   I+  ++   D    +  +I++G V+LMKKN LD KD+ AS  D +HELVG++VS +
Sbjct  1    MFHTIMNVLSIHDDNNKNKNDRIMRGEVILMKKNVLDFKDLSASFFDGIHELVGKRVSLQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTF  404
            L+SA   DP  G++GK GK +YLE+W S  TPL AGES Y+VTF
Sbjct  61   LVSADKGDPGNGMKGKVGKPAYLEDWNSTITPLIAGESTYKVTF  104


 Score = 39.3 bits (90),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  115  PGAFLIKNNHHSEFYLK  131



>ref|XP_006392468.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
 gb|ESQ29754.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
Length=856

 Score =   107 bits (266),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 76/113 (67%), Gaps = 7/113 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G +V   TG  +AA       +KGTVVLMKKN LD  D  AS LD +HE +G +V+ +
Sbjct  1    MIGDLVDLFTGGGNAAK------VKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNRVTLQ  54

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+  +DPE G +GK GK ++LE+W +  T L AGESA++VTF++D+  G P
Sbjct  55   LISSDLSDPENGAKGKLGKAAHLEDWITTITSLTAGESAFKVTFDYDKDFGYP  107


 Score = 35.0 bits (79),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEFYLK
Sbjct  105  GYPGAFLIRNSHFSEFYLK  123



>ref|XP_006838255.1| hypothetical protein AMTR_s00103p00053790 [Amborella trichopoda]
 gb|ERN00824.1| hypothetical protein AMTR_s00103p00053790 [Amborella trichopoda]
Length=259

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +3

Query  153  KPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGK  332
            K   +KG+VVL KKN LD  D   S LD++HE +G++VS  L+SA +ADPE+GL+GK GK
Sbjct  18   KGSTMKGSVVLQKKNVLDFNDFHVSFLDSLHEFLGKRVSLHLVSATHADPERGLKGKLGK  77

Query  333  VSYLENWSKP-TPLAAGESAYEVTFEWDESIGVP  431
             +YLE W K    LA GE+ + V FEWDES G P
Sbjct  78   AAYLEEWGKKQVGLAVGEAQFTVDFEWDESFGTP  111



>ref|XP_003626279.1| Chalcone synthase [Medicago truncatula]
Length=1317

 Score =   102 bits (253),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            D    +  +I++G V+LMKKN LD KD+ AS  D +HELVG++VS +L+SA   DP  G+
Sbjct  9    DNNKNKNDRIMRGEVILMKKNVLDFKDLSASFFDGIHELVGKRVSLQLVSADKGDPGNGM  68

Query  315  QGKRGKVSYLENW-SKPTPLAAGESAYEVTF  404
            +GK GK +YLE+W S  TPL AGES Y+VTF
Sbjct  69   KGKVGKPAYLEDWNSTITPLIAGESTYKVTF  99


 Score = 39.7 bits (91),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 15/17 (88%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEFYLK
Sbjct  110  PGAFLIKNNHHSEFYLK  126



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score =   104 bits (260),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 75/96 (78%), Gaps = 3/96 (3%)
 Frame = +3

Query  153  KPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELI--SAVNADPEKGLQGKR  326
            K K +KG VVLMKKN L++ DI ASV+D+V E++G+KV+F+LI  S+++ D E+ L+GK 
Sbjct  17   KKKTMKGVVVLMKKNLLEVNDIAASVVDSVDEILGRKVAFQLITTSSLDHDSEENLKGKP  76

Query  327  GKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            GK++YLE+W +K  PL AG++ Y VTFEW + +GVP
Sbjct  77   GKIAYLEDWITKIGPLTAGDATYTVTFEWTKEMGVP  112


 Score = 36.6 bits (83),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  412  TRASAFPGAFVINNNHHSEFYLK  480
            T+    PGAF + N HHSEFYLK
Sbjct  106  TKEMGVPGAFTVTNFHHSEFYLK  128



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   109 bits (272),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKGTVVLMKKN LD  DI AS LD VHEL+G+ VS +L+SAV+ DP+  L+GK GKV+ +
Sbjct  36   IKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQDPD-SLRGKLGKVADV  94

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVPRGV  440
            E W +  TPL AGE+ + +TFEWDE++G+P  +
Sbjct  95   EKWVTTRTPLTAGETIFTITFEWDENMGLPGAI  127


 Score = 32.0 bits (71),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGA +I N+HHS+ YLK
Sbjct  122  GLPGAIIIKNHHHSQLYLK  140



>ref|XP_009790810.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=853

 Score =   109 bits (273),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            +KGTVVLMKKN LDL D+ ASV+D V E++G KVS +LI AVNADP    +GK GK ++L
Sbjct  15   VKGTVVLMKKNFLDLDDVKASVVDRVDEVLGHKVSLQLIGAVNADPANKCRGKPGKPAFL  74

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            ENW +K TPL A ++ + VTFEW+E  GVP
Sbjct  75   ENWEAKFTPLTATDATFRVTFEWEEEAGVP  104


 Score = 31.6 bits (70),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  421  SAFPGAFVINNNHHSEFYLK  480
            +  PGAF+I N H  EFYLK
Sbjct  101  AGVPGAFLIKNFHQKEFYLK  120



>gb|KJB80990.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=860

 Score =   102 bits (253),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 53/113 (47%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  ++ A+ G  +   + KP+ IKGTV+LMKKN LD  D  AS LD  HEL+G++VSF+
Sbjct  1    MLSHLLHAVAGDDNGNEKMKPEKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+ + D      GK GK +YLE+W S  T   AGES ++V F+++E IG+P
Sbjct  61   LISSQHVD-----AGKLGKEAYLEDWNSTETSAVAGESKFDVNFDFEEEIGLP  108


 Score = 39.3 bits (90),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGAF+I NNHHSEFYLK
Sbjct  106  GLPGAFLIKNNHHSEFYLK  124



>gb|AAO03558.1| lipoxygenase 1 [Brassica napus]
Length=857

 Score =   105 bits (263),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G +V  +TG    AA+     +KGTVVLMKKN LD  D  AS LD +HE +G KV+  
Sbjct  1    MIGDLVDLLTGGGGNAAK-----VKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLR  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   DPE G  GK GK ++LE+W +  T L AGESA++VTF++D+  G P
Sbjct  56   LISSDVTDPENGSNGKLGKAAHLEDWITTITSLTAGESAFKVTFDYDQDFGYP  108


 Score = 35.0 bits (79),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEFYLK
Sbjct  106  GYPGAFLIRNSHFSEFYLK  124



>emb|CDY43490.1| BnaA01g21450D [Brassica napus]
Length=1203

 Score =   105 bits (263),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G +V  +TG    AA+     +KGTVVLMKKN LD  D  AS LD +HE +G KV+  
Sbjct  1    MIGDLVDLLTGGGGNAAK-----VKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLR  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   DPE G  GK GK ++LE+W +  T L AGESA++VTF++D+  G P
Sbjct  56   LISSDVTDPENGSNGKLGKAAHLEDWITTITSLTAGESAFKVTFDYDQDFGYP  108


 Score = 35.0 bits (79),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEFYLK
Sbjct  106  GYPGAFLIRNSHFSEFYLK  124


 Score = 42.0 bits (97),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 39/66 (59%), Gaps = 3/66 (5%)
 Frame = +3

Query  240  VHELVGQKVSFELISAVNAD-PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWD  413
            +H+ +  ++     S ++ D  E G  GK GK ++LE+W +  T L AGESA++V  ++D
Sbjct  390  LHKYIN-RIHTSFNSLIHCDLAENGSNGKLGKAAHLEDWITTITSLTAGESAFKVRIDYD  448

Query  414  ESIGVP  431
            +  G P
Sbjct  449  QDFGYP  454


 Score = 35.0 bits (79),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEFYLK
Sbjct  452  GYPGAFLIRNSHFSEFYLK  470



>gb|KHN02707.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=850

 Score =   102 bits (254),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRG  329
            E+ K +KG VVLMKK  LD  DI A+VLD VHEL+G+ VS +LISA   DP  GL+GK G
Sbjct  2    ERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDP--GLRGKLG  59

Query  330  KVSYLENW-SKPTPL-AAGESAYEVTFEWDESIGVP  431
            KV++LE W S  T L +A ++ + VTFEWDES+GVP
Sbjct  60   KVAHLERWVSTITSLTSATDTEFTVTFEWDESMGVP  95


 Score = 38.9 bits (89),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHS+FYLK
Sbjct  95   PGAFIIRNNHHSQFYLK  111



>ref|XP_009119596.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Brassica rapa]
Length=857

 Score =   105 bits (263),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G +V  +TG    AA+     +KGTVVLMKKN LD  D  AS LD +HE +G KV+  
Sbjct  1    MIGDLVDLLTGGGGNAAK-----VKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLR  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   DPE G  GK GK ++LE+W +  T L AGESA++VTF++D+  G P
Sbjct  56   LISSDVTDPENGSNGKLGKAAHLEDWITTITSLTAGESAFKVTFDYDQDFGYP  108


 Score = 35.0 bits (79),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEFYLK
Sbjct  106  GYPGAFLIRNSHFSEFYLK  124



>ref|XP_004496744.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496745.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496746.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=858

 Score =   102 bits (253),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K +KG VVLMKK+ LD  DI A++LD +HE +G+ VS +LISA   DPEKGL+GK GKV+
Sbjct  8    KEVKGRVVLMKKSLLDFHDIKANLLDRIHEFLGKGVSLQLISATTPDPEKGLRGKHGKVA  67

Query  339  YLENW--SKPTPLAAGESAYEVTFEWD-ESIGVP  431
            YLE W  S  +   A E+ + VTF+WD E +GVP
Sbjct  68   YLERWISSISSLTTATETEFSVTFDWDHEKMGVP  101


 Score = 38.5 bits (88),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHS+FYLK
Sbjct  101  PGAFIITNNHHSQFYLK  117



>gb|EYU41500.1| hypothetical protein MIMGU_mgv1a001165mg [Erythranthe guttata]
Length=874

 Score =   102 bits (255),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++ K++G++ GK       + K +KGTVVLMKKN +D+ D G+S+LD  HEL G+ VS +
Sbjct  1    MMEKLLGSVCGKIKDEPIVELKKVKGTVVLMKKNVMDVTDFGSSILDRFHELFGKGVSLQ  60

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPL-AAGESAYEVTFEWDESIGVP  431
            L+S+VN D     +GK GK ++LENW SK T L A  E++++V F WDES G+P
Sbjct  61   LVSSVNGDSANENKGKLGKEAFLENWISKITSLNAKDEASFDVVFNWDESHGIP  114


 Score = 37.7 bits (86),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 14/25 (56%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = +1

Query  406  NGTRASAFPGAFVINNNHHSEFYLK  480
            N   +   PGAF+I N+HHS+FYLK
Sbjct  106  NWDESHGIPGAFIIKNHHHSQFYLK  130



>ref|XP_010549787.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=861

 Score =   102 bits (255),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 55/113 (49%), Positives = 73/113 (65%), Gaps = 4/113 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G++V   TG  DA A  K   +KG VVLMKKN LD  D  AS LD +HE +G KV+  
Sbjct  1    MIGQLVDLFTGGDDAGAGTK---VKGMVVLMKKNVLDFNDFNASFLDHLHEFLGNKVTLR  57

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+  AD E G +GK GK ++LE+W +  TPL  GESA++VTF+ +   G P
Sbjct  58   LISSDVADSENGSKGKLGKPAHLEDWITTVTPLTVGESAFKVTFDCENGFGFP  110


 Score = 37.4 bits (85),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             FPGAF I NNH SEFYLK
Sbjct  108  GFPGAFTIRNNHFSEFYLK  126



>emb|CDO99039.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   107 bits (266),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 83/118 (70%), Gaps = 8/118 (7%)
 Frame = +3

Query  96   ILGKIVGAITGKH-DAAAE----EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQ  260
            +LGK++  + GK+ D   E    E+PKI KGTVVLMKKN LD+KD+GAS+LD +HEL  +
Sbjct  12   MLGKLLETVCGKNRDTPIEIENGERPKI-KGTVVLMKKNILDVKDVGASILDRLHELFHR  70

Query  261  KVSFELISAVNADPEKGLQGKRGKVSYLENWS-KPTPLAAGESAYEVTFEWDESIGVP  431
             VS +L+SA   DPE G +GK GK + LE W+ K T ++A +  ++V FEWDES+G P
Sbjct  71   GVSIQLVSADQIDPENG-RGKLGKAAILEKWNAKLTSVSATDVKFDVNFEWDESMGAP  127


 Score = 33.1 bits (74),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA ++ N+HHS+FYLK
Sbjct  127  PGALIVRNHHHSQFYLK  143



>ref|XP_010905215.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Elaeis guineensis]
Length=866

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +3

Query  117  AITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNA  296
            AITGK       K   IKGTVVLMKKN LD  D+ AS+LD +HE++GQ V+F+L+SA   
Sbjct  6    AITGKRPEGG--KGTKIKGTVVLMKKNVLDFNDLHASLLDRMHEILGQGVTFQLVSATEG  63

Query  297  DPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            DP  G +GK G  +YLE W +  T L+AGES + VTF WDES G+P  V 
Sbjct  64   DPNNGKRGKVGPPAYLEEWITTLTSLSAGESRFNVTFNWDESQGIPGAVI  113



>gb|AAD09861.1| lipoxygenase [Persea americana]
Length=858

 Score =   108 bits (270),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 58/113 (51%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = +3

Query  108  IVGAITG-KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELIS  284
            I+ A+ G  HD    EK   IKG+VVLMKKN LD  D  AS LD VHE +G+ VSF+L+S
Sbjct  3    IIDALMGTSHD----EKSVQIKGSVVLMKKNVLDFNDFQASFLDRVHEFLGKGVSFQLVS  58

Query  285  AVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGV  440
            A + DP+ G +GK G+ +YLE+W +  T + AGES + VTF WD S G P  V
Sbjct  59   AEHGDPDNGNRGKVGEAAYLEDWITTLTSIQAGESVFNVTFNWDMSFGTPGAV  111


 Score = 31.6 bits (70),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA ++ N HHSEF+LK
Sbjct  108  PGAVIVKNFHHSEFFLK  124



>gb|ACU20079.1| unknown [Glycine max]
Length=177

 Score =   103 bits (256),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRG  329
            E+ K +KG VVLMKK  LD  DI A+VLD VHEL+G+ VS +LISA   DP  GL+GK G
Sbjct  2    ERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDP--GLRGKLG  59

Query  330  KVSYLENW-SKPTPL-AAGESAYEVTFEWDESIGVP  431
            KV++LE W S  T L +A ++ + VTFEWDES+GVP
Sbjct  60   KVAHLERWVSTITSLTSATDTEFTVTFEWDESMGVP  95


 Score = 37.0 bits (84),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHS+FYLK
Sbjct  95   PGAFIIRNNHHSQFYLK  111



>ref|XP_006607065.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like, partial 
[Glycine max]
Length=436

 Score =   102 bits (254),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRG  329
            E+ K +KG VVLMKK  LD  DI A+VLD VHEL+G+ VS +LISA   DP  GL+GK G
Sbjct  2    ERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDP--GLRGKLG  59

Query  330  KVSYLENW-SKPTPL-AAGESAYEVTFEWDESIGVP  431
            KV++LE W S  T L +A ++ + VTFEWDES+GVP
Sbjct  60   KVAHLERWVSTITSLTSATDTEFTVTFEWDESMGVP  95


 Score = 37.0 bits (84),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHS+FYLK
Sbjct  95   PGAFIIRNNHHSQFYLK  111



>ref|XP_010674736.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score =   109 bits (272),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  +V A++G        K K IKG VVLMKK  LD  D  AS+LD   EL+G+KVSF+
Sbjct  1    MLHNLVDALSGN-----VTKKKEIKGRVVLMKKYVLDFNDFTASILDRFDELLGKKVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            L SAVNADPE   +GK GK SYL +W +  T L  GESA+ +TF WDE IGVP  + 
Sbjct  56   LASAVNADPENESKGKLGKPSYLGDWLTNFTGLTPGESAFSITFAWDEDIGVPGAIV  112


 Score = 30.0 bits (66),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA VI N H ++FYLK
Sbjct  108  PGAIVIRNEHQNQFYLK  124



>gb|AGN75068.1| lipoxygenase 2 [Momordica charantia]
Length=845

 Score =   102 bits (254),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K I+GTV+LMK N LD  D   S+LD ++E +G++VS +L+SA+N D   GL+GK G+ +
Sbjct  11   KKIEGTVILMKSNVLDFNDFHESLLDYLYEFLGKRVSLQLVSAINGDHSNGLRGKLGEAA  70

Query  339  YLENW-SKPTPLAAGESAYEVTFEWD-ESIGVP  431
            YLE+W +  TPL AGE+A++V F+WD E +G+P
Sbjct  71   YLEDWITTRTPLIAGEAAFKVRFDWDEEEMGIP  103


 Score = 37.0 bits (84),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF I N+HHSEFYLK
Sbjct  103  PGAFFIRNDHHSEFYLK  119



>ref|XP_006850111.1| hypothetical protein AMTR_s00022p00225700 [Amborella trichopoda]
 gb|ERN11692.1| hypothetical protein AMTR_s00022p00225700 [Amborella trichopoda]
Length=618

 Score =   105 bits (261),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 50/93 (54%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = +3

Query  162  IIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSY  341
            +I+G +VL KKN LD  D   S LD + E +G++VS +L+SA +ADPE+GL+GK GK +Y
Sbjct  25   MIEGWLVLKKKNVLDFNDFHLSFLDNLDEFLGKRVSLQLVSATHADPERGLKGKLGKAAY  84

Query  342  LENWSKP-TPLAAGESAYEVTFEWDESIGVPRG  437
            LE WSK    LA GE+ + V FEWDES G+P G
Sbjct  85   LEEWSKKHDGLAVGEAQFIVNFEWDESFGIPGG  117


 Score = 33.9 bits (76),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PG F+I N HH+EFYLK
Sbjct  115  PGGFIIRNEHHAEFYLK  131



>ref|XP_010025194.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=871

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 74/115 (64%), Gaps = 5/115 (4%)
 Frame = +3

Query  126  GKHDAAAEEK----PKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVN  293
            G+ D A   +     K +KGTVVLMKK  LD  D  ASVLD V EL+G+KVS  L+S V+
Sbjct  13   GRGDKAGHRRKAGRSKKVKGTVVLMKKYVLDFNDFNASVLDNVDELLGKKVSLRLVSVVH  72

Query  294  ADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVCDQQQ  455
             DPE  L+GK GK ++LE W +  TPL  G+SA++VTF WD+ +GVP  +  Q  
Sbjct  73   GDPENCLRGKLGKPAHLEGWITTITPLTTGDSAFKVTFNWDKEVGVPGAIIVQNN  127



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score =   103 bits (258),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 79/122 (65%), Gaps = 11/122 (9%)
 Frame = +3

Query  93   MILGKIVGAITGKHD-----AAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVG  257
            M+L K+V A+TGK D          + K IKG VVL +K+ LD      S+LD VHEL+G
Sbjct  1    MLLHKVVEAVTGKRDDENGNGNGNGEEKKIKGRVVLTRKSELDF--FSDSILDNVHELLG  58

Query  258  QKVSFELISAVNADPE---KGLQGKRGKVSYLENWSKPTPLAA-GESAYEVTFEWDESIG  425
            QKVS +LISAVN DP    KGL+GK GK +YLE+W     L   G+SA++V F+W++ +G
Sbjct  59   QKVSLQLISAVNGDPPAAGKGLRGKLGKAAYLEDWITTITLPGHGDSAFDVAFDWEDEVG  118

Query  426  VP  431
            +P
Sbjct  119  LP  120


 Score = 34.7 bits (78),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGAF+I N HH+EFYLK
Sbjct  118  GLPGAFLIRNLHHTEFYLK  136



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 78/125 (62%), Gaps = 10/125 (8%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M+LGK+  A++           K IKG VVLM+KN LD  D  AS++D + + +GQKVS 
Sbjct  1    MLLGKLAEALSPT---------KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSL  51

Query  273  ELISAVNADPEKGLQGKRGKVSYLENWS-KPTPLAAGESAYEVTFEWDESIGVPRGVCDQ  449
            EL+S+V AD   GL+GKR K +YL++W  K T LA+GESA+++ FEW E  GVP     +
Sbjct  52   ELVSSVQADLGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPGAFIIK  111

Query  450  QQSPQ  464
               P 
Sbjct  112  NNHPN  116



>ref|XP_011036801.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=863

 Score =   104 bits (260),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNAD-PEKGLQGKRGKVSY  341
            IKGTVVLMKKN L+  D  ASVLD  HEL+GQ VS ++I A  +D PE GL+ K GK + 
Sbjct  21   IKGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQVIGAAKSDPPENGLKEKLGKPAN  80

Query  342  LENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LENW +   PL AGE+A++VTF+WDE IGVP
Sbjct  81   LENWITTIDPLIAGETAFKVTFDWDEEIGVP  111


 Score = 33.5 bits (75),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P A +I NNHHSEFYLK
Sbjct  111  PVALLIRNNHHSEFYLK  127



>ref|NP_001275351.1| 5-lipoxygenase [Solanum tuberosum]
 gb|AAD04258.1| 5-lipoxygenase [Solanum tuberosum]
Length=864

 Score =   107 bits (267),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (67%), Gaps = 9/117 (8%)
 Frame = +3

Query  93   MILGKIVGA--ITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKV  266
            M +G+I+G   + G HD +     K +KGTVV+MKKNALD  D+  S+ D   +++GQKV
Sbjct  1    MNIGQIMGGRELFGGHDDS-----KKVKGTVVMMKKNALDFTDLAGSLTDIAFDVLGQKV  55

Query  267  SFELISAVNADPEKGLQGKRGKVSYLEN-WSKPTPLAAG-ESAYEVTFEWDESIGVP  431
            SF+LIS+V  DP  GLQGK    +YLEN     TPL AG E+A+ VTF+W+E  GVP
Sbjct  56   SFQLISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVP  112


 Score = 30.4 bits (67),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  112  PGAFIIKNTHINEFFLK  128



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score =   105 bits (263),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 9/115 (8%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            MIL KIV +ITGK D    EK   +KGTVVLMKKN LD  D+ AS++D   E +G++VSF
Sbjct  1    MILNKIVDSITGKDDG---EK---VKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSF  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDES-IGVP  431
            +LIS    D   GL+GK    +YLENW +  TP+ AGES + VTF+WD+   GVP
Sbjct  55   QLISNSVHD-ANGLEGKLSNPAYLENWITNITPVVAGESTFSVTFDWDDDEFGVP  108


 Score = 31.6 bits (70),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H SEF+LK
Sbjct  108  PGAFIIKNLHFSEFFLK  124



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 75/120 (63%), Gaps = 5/120 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPK---IIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKV  266
            +L     AITGKH     E PK    +KG+V+LMKKN LD  D  AS+LD +HE +G+ V
Sbjct  1    MLHGFFDAITGKHHEH-HEAPKSSTTVKGSVLLMKKNVLDFNDFNASLLDGLHEFLGKGV  59

Query  267  SFELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            SF+L+SA  ADP  G +GK G  +YLE W +  T +A GE+ + V F WDES GVP  + 
Sbjct  60   SFQLVSATVADPHNGNKGKIGPPAYLEEWITTMTSVATGETKFTVHFSWDESQGVPGAII  119



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score =   102 bits (255),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 51/97 (53%), Positives = 71/97 (73%), Gaps = 3/97 (3%)
 Frame = +3

Query  147  EEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKR  326
            EEK KI+ G VVLMK N LD  D  AS+LDT++E VG++VS +L+SA++ DP   L+GK 
Sbjct  5    EEKKKIL-GEVVLMKSNVLDFDDFNASLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKL  63

Query  327  GKVSYLENW-SKPTPLAAGESAYEVTFEWDES-IGVP  431
            G+ +YLE W +  TPL  GE+ ++VTF+WDE  +G+P
Sbjct  64   GEEAYLEEWITTITPLTTGEATFKVTFDWDEEHMGIP  100


 Score = 34.7 bits (78),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF I N+HH++FYLK
Sbjct  100  PGAFFITNHHHTQFYLK  116



>gb|AEZ50136.1| lipoxygenase [Diospyros kaki]
Length=901

 Score =   100 bits (250),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 56/103 (54%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = +3

Query  129  KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEK  308
            KH+ A  EK   IKG+VVLMKKN LD  D+ AS  D   E+ G KVS +LISAVN DPE 
Sbjct  50   KHEGAEMEK---IKGSVVLMKKNLLDFSDLVASAADRFDEIRGNKVSLQLISAVNGDPEN  106

Query  309  GLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEW-DESIGVP  431
              +GK GK +YLE+W +K  PL A + A+ +TFEW +E IG+P
Sbjct  107  DNRGKVGKPAYLEDWFTKFDPLTAADVAFNITFEWNEEEIGLP  149


 Score = 36.2 bits (82),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
              PGAF+I N+HH+EFYL+
Sbjct  147  GLPGAFIIKNSHHNEFYLR  165



>gb|ADL41189.1| lipoxygenase [Camellia sinensis]
Length=868

 Score =   101 bits (251),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 67/101 (66%), Gaps = 6/101 (6%)
 Frame = +3

Query  129  KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEK  308
            KHD       K IKGTVVLMKK+ LD   +   ++D + E+VGQKVS +LISAVN DP K
Sbjct  14   KHDE------KKIKGTVVLMKKSLLDFDGLSLPLVDRIEEVVGQKVSLQLISAVNGDPGK  67

Query  309  GLQGKRGKVSYLENWSKPTPLAAGESAYEVTFEWDESIGVP  431
             L+GK GK +YLE+W       + + ++ VTFEWDE +GVP
Sbjct  68   DLRGKIGKKAYLEDWITKITTPSADVSFNVTFEWDEEVGVP  108


 Score = 35.8 bits (81),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF I N+HH+EFYLK
Sbjct  108  PGAFTITNSHHNEFYLK  124



>gb|ABF60002.1| lipoxygenase 2 [Actinidia deliciosa]
Length=865

 Score =   100 bits (248),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K I+GTVVLMKK  LD  D+ ASV D   E++G KVS +LISAVN DPEK L+GK GK +
Sbjct  21   KKIQGTVVLMKKKFLDSNDLTASVTDRFDEILGNKVSLQLISAVNGDPEKELRGKLGKPA  80

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             LE+W +K T L A    + VTFEW+E IGVP
Sbjct  81   NLEDWDTKITALTAPGVTFNVTFEWEEEIGVP  112


 Score = 37.0 bits (84),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+HH+EFYLK
Sbjct  112  PGAFIIKNSHHNEFYLK  128



>ref|XP_010511239.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   103 bits (257),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G++V  +TG    + E   K +KGTVVLMKKN LD  D  AS LD +HE +G K++  
Sbjct  1    MIGELVDLLTGG--GSDETTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLR  58

Query  276  LISAVNADPEKGLQGKRGKVSYLENWSKP-TPLAAGESAYEVTFEWDESIGVP  431
            LIS+   D   G +GK GK ++LE+W  P T L AGESA++VTF++D   G P
Sbjct  59   LISSDVTDSANGSKGKLGKAAHLEDWITPITSLTAGESAFKVTFDYDSDFGYP  111


 Score = 33.5 bits (75),  Expect(2) = 7e-24, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEF+LK
Sbjct  109  GYPGAFLIRNSHFSEFFLK  127



>ref|XP_004156418.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   102 bits (254),  Expect(2) = 8e-24, Method: Composition-based stats.
 Identities = 50/99 (51%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = +3

Query  141  AAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQG  320
            + EE+ KI+ G VVLMK N LD  D  AS+LDT++E VG++VS +L+SA++ DP   L+G
Sbjct  3    SKEERKKIL-GEVVLMKSNVLDFDDFSASLLDTLYEFVGKRVSLQLVSAIHGDPSNELRG  61

Query  321  KRGKVSYLENW-SKPTPLAAGESAYEVTFEWDES-IGVP  431
            K G+ +YLE W +  TPL  GE+ ++VTF+WDE  +G+P
Sbjct  62   KLGEEAYLEEWITTITPLTTGEATFKVTFDWDEQRMGIP  100


 Score = 34.7 bits (78),  Expect(2) = 8e-24, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF I N+HHS FYLK
Sbjct  100  PGAFFITNHHHSHFYLK  116



>gb|AFU51542.1| lipoxygenase 3 [Capsicum annuum]
Length=859

 Score =   107 bits (267),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 53/95 (56%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +3

Query  150  EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRG  329
            +  K +KGTVV+MKKNALD  D+  S+ D + E +GQKVS +LIS+V  DP  GLQGK  
Sbjct  13   DSSKKVKGTVVMMKKNALDFTDLAGSLTDKLFEALGQKVSLQLISSVQGDPANGLQGKHS  72

Query  330  KVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
              +YLEN+   PT L AGESA+ VTF+W+E  GVP
Sbjct  73   NPAYLENFLFTPTRLTAGESAFGVTFDWNEEFGVP  107


 Score = 29.3 bits (64),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF I N+H +EF+LK
Sbjct  107  PGAFTIKNSHINEFFLK  123



>gb|AIC82456.1| lipoxygenase [Cocos nucifera]
Length=852

 Score =   102 bits (253),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            +KGTV+LMKKN LD  D  AS+ D + E +G+ VSF+L+S+  ADP  G +GK G+  Y+
Sbjct  6    VKGTVILMKKNVLDFTDFHASLHDRLDEFLGKGVSFQLVSSTIADPNNGNKGKVGEPGYI  65

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
            E W +K T +AAGES ++VTF+WDES G+P  V 
Sbjct  66   EEWITKITSIAAGESKFQVTFQWDESEGIPGAVI  99


 Score = 34.7 bits (78),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  418  ASAFPGAFVINNNHHSEFYLK  480
            +   PGA ++ N+HHSEFYLK
Sbjct  91   SEGIPGAVIVRNHHHSEFYLK  111



>dbj|BAH57745.1| lipoxygenase [Actinidia arguta]
Length=886

 Score =   102 bits (254),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKG VVLMKKN LD+  +GAS+LD VHE++G+ VS +LISA   DP  G +GK GK +YL
Sbjct  40   IKGRVVLMKKNVLDMNHLGASILDRVHEVLGKGVSIQLISANRGDPANGKRGKLGKTAYL  99

Query  345  ENW-SKPTPLA-AGESAYEVTFEWDESIGVP  431
            ENW +  T +A A ++++ V+FEWDE++G+P
Sbjct  100  ENWIATITSVATADDASFNVSFEWDEAMGIP  130


 Score = 33.9 bits (76),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 13/21 (62%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  418  ASAFPGAFVINNNHHSEFYLK  480
            A   PGAF+I N+HH E YLK
Sbjct  126  AMGIPGAFIIKNHHHYEVYLK  146



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score =   107 bits (266),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 80/116 (69%), Gaps = 12/116 (10%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M LG IV AI G +D    EK   +KG V+LMKKN LD  DI ASV+D V +L+GQKVS 
Sbjct  1    MSLGGIVDAIVGNNDG---EK---VKGRVILMKKNVLDFTDISASVVDGVADLLGQKVSI  54

Query  273  ELIS-AVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDE-SIGVP  431
            +LIS +VNAD   GL+GKR K +YLE+W +  TP+ AGES + VTF+WD    GVP
Sbjct  55   QLISGSVNAD---GLEGKRSKPAYLESWLTHITPIIAGESTFSVTFDWDHKEFGVP  107


 Score = 29.3 bits (64),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  107  PGAFIIKNLHLNEFFLK  123



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score =   101 bits (251),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  186  MKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNAD-PEKGLQGKRGKVSYLENW-SK  359
            MKKN L   D  ASVLD VHEL+GQ+VS +LISAVN+D  +  L+GK G+ +YLE W + 
Sbjct  1    MKKNVLGFNDFHASVLDRVHELLGQRVSLQLISAVNSDRSDNDLKGKLGEPAYLEEWVTT  60

Query  360  PTPLAAGESAYEVTFEWDESIGVP  431
             TPL AGE+A++VTF+WDE IGVP
Sbjct  61   VTPLTAGEAAFKVTFDWDEEIGVP  84


 Score = 34.7 bits (78),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNH SEFYLK
Sbjct  84   PGAFLIRNNHLSEFYLK  100



>ref|XP_003591120.1| Lipoxygenase [Medicago truncatula]
 gb|AES61371.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=858

 Score =   102 bits (254),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +L  I+ A TG  D +   +   ++GTVVLMKK+ LD  D  AS+LD +HE VG+ VS +
Sbjct  1    MLHNILNAFTG--DKSNRHQ---VEGTVVLMKKSVLDFNDFTASMLDGLHEFVGKGVSLQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENWSKPTPLAAGESAYEVTFEWDESIGVP  431
            L+S VN D E GL+GK GK + L+  +   PL+ GES ++V+F+WDE IG P
Sbjct  56   LVSTVNTDSENGLKGKLGKPANLDWSTASKPLSTGESTFKVSFDWDEEIGTP  107


 Score = 33.1 bits (74),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNH +EFYLK
Sbjct  107  PGAFLIWNNHDNEFYLK  123



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score = 99.8 bits (247),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G++V  ++G  D+ A  K   +KGTVVLMKKN LD  D  AS LD + E +G KV+  
Sbjct  1    MIGQLVDLLSGGDDSGAGAK---VKGTVVLMKKNVLDFNDFNASFLDRLTEFLGNKVTLR  57

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+  AD   G +GK GK ++LE W +  TPL AGESA++VTF+++   G P
Sbjct  58   LISSDVADSGNGSKGKLGKPAHLEEWITTITPLTAGESAFKVTFDYENGFGFP  110


 Score = 35.8 bits (81),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             FPGAF I N+H SEFYLK
Sbjct  108  GFPGAFAIRNDHFSEFYLK  126



>gb|KFK35600.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=857

 Score =   100 bits (248),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G +V   TG  +   +     +KGTVVLMKKN LD  D  AS LD +HE +G KV+  
Sbjct  1    MMGDLVDLFTGGGNVKTK-----VKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLR  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   DP  G +GK GK  +LE+W +  T L AGESA++VTF++D   G P
Sbjct  56   LISSDLTDPADGSKGKLGKAGHLEDWITTITSLTAGESAFKVTFDYDSDFGYP  108


 Score = 35.0 bits (79),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEFYLK
Sbjct  106  GYPGAFLIRNSHFSEFYLK  124



>ref|XP_010323943.1| PREDICTED: lipoxygenase isoform X1 [Solanum lycopersicum]
Length=862

 Score =   105 bits (263),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 9/115 (8%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            MIL KIV +ITGK D    EK   +KGTVVLMKKN LD  D+ AS++D   E +G++VSF
Sbjct  1    MILNKIVDSITGKDDG---EK---VKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSF  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDES-IGVP  431
            +LIS    D   GL+GK    +YLENW +  TP+ AGES + VTF+WD +  GVP
Sbjct  55   QLISNSVHD-ANGLEGKLSNPAYLENWITNITPIIAGESTFSVTFDWDRNEFGVP  108


 Score = 29.3 bits (64),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  108  PGAFIIKNFHLNEFFLK  124



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score = 97.1 bits (240),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  186  MKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEK-GLQGKRGKVSYLENW-SK  359
            MKKN LD  D+ ASVLD V+ELVGQ VS +LISAV+AD  K G +GK G+ +YLE+W + 
Sbjct  1    MKKNVLDFNDLNASVLDGVYELVGQGVSLQLISAVHADDSKNGWKGKLGQPAYLEDWITT  60

Query  360  PTPLAAGESAYEVTFEWDESIGVP  431
             TPL  GESA++VTF+++E +GVP
Sbjct  61   ITPLTTGESAFKVTFDYEEEVGVP  84


 Score = 38.1 bits (87),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHSEF+LK
Sbjct  84   PGAFLIKNNHHSEFFLK  100



>ref|XP_010667400.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=895

 Score =   102 bits (255),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +3

Query  162  IIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNA-DPEKGLQGKRGKVS  338
            IIKGT+VLMKKN LD+ D+ AS+LD +HEL G+ VS +LISA  + +P +  +GK GK S
Sbjct  50   IIKGTIVLMKKNVLDMTDVSASILDKIHELGGKGVSLQLISADQSNEPARISRGKLGKAS  109

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            Y+E W S  TPL AGE+ + +TF+W ES+ VP
Sbjct  110  YVEKWVSTITPLTAGETTFNITFDWHESMDVP  141


 Score = 32.3 bits (72),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H S+FYLK
Sbjct  141  PGAFIIKNYHRSQFYLK  157



>ref|XP_006382595.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
 gb|ERP60392.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
Length=863

 Score =   101 bits (251),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 74/114 (65%), Gaps = 5/114 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            +   IV AI      A + K KI KGTVVLMKKN L+  D  ASVLD  HEL+GQ VS +
Sbjct  1    MFQNIVNAIASC--CAGDSKMKI-KGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQ  57

Query  276  LISAVNAD-PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +I    +D PE GL+ K GK + LENW +   PL AGE+ ++VTF+WDE IG+P
Sbjct  58   VIGTAKSDPPENGLKEKLGKPANLENWITTIDPLIAGETEFKVTFDWDEEIGIP  111


 Score = 33.5 bits (75),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P A +I NNHHSEFYLK
Sbjct  111  PVALLIRNNHHSEFYLK  127



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=860

 Score = 97.4 bits (241),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K IKGTVVLMK N LD  D  ASVLD VHE +GQ VS +LIS    D   G QGK GKV+
Sbjct  19   KKIKGTVVLMKNNVLDFNDFHASVLDRVHEFLGQGVSLQLIS---GDSSTGSQGKLGKVA  75

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            YLENW     P+ AGE+ ++VTF+ +  IGVP
Sbjct  76   YLENWIGTLGPVTAGETTFKVTFDVEGDIGVP  107


 Score = 37.4 bits (85),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAFVI NNHHS+F+LK
Sbjct  107  PGAFVIRNNHHSQFFLK  123



>ref|XP_004139173.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   100 bits (248),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 71/99 (72%), Gaps = 3/99 (3%)
 Frame = +3

Query  141  AAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQG  320
            + EE+ KI+ G VVLMK N LD  D   S+LDT++E VG++VS +L+SA++ DP   L+G
Sbjct  3    SKEERRKIL-GEVVLMKSNVLDFDDFSTSLLDTLYEFVGKRVSLQLVSAIHGDPSNELRG  61

Query  321  KRGKVSYLENW-SKPTPLAAGESAYEVTFEWDES-IGVP  431
            K G+ +YLE W +  TPL  GE+ ++VTF+WDE  +G+P
Sbjct  62   KLGEEAYLEEWITTITPLTTGEATFKVTFDWDEQRMGIP  100


 Score = 34.7 bits (78),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF I N+HHS FYLK
Sbjct  100  PGAFFITNHHHSHFYLK  116



>ref|XP_010674744.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=841

 Score =   101 bits (252),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            +KGTVVL KKN     ++ AS+LD +HEL G+KVSF L+SAVNADP   L+GK GK SYL
Sbjct  1    MKGTVVLRKKN-----NLSASILDGIHELRGKKVSFRLVSAVNADPANNLKGKLGKPSYL  55

Query  345  -ENWSKPTPLAAGESAYEVTFEWDESIGVP  431
             E  +KP  LA  ESAY VTF+WDE I +P
Sbjct  56   EERLTKPIGLAVDESAYTVTFDWDEEIDIP  85


 Score = 33.1 bits (74),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA ++ N HHSEF+LK
Sbjct  85   PGALIVKNEHHSEFFLK  101



>gb|KGN60916.1| hypothetical protein Csa_2G023340 [Cucumis sativus]
Length=485

 Score = 99.8 bits (247),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 71/99 (72%), Gaps = 3/99 (3%)
 Frame = +3

Query  141  AAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQG  320
            + EE+ KI+ G VVLMK N LD  D   S+LDT++E VG++VS +L+SA++ DP   L+G
Sbjct  3    SKEERRKIL-GEVVLMKSNVLDFDDFSTSLLDTLYEFVGKRVSLQLVSAIHGDPSNELRG  61

Query  321  KRGKVSYLENW-SKPTPLAAGESAYEVTFEWDES-IGVP  431
            K G+ +YLE W +  TPL  GE+ ++VTF+WDE  +G+P
Sbjct  62   KLGEEAYLEEWITTITPLTTGEATFKVTFDWDEQRMGIP  100


 Score = 35.0 bits (79),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF I N+HHS FYLK
Sbjct  100  PGAFFITNHHHSHFYLK  116



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score =   105 bits (261),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 8/114 (7%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M LG IV AI GK D     +PK+ KG V+LMKKN LD  +IGASV+D + +L+GQKVS 
Sbjct  1    MSLGGIVDAILGKDD-----RPKV-KGRVILMKKNVLDFINIGASVVDGISDLLGQKVSI  54

Query  273  ELISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +LIS  + +   GL+GK    +YLE+W +  TP+ AGES + VTF+WD+  GVP
Sbjct  55   QLISG-SVNYADGLEGKLSNPAYLESWLTDITPITAGESTFSVTFDWDDEFGVP  107


 Score = 29.3 bits (64),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  107  PGAFIIKNFHLNEFFLK  123



>emb|CAE17327.1| lipoxygenase [Fragaria x ananassa]
Length=884

 Score =   100 bits (250),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 68/95 (72%), Gaps = 4/95 (4%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKG---LQGKRG  329
            K I+GTVVLMKKN LD  D+ AS+LD +HE +G+ VS +LISA + +P      L+GK G
Sbjct  34   KKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSLQLISATHPEPAANRLVLRGKPG  93

Query  330  KVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            K++YLE W +  T L AG++A+  + +WDES+GVP
Sbjct  94   KIAYLEKWITTATSLTAGDTAFSASIDWDESMGVP  128


 Score = 33.9 bits (76),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I N+HHS+FYLK
Sbjct  128  PGALMITNHHHSQFYLK  144



>gb|EYU26430.1| hypothetical protein MIMGU_mgv1a023655mg [Erythranthe guttata]
Length=963

 Score = 97.4 bits (241),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 93/149 (62%), Gaps = 18/149 (12%)
 Frame = +3

Query  39   H*HTRTYIY*VVFSRKLRMILGKI-------------VGAITGKHDAAAEE--KPKIIKG  173
            H HT+T+IY  ++      ++G +             +G    K++    E  K K +KG
Sbjct  63   HTHTQTHIYIHIYIENCWKLVGVLNKKKFIIPIKKISMGDKKSKYEEMEGESMKKKTMKG  122

Query  174  TVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELIS--AVNADPEKGLQGKRGKVSYLE  347
             VVLMKKN L++ DI AS++D+V E++G+KV+ +LI+  +++ D E+ L+GK GK++YLE
Sbjct  123  IVVLMKKNLLEVNDIAASIVDSVDEILGRKVALQLITTASLDHDSEENLKGKPGKIAYLE  182

Query  348  NW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +  +K  PL AG++ Y VTFEW + +G+P
Sbjct  183  DLITKIGPLTAGDATYTVTFEWTKEMGIP  211


 Score = 37.0 bits (84),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  412  TRASAFPGAFVINNNHHSEFYLK  480
            T+    PGAF + N HHSEFYLK
Sbjct  205  TKEMGIPGAFTVTNFHHSEFYLK  227



>ref|XP_010414944.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   100 bits (250),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G++V  +TG    + E   K +KGTVVLMKKN LD  D  AS LD +HE +G K++  
Sbjct  1    MIGELVDLLTG--GGSDETTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLR  58

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   D   G +GK GK ++LE+W ++ T L AGESA++VTF++D   G P
Sbjct  59   LISSDVTDSANGSKGKLGKAAHLEDWITRITSLTAGESAFKVTFDYDSDFGYP  111


 Score = 33.5 bits (75),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEF+LK
Sbjct  109  GYPGAFLIRNSHFSEFFLK  127



>ref|XP_004495725.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=858

 Score =   100 bits (249),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            +KGTVVLMKKN LD  D  AS  D + E  G+KVS  LISAVNADP  GL+GK GK + +
Sbjct  19   VKGTVVLMKKNVLDFNDSIASFRDDIREFWGKKVSLRLISAVNADPNNGLKGKLGKPANI  78

Query  345  ENWSKPTPLAAGESAYEVTFEWDESIGVPRGV  440
            E+WS      AGES  +V+F+WDE IG P  V
Sbjct  79   EHWST-IRATAGESTLQVSFDWDEEIGTPGAV  109


 Score = 33.9 bits (76),  Expect(2) = 5e-23, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNH+SEFYLK
Sbjct  106  PGAVLIRNNHYSEFYLK  122



>ref|XP_010488264.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=889

 Score = 99.4 bits (246),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 48/91 (53%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD+ AS+LD VHEL+G++VS  LIS++  DP    +G+ GK ++L
Sbjct  38   IEGEVVVMKKNLLDFKDVMASLLDRVHELLGRRVSLHLISSLQPDPANEKRGRLGKAAHL  97

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            E W     T + AGE+A+ VTF+WDES+G P
Sbjct  98   EKWVTKIKTSVTAGETAFGVTFDWDESMGPP  128


 Score = 34.7 bits (78),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  128  PAAFVIKNHHHSQFYLK  144



>ref|XP_004296897.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=884

 Score = 99.8 bits (247),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 68/95 (72%), Gaps = 4/95 (4%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKG---LQGKRG  329
            K I+GTVVLMKKN LD  D+ AS+LD +HE +G+ VS +LISA + +P      L+GK G
Sbjct  34   KKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSMQLISATHPEPAANRLVLRGKPG  93

Query  330  KVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            K++YLE W +  T L AG++A+  + +WDES+GVP
Sbjct  94   KIAYLEKWITTVTSLTAGDTAFSASIDWDESMGVP  128


 Score = 33.5 bits (75),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I N+HHS+FYLK
Sbjct  128  PGALMITNHHHSQFYLK  144



>ref|XP_008777614.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Phoenix dactylifera]
Length=885

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 72/105 (69%), Gaps = 2/105 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            ++GTVVLMKKN LD+ D GA++LD VHEL+GQ VS +L+SA   DP  G +G  GK +YL
Sbjct  43   VEGTVVLMKKNVLDITDFGATLLDDVHELLGQGVSLQLVSATVGDPNNGNRGIVGKPAYL  102

Query  345  ENWSKPTP-LAAGESAYEVTFEWDESIGVPRGV-CDQQQSPQRVL  473
            E++    P LAAGES + VTF+W+E+ G+P  V    Q S Q  L
Sbjct  103  ESYITSLPSLAAGESTFSVTFDWNENHGIPGAVIVKNQHSAQFFL  147



>sp|O22508.1|LOX18_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 8 [Solanum tuberosum]
 gb|AAB81595.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   103 bits (257),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G+I   + G HD +     K +KGTVV+M KN LD  D+ +S+   + +++GQKVSF+
Sbjct  1    MIGQITSGLFGGHDDS-----KKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLEN-WSKPTPLAAG-ESAYEVTFEWDESIGVP  431
            LIS+V  DP  GLQGK    +YLEN     TPL AG E+A+ VTF+W+E  GVP
Sbjct  56   LISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVP  109


 Score = 29.6 bits (65),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  109  PGAFIIKNMHITEFFLK  125



>sp|Q43189.1|LOX13_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 3 [Solanum tuberosum]
 gb|AAB67858.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   103 bits (257),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G+I   + G HD +     K +KGTVV+M KN LD  D+ +S+   + +++GQKVSF+
Sbjct  1    MIGQITSGLFGGHDDS-----KKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLEN-WSKPTPLAAG-ESAYEVTFEWDESIGVP  431
            LIS+V  DP  GLQGK    +YLEN     TPL AG E+A+ VTF+W+E  GVP
Sbjct  56   LISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVP  109


 Score = 29.6 bits (65),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  109  PGAFIIKNMHITEFFLK  125



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score =   101 bits (251),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 76/116 (66%), Gaps = 9/116 (8%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M LG+IV AI G  D       K +KG ++LMKK  LD  DI ASV D V + +G+KVS 
Sbjct  1    MSLGEIVDAIIGNTDG------KNVKGRIILMKKIFLDFTDINASVGDEVVDFLGEKVSI  54

Query  273  ELIS-AVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDE-SIGVP  431
            +LIS +++ DPE G++GKR   +YLE+W +  TP+ AGES + VTF+WD    GVP
Sbjct  55   QLISGSIHDDPENGVEGKRSNPAYLEDWLTHITPIIAGESTFSVTFDWDHKEFGVP  110


 Score = 32.0 bits (71),  Expect(2) = 9e-23, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+INN H +EF+LK
Sbjct  110  PGAFIINNFHLNEFFLK  126



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score = 97.8 bits (242),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 68/98 (69%), Gaps = 6/98 (6%)
 Frame = +3

Query  153  KPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGK  332
            K K IKG VVL+KKN LD  D+ ASVLD VHEL G+ VS +LIS+     E GL+GK GK
Sbjct  110  KGKKIKGRVVLIKKNFLDFNDLKASVLDRVHELFGEGVSLQLISS-----ENGLKGKLGK  164

Query  333  VSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
             +YLE+W +  T L  GESA+EVTF+ +E +GVP  + 
Sbjct  165  PAYLEDWITTITSLTPGESAFEVTFDHEEEVGVPGAIL  202


 Score = 35.4 bits (80),  Expect(2) = 9e-23, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNHHSEF+LK
Sbjct  198  PGAILIKNNHHSEFFLK  214



>sp|P37831.1|LOX11_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=StLOX1 [Solanum tuberosum]
 emb|CAA55724.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   103 bits (257),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G+I   + G HD +     K +KGTVV+M KN LD  D+  S+   + +++GQKVSF+
Sbjct  1    MIGQITSGLFGGHDDS-----KKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLEN-WSKPTPLAAG-ESAYEVTFEWDESIGVP  431
            LIS+V  DP  GLQGK    +YLEN     TPL AG E+A+ VTF+W+E  GVP
Sbjct  56   LISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVP  109


 Score = 29.3 bits (64),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  109  PGAFIIKNMHINEFFLK  125



>ref|XP_010480214.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Camelina sativa]
Length=860

 Score = 99.8 bits (247),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G++V  +TG    + E   K +KGTVVLMKKN LD  D  AS LD +HE +G K++  
Sbjct  1    MIGELVDLLTG--GGSDETTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLR  58

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   D   G +GK GK ++LE+W +  T L AGESA++VTF++D   G P
Sbjct  59   LISSDVTDSANGSKGKLGKTAHLEDWITTITSLTAGESAFKVTFDYDSDFGYP  111


 Score = 33.5 bits (75),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEF+LK
Sbjct  109  GYPGAFLIRNSHFSEFFLK  127



>ref|XP_010934565.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Elaeis guineensis]
Length=885

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  99   LGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFEL  278
            +G  VG+I G            +KGTVVLMKKN LD  D GA++LD VHEL+GQ VS +L
Sbjct  28   IGDTVGSIIGGAQGN-------VKGTVVLMKKNVLDFTDFGATLLDDVHELLGQGVSLQL  80

Query  279  ISAVNADPEKGLQGKRGKVSYLENWSKPTP-LAAGESAYEVTFEWDESIGVPRGV-CDQQ  452
            +SA   DP  G +G  G+ +YLE++    P +AAGES + VTF+W+E+ G+P  V    Q
Sbjct  81   VSATVGDPNNGNRGIVGEPAYLESYITSLPSIAAGESTFTVTFDWNENHGIPGAVIVKNQ  140

Query  453  QSPQRVL  473
             S Q  L
Sbjct  141  HSAQFFL  147



>ref|XP_010556753.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Tarenaya 
hassleriana]
Length=733

 Score =   102 bits (254),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  DAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGL  314
            + +A  K  +I+G VV+MKKN LD KD+ ASVLD VHEL+G++V+ +L+S+V  DP    
Sbjct  2    EGSAASKMTMIQGEVVVMKKNVLDFKDVMASVLDRVHELLGRRVTLQLVSSVQPDPGNER  61

Query  315  QGKRGKVSYLENWSK-PTPLAAGESAYEVTFEWDESIGVP  431
            +G+ GK ++L NW K  + + A E+A+ V FEWDES+G P
Sbjct  62   RGRLGKAAHLANWVKIKSAVTAEETAFAVAFEWDESMGTP  101


 Score = 30.4 bits (67),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+H S+F+LK
Sbjct  101  PSAFVIKNHHRSQFFLK  117



>ref|XP_002278007.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=876

 Score =   101 bits (252),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +3

Query  105  KIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELIS  284
            K+ G+ + K     +E  KI +G VVLMKKN +DL D  AS++D+V+ELVG+ VS +LIS
Sbjct  14   KVCGSNSKKSKDREDESQKI-EGRVVLMKKNVMDLNDSKASLIDSVYELVGKHVSLQLIS  72

Query  285  AVNADPEKGLQGKRGKVSYLENWSKPTP-LAAGESAYEVTFEWDESIGVP  431
            A +ADPE  L GK GK + L+ W+   P + A E+ + VTF+W+E +GVP
Sbjct  73   ATHADPENNLGGKIGKATCLQKWNCTGPAITARETEFAVTFDWEEGMGVP  122


 Score = 31.2 bits (69),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYL  477
            PGA  ++N+HHSEFYL
Sbjct  122  PGALRVSNHHHSEFYL  137



>gb|AAD09202.1| lipoxygenase [Solanum tuberosum]
Length=876

 Score = 97.8 bits (242),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 70/92 (76%), Gaps = 3/92 (3%)
 Frame = +3

Query  159  KIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVS  338
            K ++GTVVLM++  LDL ++GAS+LD  HE++G+ VS +LISA +A+P  G  GK GK +
Sbjct  31   KKVRGTVVLMEEECLDLTNVGASLLDRFHEVIGKGVSLQLISADHAEP--GCTGKLGKPA  88

Query  339  YLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            +LE W S  T ++AG++ + VTF+WDES+GVP
Sbjct  89   FLEKWISTLTSISAGDATFNVTFDWDESMGVP  120


 Score = 35.0 bits (79),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYL+
Sbjct  120  PGAFIIKNYHHSQFYLR  136



>ref|XP_008388563.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=912

 Score = 98.2 bits (243),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 68/98 (69%), Gaps = 6/98 (6%)
 Frame = +3

Query  153  KPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGK  332
            K K IKG VVL+KKN LD  D+ ASVLD VHEL G+ VS +LIS+     E GL+GK GK
Sbjct  110  KGKKIKGRVVLIKKNFLDFNDLKASVLDRVHELFGEGVSLQLISS-----ENGLKGKLGK  164

Query  333  VSYLENW-SKPTPLAAGESAYEVTFEWDESIGVPRGVC  443
             +YLE+W +  T L  GESA+EVTF+ +E +GVP  + 
Sbjct  165  PAYLEDWITTITSLTPGESAFEVTFDHEEEVGVPGAIL  202


 Score = 34.7 bits (78),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I NNHHSEF+LK
Sbjct  198  PGAILIKNNHHSEFFLK  214



>gb|KHN15782.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=858

 Score = 94.4 bits (233),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRG  329
            E+ K +KG VVLMKK  LD  DI A+VLD VHEL+G+ VS +LISA   DP KGL   RG
Sbjct  9    ERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDPAKGLL--RG  66

Query  330  KVSYLENW--SKPTPLAAGESAYEVTFEWDESIGVP  431
            KV+ LE W  +  +  +  ++ + VTFEWDES+GVP
Sbjct  67   KVANLERWVSTITSLTSTTDTEFSVTFEWDESMGVP  102


 Score = 38.5 bits (88),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHS+FYLK
Sbjct  102  PGAFIIRNNHHSQFYLK  118



>sp|O22507.1|LOX17_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 7 [Solanum tuberosum]
 gb|AAB81594.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   103 bits (256),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G+I   + G HD +     K +KGTVV+M KN LD  D+  S+   + +++GQKVSF+
Sbjct  1    MIGQITSGLFGGHDDS-----KKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLEN-WSKPTPLAAG-ESAYEVTFEWDESIGVP  431
            LIS+V  DP  GLQGK    +YLEN     TPL AG E+A+ VTF+W+E  GVP
Sbjct  56   LISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVP  109


 Score = 29.3 bits (64),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  109  PGAFIIKNMHINEFFLK  125



>ref|NP_001275169.1| probable linoleate 9S-lipoxygenase 8-like [Solanum tuberosum]
 emb|CAB65460.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   103 bits (256),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G+I   + G HD +     K +KGTVV+M KN LD  D+  S+   + +++GQKVSF+
Sbjct  1    MIGQITSGLFGGHDDS-----KKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLEN-WSKPTPLAAG-ESAYEVTFEWDESIGVP  431
            LIS+V  DP  GLQGK    +YLEN     TPL AG E+A+ VTF+W+E  GVP
Sbjct  56   LISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVP  109


 Score = 29.3 bits (64),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  109  PGAFIIKNMHINEFFLK  125



>ref|XP_006296682.1| hypothetical protein CARUB_v10012957mg [Capsella rubella]
 gb|EOA29580.1| hypothetical protein CARUB_v10012957mg [Capsella rubella]
Length=869

 Score = 99.0 bits (245),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 48/91 (53%), Positives = 66/91 (73%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD+ AS+LD VHEL+G++VS  LIS++  DP    +G+ GK ++L
Sbjct  21   IEGEVVVMKKNVLDFKDVMASLLDRVHELLGRRVSLHLISSLQPDPANEKRGRLGKAAHL  80

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            ENW     T + A E+A+ VTF+WDES+G P
Sbjct  81   ENWVTKIKTSVTAEETAFGVTFDWDESMGPP  111


 Score = 33.5 bits (75),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  111  PVAFVIKNHHHSQFYLK  127



>emb|CBI26229.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   101 bits (252),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +3

Query  105  KIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELIS  284
            K+ G+ + K     +E  KI +G VVLMKKN +DL D  AS++D+V+ELVG+ VS +LIS
Sbjct  14   KVCGSNSKKSKDREDESQKI-EGRVVLMKKNVMDLNDSKASLIDSVYELVGKHVSLQLIS  72

Query  285  AVNADPEKGLQGKRGKVSYLENWSKPTP-LAAGESAYEVTFEWDESIGVP  431
            A +ADPE  L GK GK + L+ W+   P + A E+ + VTF+W+E +GVP
Sbjct  73   ATHADPENNLGGKIGKATCLQKWNCTGPAITARETEFAVTFDWEEGMGVP  122


 Score = 30.8 bits (68),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYL  477
            PGA  ++N+HHSEFYL
Sbjct  122  PGALRVSNHHHSEFYL  137



>ref|XP_003556040.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006606050.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Glycine max]
Length=858

 Score = 94.4 bits (233),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  EKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRG  329
            E+ K +KG VVLMKK  LD  DI A+VLD VHEL+G+ VS +LISA   DP KGL   RG
Sbjct  9    ERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDPAKGLL--RG  66

Query  330  KVSYLENW--SKPTPLAAGESAYEVTFEWDESIGVP  431
            KV+ LE W  +  +  +  ++ + VTFEWDES+GVP
Sbjct  67   KVANLERWVSTITSLTSTTDTEFSVTFEWDESMGVP  102


 Score = 38.1 bits (87),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHS+FYLK
Sbjct  102  PGAFIIRNNHHSQFYLK  118



>ref|XP_007143236.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
 gb|ESW15230.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
Length=855

 Score = 99.4 bits (246),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = +3

Query  147  EEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKR  326
            EE+ K +KG VVLMKK  LD  DI A+VLD VHEL+G+ VS +LISA + DP KGL GK 
Sbjct  3    EERSKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSIQLISATSPDPAKGLLGKH  62

Query  327  GKVSYLENW--SKPTPLAAGESAYEVTFEWD-ESIGVP  431
            G+ SYLE W  +  +  +A ++ + VTF+WD E +GVP
Sbjct  63   GEESYLERWVSTISSLTSASDTEFWVTFDWDHEKMGVP  100


 Score = 33.1 bits (74),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N+H S+FYLK
Sbjct  100  PGAFIIRNHHKSQFYLK  116



>emb|CCD74473.1| lipoxygenase 1, partial [Arabidopsis halleri subsp. halleri]
Length=381

 Score =   101 bits (251),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (65%), Gaps = 6/113 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G++V  +TG  +       K +KGTVVLMKKN LD  D  AS LD +HE +G K++  
Sbjct  1    MIGELVDLLTGGGNET-----KKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLR  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   D E G +GK GK ++LE+W +  T L AGESA++VTF++D   G P
Sbjct  56   LISSDVTDSENGSKGKLGKAAHLEDWITTITSLTAGESAFKVTFDYDSDFGYP  108


 Score = 30.8 bits (68),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 16/18 (89%), Gaps = 0/18 (0%)
 Frame = +1

Query  427  FPGAFVINNNHHSEFYLK  480
            +PGAF+I N+H SEF+L+
Sbjct  107  YPGAFLIKNSHFSEFFLR  124



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   102 bits (255),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 12/116 (10%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M LG IV AI GK D     +PK+ KG V+LMKKN LD  +IGASV+D + +L+GQKVS 
Sbjct  1    MSLGGIVDAILGKDD-----RPKV-KGRVILMKKNVLDFINIGASVVDGISDLLGQKVSI  54

Query  273  ELIS-AVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWD-ESIGVP  431
            +LIS +VN D   GL+GK    +YLE+W +  TP+ AGES + VTF+WD +  GVP
Sbjct  55   QLISGSVNYD---GLEGKLSNPAYLESWLTDITPITAGESTFSVTFDWDRDEFGVP  107


 Score = 29.3 bits (64),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  107  PGAFIIKNLHLNEFFLK  123



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   102 bits (255),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 12/116 (10%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            M LG IV AI GK D     +PK+ KG V+LMKKN LD  +IGASV+D + +L+GQKVS 
Sbjct  1    MSLGGIVDAILGKDD-----RPKV-KGRVILMKKNVLDFINIGASVVDGISDLLGQKVSI  54

Query  273  ELIS-AVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWD-ESIGVP  431
            +LIS +VN D   GL+GK    +YLE+W +  TP+ AGES + VTF+WD +  GVP
Sbjct  55   QLISGSVNYD---GLEGKLSNPAYLESWLTDITPITAGESTFSVTFDWDRDEFGVP  107


 Score = 29.3 bits (64),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  107  PGAFIIKNLHLNEFFLK  123



>ref|XP_009774215.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=865

 Score = 97.1 bits (240),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 74/126 (59%), Gaps = 13/126 (10%)
 Frame = +3

Query  72   VFSRKLRMILGKIVGAITGKHDAAAEEKPK------IIKGTVVLMKKNALDLKDIGASVL  233
            V  + L M+ GK       +HD   E           IKGTVVL KKN L+ KD G++ L
Sbjct  11   VLEKMLEMVCGK-------QHDVPIESNSSNQTSSIKIKGTVVLRKKNVLNFKDAGSAFL  63

Query  234  DTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYLENWSKPTPLAAGESAYEVTFEWD  413
            D +HEL G++V  ELIS V+ADP  G +GK GK + L+  S  T ++  E+ + +TFE D
Sbjct  64   DRMHELFGKRVILELISDVHADPGNGSKGKVGKPAILDWTSSKTWISVEEATFNITFELD  123

Query  414  ESIGVP  431
            ESIGVP
Sbjct  124  ESIGVP  129


 Score = 35.0 bits (79),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N HHS+FYLK
Sbjct  129  PGAFIIKNYHHSQFYLK  145



>gb|KFK35599.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=856

 Score = 97.1 bits (240),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 7/113 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G +V   TG  +   +     +KGTVVLMKKN LD  D  AS LD +HE +G KV+  
Sbjct  1    MMGDLVDLFTGGGNVKTK-----VKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLR  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   DP+ G +GK GK  +LE+W +  T L AGESA++VTF++D   G P
Sbjct  56   LISSDLTDPD-GSKGKLGKAGHLEDWITTITSLTAGESAFKVTFDYDSDFGYP  107


 Score = 35.0 bits (79),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEFYLK
Sbjct  105  GYPGAFLIRNSHFSEFYLK  123



>ref|XP_010466519.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Camelina 
sativa]
Length=889

 Score = 97.1 bits (240),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 48/91 (53%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD+ AS+LD VHEL+G++VS  LIS++  DP    +GK GK ++L
Sbjct  37   IEGEVVVMKKNLLDFKDVMASLLDRVHELLGRRVSLHLISSLQPDPANEKRGKLGKAAHL  96

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            E W     T + A E+A+ VTF+WDES+G P
Sbjct  97   EKWVTKIKTSVTAEETAFGVTFDWDESMGPP  127


 Score = 34.7 bits (78),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  127  PAAFVIKNHHHSQFYLK  143



>ref|NP_001275357.1| linoleate 9S-lipoxygenase 2 [Solanum tuberosum]
 sp|O24379.1|LOX12_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 2; AltName: Full=Lipoxygenase 
1-2 [Solanum tuberosum]
 emb|CAA64766.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   101 bits (251),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 7/114 (6%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G+I   + G  D +     K +KGTVV+M KNALD  D+  S+ D   E +GQ VSF+
Sbjct  1    MIGQITSGLFGGPDDS-----KKLKGTVVMMNKNALDFTDLAGSLTDKAFEFLGQTVSFQ  55

Query  276  LISAVNADPEKGLQGKRGKVSYLEN-WSKPTPLAAG-ESAYEVTFEWDESIGVP  431
            LIS+V  DP  GLQGK    +YLEN     TPL AG E+A+ VTF+W+E  GVP
Sbjct  56   LISSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVP  109


 Score = 30.4 bits (67),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I N H +EF+LK
Sbjct  109  PGAFIIKNTHINEFFLK  125



>ref|XP_003592410.1| Lipoxygenase [Medicago truncatula]
 gb|AES62661.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=856

 Score = 94.4 bits (233),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 64/92 (70%), Gaps = 3/92 (3%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            +KG VVLMKK+ LD  DI ++VLD +HE +G+ VS +LISA   DP KGL+GK GKV+ L
Sbjct  9    VKGKVVLMKKSLLDFHDIKSNVLDRIHEFLGKGVSLQLISATAPDPAKGLKGKHGKVACL  68

Query  345  ENW--SKPTPLAAGESAYEVTFEWD-ESIGVP  431
            E W  S  +   A ++ + VTF+WD E +GVP
Sbjct  69   ERWMSSISSLTTATDTEFSVTFDWDHEKMGVP  100


 Score = 37.4 bits (85),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNHHS+FYLK
Sbjct  100  PGAFLIRNNHHSQFYLK  116



>ref|XP_010511294.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic isoform 
X2 [Camelina sativa]
Length=886

 Score = 96.7 bits (239),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD+ AS+LD +HEL+G++VS  LIS++  DP    +G+ GK ++L
Sbjct  37   IEGEVVVMKKNLLDFKDVMASLLDRIHELLGRRVSLHLISSLQPDPANEKRGRLGKAAHL  96

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            ENW     T + A E+ + VTF+WDES+G P
Sbjct  97   ENWVTKIKTSVTAEETTFGVTFDWDESMGPP  127


 Score = 34.7 bits (78),  Expect(2) = 3e-22, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  127  PAAFVIKNHHHSQFYLK  143



>ref|XP_008454500.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=858

 Score = 99.8 bits (247),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 47/94 (50%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +3

Query  153  KPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGK  332
            K + IKG V+L++ N+LD  +I +SVLD + E  G KVSF+LIS+ N D  K LQGK GK
Sbjct  14   KGQKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGK  73

Query  333  VSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             +YL NW +K  P++ GE+ ++++F+WDE IG+P
Sbjct  74   KTYLGNWMTKMVPVSPGETVFKISFDWDEDIGIP  107


 Score = 31.6 bits (70),  Expect(2) = 4e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNH ++F+LK
Sbjct  107  PGAFLIRNNHFTKFFLK  123



>ref|XP_010470260.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=851

 Score = 96.3 bits (238),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD+ AS+LD +HEL+G++VS  LIS++  DP    +G+ GK ++L
Sbjct  3    IEGEVVVMKKNLLDFKDVMASLLDRIHELLGRRVSLHLISSLQPDPANEKRGRLGKAAHL  62

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            ENW     T + A E+ + VTF+WDES+G P
Sbjct  63   ENWVTKIKTSVTAEETTFGVTFDWDESMGPP  93


 Score = 34.7 bits (78),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  93   PAAFVIKNHHHSQFYLK  109



>ref|XP_010530359.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Tarenaya 
hassleriana]
Length=883

 Score =   100 bits (250),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 71/107 (66%), Gaps = 2/107 (2%)
 Frame = +3

Query  117  AITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNA  296
             + G+   +A  K   I G VV+MKKN LD KD+ ASVLD VHEL+G++VS +L+S+V  
Sbjct  20   TMEGEIQRSAAGKVTTIHGEVVVMKKNVLDFKDVMASVLDRVHELLGRRVSIQLVSSVQP  79

Query  297  DPEKGLQGKRGKVSYLENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            DP  G +G+ GK ++LE W     + + A E+A+ + FEWDES+G P
Sbjct  80   DPGNGRRGRLGKAAHLEKWVTKIKSAVTAEETAFAIAFEWDESMGTP  126


 Score = 30.0 bits (66),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+H S+F+LK
Sbjct  126  PSAFVIKNHHRSQFFLK  142



>ref|XP_007030815.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11317.1| Lipoxygenase 1 [Theobroma cacao]
Length=863

 Score = 99.4 bits (246),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 71/117 (61%), Gaps = 2/117 (2%)
 Frame = +3

Query  93   MILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSF  272
            MILG ++ A  G        K K IKGTV+LMK NA    ++ +   D V E+VGQKV+ 
Sbjct  1    MILGSVLNA-AGNAVKEITRKKKTIKGTVILMKNNAFGFNNLVSGTADRVLEIVGQKVTL  59

Query  273  ELISAVNADPEKGLQGKRGKVSYLENWS-KPTPLAAGESAYEVTFEWDESIGVPRGV  440
            +L+SA +ADP  G  GK GK + LENW+ K T   AG+S Y+V FEWDE  G P  +
Sbjct  60   QLVSAEHADPVNGNGGKLGKQAALENWNLKITSPMAGDSRYKVYFEWDEEFGTPGAI  116


 Score = 31.2 bits (69),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA ++ NNH +EFYLK
Sbjct  113  PGAIIVRNNHSAEFYLK  129



>ref|XP_009625816.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=832

 Score = 99.0 bits (245),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 62/83 (75%), Gaps = 1/83 (1%)
 Frame = +3

Query  186  MKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYLENW-SKP  362
            MKKN LDL D+ ASV+D V E++G KVS +LISAVNADP    +GK GK ++LENW +K 
Sbjct  1    MKKNFLDLDDVKASVVDRVDEILGHKVSLQLISAVNADPANKCRGKPGKPAFLENWEAKF  60

Query  363  TPLAAGESAYEVTFEWDESIGVP  431
            TPL A ++ + VTFEW+E  GVP
Sbjct  61   TPLTATDATFGVTFEWEEEAGVP  83


 Score = 31.6 bits (70),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  421  SAFPGAFVINNNHHSEFYLK  480
            +  PGAF+I N H  EFYLK
Sbjct  80   AGVPGAFLIKNFHQKEFYLK  99



>ref|XP_010511287.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic isoform 
X1 [Camelina sativa]
Length=886

 Score = 96.3 bits (238),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 47/91 (52%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD+ AS+LD VHEL+G++VS  LIS++  DP    +G+ GK ++L
Sbjct  37   IEGEVVVMKKNLLDFKDVMASLLDRVHELLGRRVSLHLISSLQPDPANEKRGRLGKAAHL  96

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            E W     T + A E+A+ VTF+WDES+G P
Sbjct  97   EKWVTKIKTSVTAEETAFGVTFDWDESMGPP  127


 Score = 34.3 bits (77),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  127  PAAFVIKNHHHSQFYLK  143



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score = 93.6 bits (231),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +3

Query  129  KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELIS---AVNAD  299
            +H+ +   +   ++G VVLMKK  L + DI ASV+D V E+ G+KV+ +LIS   A++ D
Sbjct  11   RHEESGNGERSKMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHD  70

Query  300  PEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
              +  +GK GK +YLE+W +K +PL AG++AY+VTFEW   +GVP
Sbjct  71   SAESYRGKVGKKAYLEDWITKISPLTAGDTAYDVTFEWTREMGVP  115


 Score = 37.4 bits (85),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  412  TRASAFPGAFVINNNHHSEFYLK  480
            TR    PGAF I N HH+EFYLK
Sbjct  109  TREMGVPGAFTITNFHHNEFYLK  131



>ref|XP_002891934.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68193.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
Length=857

 Score = 99.4 bits (246),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G++V  +TG  +       K +KGTVVLMKKN LD  D  AS LD +HE +G K++  
Sbjct  1    MIGELVDLLTGGGNET-----KKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLR  55

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   D E G +GK GK ++LE+W +  T L AGESA++VTF+++ + G P
Sbjct  56   LISSDVTDSENGSKGKLGKAAHLEDWITTITSLTAGESAFKVTFDYESNFGYP  108


 Score = 30.8 bits (68),  Expect(2) = 8e-22, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEF L+
Sbjct  106  GYPGAFLIKNSHFSEFLLR  124



>ref|XP_006300394.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
 gb|EOA33292.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
Length=859

 Score = 96.7 bits (239),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            ++G++V   TG      E   K +KGTVVL+KKN LD  D  AS LD +HE +  K++  
Sbjct  1    MIGELVDLFTG---GGNETTAKKVKGTVVLIKKNVLDFNDFNASFLDRLHEFLNNKITLR  57

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            LIS+   D   G +GK GK ++LE+W +  T L AGESA++VTF++D   G P
Sbjct  58   LISSDVTDSANGSKGKLGKAAHLEDWITTITSLTAGESAFKVTFDYDSDFGYP  110


 Score = 33.1 bits (74),  Expect(2) = 9e-22, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  424  AFPGAFVINNNHHSEFYLK  480
             +PGAF+I N+H SEF+LK
Sbjct  108  GYPGAFLIRNSHFSEFFLK  126



>ref|XP_010488263.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=890

 Score = 95.1 bits (235),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 66/92 (72%), Gaps = 3/92 (3%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKG-LQGKRGKVSY  341
            I+G VV+MKKN LD KD+ AS+LD VHEL+G++VS  LIS++  DP     +G+ GK ++
Sbjct  38   IEGEVVVMKKNLLDFKDVMASLLDRVHELLGRRVSLHLISSLQPDPAANEKRGRLGKAAH  97

Query  342  LENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            LE W     T + AGE+A+ VTF+WDES+G P
Sbjct  98   LEKWVTKIKTSVTAGETAFGVTFDWDESMGPP  129


 Score = 34.7 bits (78),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  129  PAAFVIKNHHHSQFYLK  145



>ref|XP_006406169.1| hypothetical protein EUTSA_v10020023mg [Eutrema salsugineum]
 gb|ESQ47622.1| hypothetical protein EUTSA_v10020023mg [Eutrema salsugineum]
Length=888

 Score = 95.1 bits (235),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 64/91 (70%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G +V+MKKN LD KD  AS+LD +HEL+G++VS  LIS++  DP    +G+ GK +YL
Sbjct  39   IEGELVVMKKNLLDFKDAMASLLDRIHELLGRRVSLHLISSLQPDPANEKRGRLGKAAYL  98

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            E W     T + A E+A+ VTF+WDES+G P
Sbjct  99   EKWVTKIKTSVTAEETAFGVTFDWDESMGPP  129


 Score = 34.7 bits (78),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  129  PAAFVIKNHHHSQFYLK  145



>ref|XP_009376662.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376685.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=929

 Score = 94.0 bits (232),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 67/102 (66%), Gaps = 6/102 (6%)
 Frame = +3

Query  129  KHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEK  308
            K +  A  + K IKG VVLMKKN L   D+ ASVLD VHEL  ++VS  LIS+     E 
Sbjct  79   KTETEAGREGKKIKGRVVLMKKNFLGFNDLKASVLDRVHELFRKRVSLRLISS-----ET  133

Query  309  GLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             LQG+ GK +YLENW +  TPL A E  ++V+F+WD+ IGVP
Sbjct  134  ELQGEVGKAAYLENWVNTITPLIAEEITFDVSFDWDKKIGVP  175


 Score = 35.4 bits (80),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I N HHSEFYLK
Sbjct  175  PGALIIRNEHHSEFYLK  191



>gb|KFK39531.1| hypothetical protein AALP_AA3G256400 [Arabis alpina]
Length=882

 Score = 95.9 bits (237),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD  AS+LD VHEL+G++VS +LIS++  DP    +G+ GK ++L
Sbjct  33   IEGEVVVMKKNVLDFKDAMASLLDRVHELLGRRVSLQLISSLQPDPANEKRGRLGKAAHL  92

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            E W     T + A E+A+ VTF+WDES+G P
Sbjct  93   EKWVTKIKTSVTAEETAFAVTFDWDESMGPP  123


 Score = 33.5 bits (75),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N HHS+FYLK
Sbjct  123  PAAFVIKNYHHSQFYLK  139



>ref|XP_009344082.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=894

 Score = 96.3 bits (238),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADP-EKGL--QGKRGKV  335
            I+G VVLMKKN LD  D+ AS +D +HEL+G+ VS +LISA + +P   GL  +GK GKV
Sbjct  43   IRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEPAANGLKSRGKLGKV  102

Query  336  SYLENWSKP-TPLAAGESAYEVTFEWDESIGVP  431
            +YLE W+   T L+AGE+++ ++ +WDES GVP
Sbjct  103  AYLEKWATTITSLSAGETSFTISLDWDESHGVP  135


 Score = 33.1 bits (74),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGA +I N+HHS+FYLK
Sbjct  135  PGALLIRNHHHSQFYLK  151



>gb|AAG00881.1|AC064840_12 lipoxygenase - partial coding sequence [Arabidopsis thaliana]
Length=391

 Score = 98.6 bits (244),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (63%), Gaps = 4/113 (4%)
 Frame = +3

Query  96   ILGKIVGAITGKHDAAAEEKPKIIKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFE  275
            + G++   +TG      E   K +KGTVVLMKKN LD  D  AS LD +HE +G K++  
Sbjct  1    MFGELRDLLTG---GGNETTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLR  57

Query  276  LISAVNADPEKGLQGKRGKVSYLENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
            L+S+   D E G +GK GK ++LE+W +  T L AGESA++VTF+++   G P
Sbjct  58   LVSSDVTDSENGSKGKLGKAAHLEDWITTITSLTAGESAFKVTFDYETDFGYP  110


 Score = 30.8 bits (68),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  427  FPGAFVINNNHHSEFYLK  480
            +PGAF+I N+H SEF LK
Sbjct  109  YPGAFLIRNSHFSEFLLK  126



>emb|CDY38326.1| BnaC05g30190D [Brassica napus]
Length=887

 Score = 94.4 bits (233),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 64/91 (70%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD  AS LD VHEL+G++VS +L+S++  DP    +G+ GK ++L
Sbjct  38   IQGEVVVMKKNLLDFKDAMASFLDRVHELLGRRVSLQLVSSLQPDPANEKRGRLGKAAHL  97

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            E W     T + A E+A+ VTF+WDES+G P
Sbjct  98   EKWVTKIKTSVTAEETAFAVTFDWDESMGPP  128


 Score = 34.7 bits (78),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  128  PAAFVIKNHHHSQFYLK  144



>ref|XP_010431179.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Camelina 
sativa]
Length=721

 Score = 95.9 bits (237),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD+ AS+LD +HEL+G+++S  LIS++  DP    +G+ GK ++L
Sbjct  3    IEGEVVVMKKNLLDFKDVMASLLDRIHELLGRRISLHLISSLQPDPANEKRGRLGKAAHL  62

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            ENW     T + A E+ + VTF+WDES+G P
Sbjct  63   ENWVTKIKTSVTAEETTFGVTFDWDESMGPP  93


 Score = 32.7 bits (73),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  93   PAAFVIKNHHHSQFYLK  109



>ref|XP_002883361.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59620.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata]
Length=838

 Score = 94.4 bits (233),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 47/91 (52%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            I+G VV+MKKN LD KD+ AS+LD VHEL G++VS  LIS+   DP    +G+ GK ++L
Sbjct  12   IEGEVVVMKKNLLDFKDVMASLLDRVHELFGRRVSLHLISSHQPDPANEKRGRLGKAAHL  71

Query  345  ENWSK--PTPLAAGESAYEVTFEWDESIGVP  431
            E W     T + A E+A+ VTF+WDES+G P
Sbjct  72   EKWVTKLKTSVTAEETAFRVTFDWDESMGPP  102


 Score = 34.3 bits (77),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            P AFVI N+HHS+FYLK
Sbjct  102  PAAFVIKNHHHSQFYLK  118



>ref|XP_004169780.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=860

 Score = 96.3 bits (238),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 45/90 (50%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +3

Query  165  IKGTVVLMKKNALDLKDIGASVLDTVHELVGQKVSFELISAVNADPEKGLQGKRGKVSYL  344
            IKG V+L++ N+LD  +I +SVLD + E  G KVSF+LIS+ N D  K LQGK GK +YL
Sbjct  20   IKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKXTYL  79

Query  345  ENW-SKPTPLAAGESAYEVTFEWDESIGVP  431
             NW +K  P++ GE+ ++++F W+E IG+P
Sbjct  80   GNWMTKMVPVSPGETMFKISFVWEEDIGIP  109


 Score = 32.0 bits (71),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  430  PGAFVINNNHHSEFYLK  480
            PGAF+I NNH ++F+LK
Sbjct  109  PGAFIIRNNHFTKFFLK  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140