BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005N21

Length=421
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007155887.1|  hypothetical protein PHAVU_003G240200g             199   3e-60   Phaseolus vulgaris [French bean]
gb|ACJ85153.1|  unknown                                                 194   1e-59   Medicago truncatula
gb|AHB59606.1|  putative MYB-related protein 20                         198   3e-59   Arachis hypogaea [goober]
gb|AFK47194.1|  unknown                                                 197   3e-59   Medicago truncatula
ref|XP_006339846.1|  PREDICTED: transcription factor MYB44-like         199   3e-59   
ref|XP_003524661.1|  PREDICTED: transcription factor MYB44              196   4e-59   Glycine max [soybeans]
ref|XP_009588514.1|  PREDICTED: transcription factor MYB44              198   4e-59   Nicotiana tomentosiformis
gb|KJB43824.1|  hypothetical protein B456_007G218100                    197   4e-59   Gossypium raimondii
gb|AEO27498.1|  MYB2                                                    197   4e-59   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004511885.1|  PREDICTED: transcription factor MYB44-like         197   4e-59   Cicer arietinum [garbanzo]
ref|XP_007205522.1|  hypothetical protein PRUPE_ppa008450mg             197   6e-59   
ref|XP_009798591.1|  PREDICTED: transcription factor MYB44              197   6e-59   Nicotiana sylvestris
ref|NP_001235731.1|  MYB transcription factor MYB178                    191   8e-59   Glycine max [soybeans]
ref|XP_010315996.1|  PREDICTED: transcription factor MYB44-like         197   9e-59   Solanum lycopersicum
ref|XP_008360495.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    192   1e-58   
gb|AHN19845.1|  MYB6                                                    195   2e-58   Malus hybrid cultivar
gb|AIK01747.1|  MYB                                                     195   2e-58   Chrysanthemum indicum var. aromaticum
ref|XP_010244270.1|  PREDICTED: transcription factor MYB44              195   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_009372447.1|  PREDICTED: transcription factor MYB44-like         194   3e-58   Pyrus x bretschneideri [bai li]
gb|AFH03065.1|  R2R3-MYB transcription factor MYB13                     195   3e-58   Epimedium sagittatum
ref|XP_007047395.1|  Myb domain protein 73, putative                    194   4e-58   
ref|XP_011099313.1|  PREDICTED: transcription factor MYB44-like         196   4e-58   Sesamum indicum [beniseed]
ref|XP_008391509.1|  PREDICTED: transcription factor MYB44-like         194   4e-58   
gb|AAZ20429.1|  MYB6                                                    194   5e-58   Malus domestica [apple tree]
emb|CBI19466.3|  unnamed protein product                                192   6e-58   Vitis vinifera
ref|XP_008338349.1|  PREDICTED: transcription factor MYB44-like         193   7e-58   
ref|XP_009367649.1|  PREDICTED: transcription factor MYB44              194   7e-58   Pyrus x bretschneideri [bai li]
emb|CDP02540.1|  unnamed protein product                                194   1e-57   Coffea canephora [robusta coffee]
ref|XP_008351390.1|  PREDICTED: transcription factor MYB44-like         191   1e-57   
ref|XP_010271172.1|  PREDICTED: transcription factor MYB44-like         193   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_004238123.1|  PREDICTED: transcription factor MYB44-like         193   1e-57   Solanum lycopersicum
gb|AGN52088.1|  MYB-related transcription factor                        192   1e-57   Salvia miltiorrhiza [Chinese salvia]
gb|AHN19846.1|  MYB6                                                    192   1e-57   Malus hybrid cultivar
ref|XP_002285015.1|  PREDICTED: transcription factor MYB44-like         192   2e-57   Vitis vinifera
gb|KDP31997.1|  hypothetical protein JCGZ_12458                         192   2e-57   Jatropha curcas
gb|AAG08959.1|AF122051_1  tuber-specific and sucrose-responsive e...    193   3e-57   Solanum tuberosum [potatoes]
ref|XP_006367421.1|  PREDICTED: transcription factor MYB44-like         192   3e-57   Solanum tuberosum [potatoes]
ref|XP_006425988.1|  hypothetical protein CICLE_v10026107mg             192   4e-57   Citrus clementina [clementine]
gb|KJB40285.1|  hypothetical protein B456_007G055600                    192   4e-57   Gossypium raimondii
ref|XP_009109365.1|  PREDICTED: transcription factor MYB44-like         191   4e-57   Brassica rapa
gb|ABQ10819.1|  putative R2R3-Myb transcription factor                  192   4e-57   Citrus sinensis [apfelsine]
emb|CDY22442.1|  BnaC03g61550D                                          190   4e-57   Brassica napus [oilseed rape]
ref|NP_001275856.1|  putative R2R3-Myb transcription factor             191   4e-57   Citrus sinensis [apfelsine]
gb|ABQ10818.1|  putative R2R3-Myb transcription factor                  191   4e-57   Citrus sinensis [apfelsine]
ref|XP_009795719.1|  PREDICTED: transcription factor MYB44-like         192   4e-57   Nicotiana sylvestris
ref|XP_011006987.1|  PREDICTED: transcription factor MYB44-like         192   4e-57   Populus euphratica
emb|CDY44045.1|  BnaA08g15610D                                          191   5e-57   Brassica napus [oilseed rape]
gb|KDO79069.1|  hypothetical protein CISIN_1g021071mg                   190   5e-57   Citrus sinensis [apfelsine]
ref|NP_001235688.1|  MYB transcription factor MYB61                     191   6e-57   Glycine max [soybeans]
ref|XP_002310702.1|  hypothetical protein POPTR_0007s10490g             191   6e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011010210.1|  PREDICTED: transcription factor MYB44-like         191   9e-57   Populus euphratica
ref|XP_003611666.1|  R2R3-MYB transcription factor                      191   9e-57   
ref|XP_010679545.1|  PREDICTED: transcription factor MYB44              191   9e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010531261.1|  PREDICTED: transcription factor MYB44              191   1e-56   Tarenaya hassleriana [spider flower]
emb|CAN75196.1|  hypothetical protein VITISV_014739                     190   1e-56   Vitis vinifera
ref|XP_008440323.1|  PREDICTED: transcription factor MYB44              190   2e-56   Cucumis melo [Oriental melon]
ref|XP_004141899.1|  PREDICTED: transcription factor MYB44-like         189   2e-56   Cucumis sativus [cucumbers]
gb|AGN52031.1|  MYB-related transcription factor                        190   2e-56   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010943207.1|  PREDICTED: transcription factor MYB44-like         191   3e-56   Elaeis guineensis
ref|XP_002306488.2|  hypothetical protein POPTR_0005s18620g             191   3e-56   
ref|XP_006411909.1|  hypothetical protein EUTSA_v10025742mg             189   3e-56   Eutrema salsugineum [saltwater cress]
ref|XP_002524926.1|  r2r3-myb transcription factor, putative            190   3e-56   Ricinus communis
dbj|BAJ40867.1|  transcriptional factor MYB-1                           189   3e-56   Coptis japonica
ref|NP_001268121.1|  sucrose responsive element binding protein         189   3e-56   Vitis vinifera
ref|XP_010070607.1|  PREDICTED: transcription factor MYB44-like         190   3e-56   Eucalyptus grandis [rose gum]
ref|XP_002880492.1|  hypothetical protein ARALYDRAFT_481200             189   3e-56   
ref|XP_007156759.1|  hypothetical protein PHAVU_002G015100g             189   4e-56   Phaseolus vulgaris [French bean]
ref|XP_010548433.1|  PREDICTED: transcription factor MYB44 isofor...    189   4e-56   
ref|XP_010548432.1|  PREDICTED: transcription factor MYB44 isofor...    189   4e-56   Tarenaya hassleriana [spider flower]
emb|CDX69287.1|  BnaC01g01660D                                          188   5e-56   
emb|CDX75635.1|  BnaA01g00670D                                          188   7e-56   
ref|XP_004287994.1|  PREDICTED: transcription factor MYB44-like         188   8e-56   Fragaria vesca subsp. vesca
ref|XP_011074411.1|  PREDICTED: transcription factor MYB44-like         188   8e-56   Sesamum indicum [beniseed]
ref|XP_010095320.1|  Transcription factor                               187   9e-56   
ref|XP_009137661.1|  PREDICTED: transcription factor MYB44              188   1e-55   Brassica rapa
gb|AAM65553.1|  putative MYB family transcription factor                187   1e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KDP41681.1|  hypothetical protein JCGZ_16088                         187   1e-55   Jatropha curcas
gb|AHB59592.1|  putative R2R3 MYB protein 4                             187   2e-55   Arachis hypogaea [goober]
gb|KJB63910.1|  hypothetical protein B456_010G023500                    186   2e-55   Gossypium raimondii
gb|AFK46950.1|  unknown                                                 187   2e-55   Medicago truncatula
gb|ADL36764.1|  MYB domain class transcription factor                   187   2e-55   Malus domestica [apple tree]
ref|XP_010417080.1|  PREDICTED: transcription factor MYB44-like         187   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006404809.1|  hypothetical protein EUTSA_v10000438mg             187   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010429274.1|  PREDICTED: transcription factor MYB44-like         187   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_011097391.1|  PREDICTED: transcription factor MYB44              189   2e-55   
ref|NP_179910.1|  myb domain protein 70                                 187   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472329.1|  PREDICTED: transcription factor MYB44-like         187   2e-55   Camelina sativa [gold-of-pleasure]
gb|KDO84060.1|  hypothetical protein CISIN_1g022144mg                   186   3e-55   Citrus sinensis [apfelsine]
ref|NP_001275798.1|  putative R2R3-MYB transcription factor             186   3e-55   Citrus sinensis [apfelsine]
ref|XP_006434697.1|  hypothetical protein CICLE_v10001979mg             186   3e-55   Citrus clementina [clementine]
ref|NP_001238087.1|  MYB transcription factor MYB50                     186   3e-55   Glycine max [soybeans]
gb|EYU25477.1|  hypothetical protein MIMGU_mgv1a010338mg                186   4e-55   Erythranthe guttata [common monkey flower]
dbj|BAC53938.1|  Myb-like protein                                       187   4e-55   Nicotiana tabacum [American tobacco]
ref|XP_009586849.1|  PREDICTED: transcription factor MYB44-like         187   5e-55   Nicotiana tomentosiformis
ref|XP_010446682.1|  PREDICTED: transcription factor MYB44-like         186   5e-55   Camelina sativa [gold-of-pleasure]
ref|NP_195443.1|  myb domain protein 73                                 186   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437245.1|  PREDICTED: transcription factor MYB44-like         186   5e-55   Camelina sativa [gold-of-pleasure]
ref|NP_001235142.1|  MYB transcription factor MYB112                    186   7e-55   
ref|XP_010432074.1|  PREDICTED: transcription factor MYB44-like         186   8e-55   Camelina sativa [gold-of-pleasure]
gb|AFS65096.1|  sucrose responsive element-binding protein              187   1e-54   Elaeis guineensis
ref|XP_009398678.1|  PREDICTED: transcription factor MYB44-like         187   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928389.1|  PREDICTED: transcription factor MYB44-like         187   1e-54   Elaeis guineensis
ref|XP_006294656.1|  hypothetical protein CARUB_v10023692mg             185   2e-54   
ref|XP_008799576.1|  PREDICTED: transcription factor MYB44-like         186   2e-54   Phoenix dactylifera
gb|ABN11121.1|  MYB transcription factor                                185   3e-54   Capsicum annuum
ref|XP_006286095.1|  hypothetical protein CARUB_v10007638mg             184   4e-54   Capsella rubella
ref|XP_002510155.1|  r2r3-myb transcription factor, putative            183   4e-54   Ricinus communis
emb|CDP01282.1|  unnamed protein product                                184   6e-54   Coffea canephora [robusta coffee]
ref|XP_010059753.1|  PREDICTED: transcription factor MYB44-like         184   9e-54   Eucalyptus grandis [rose gum]
gb|KFK30351.1|  hypothetical protein AALP_AA7G250300                    183   9e-54   Arabis alpina [alpine rockcress]
emb|CDX72621.1|  BnaC07g46430D                                          181   1e-53   
gb|AGN52056.1|  MYB-related transcription factor                        181   1e-53   Salvia miltiorrhiza [Chinese salvia]
emb|CAN81361.1|  hypothetical protein VITISV_028904                     182   1e-53   Vitis vinifera
ref|XP_007042527.1|  Myb domain protein 73, putative                    180   2e-53   
ref|XP_008811216.1|  PREDICTED: transcription factor MYB44-like         183   2e-53   Phoenix dactylifera
ref|XP_011017151.1|  PREDICTED: transcription factor MYB44-like         181   2e-53   Populus euphratica
emb|CDX89554.1|  BnaC04g35730D                                          181   3e-53   
ref|XP_002302428.2|  hypothetical protein POPTR_0002s12410g             182   3e-53   
ref|XP_006374871.1|  hypothetical protein POPTR_0014s02260g             181   3e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006844027.1|  hypothetical protein AMTR_s00006p00225600          181   4e-53   
ref|XP_004291065.1|  PREDICTED: transcription factor MYB44-like         181   4e-53   Fragaria vesca subsp. vesca
dbj|BAD34048.1|  myb-related transcription factor-like                  181   6e-53   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08096.1|  hypothetical protein OsI_30362                          181   6e-53   Oryza sativa Indica Group [Indian rice]
emb|CCU64171.1|  ScMYB19 protein                                        178   6e-53   Saccharum hybrid cultivar Co 86032
ref|NP_001062562.1|  Os09g0106700                                       181   6e-53   
ref|XP_009392116.1|  PREDICTED: transcription factor MYB44-like         182   7e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660414.1|  PREDICTED: transcription factor MYB44-like         181   7e-53   Oryza brachyantha
ref|XP_011029247.1|  PREDICTED: transcription factor MYB44-like         180   8e-53   Populus euphratica
ref|NP_001287808.1|  transcription factor MYB44-like                    181   9e-53   Malus domestica [apple tree]
gb|EYU34554.1|  hypothetical protein MIMGU_mgv1a011398mg                179   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_009354151.1|  PREDICTED: transcription factor MYB44-like         180   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_010556427.1|  PREDICTED: transcription factor MYB44-like         180   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_010101670.1|  Transcription factor                               179   2e-52   Morus notabilis
ref|XP_009138487.1|  PREDICTED: transcription factor MYB44-like         178   2e-52   Brassica rapa
ref|XP_007160886.1|  hypothetical protein PHAVU_001G025200g             178   2e-52   Phaseolus vulgaris [French bean]
ref|XP_008220277.1|  PREDICTED: transcription factor MYB44-like         179   2e-52   Prunus mume [ume]
emb|CDY38933.1|  BnaA04g13540D                                          179   2e-52   Brassica napus [oilseed rape]
ref|XP_007227715.1|  hypothetical protein PRUPE_ppa008979mg             179   3e-52   Prunus persica
ref|XP_008351984.1|  PREDICTED: transcription factor MYB44-like         179   4e-52   
ref|XP_009360105.1|  PREDICTED: transcription factor MYB44-like         178   5e-52   Pyrus x bretschneideri [bai li]
gb|AAG08960.1|AF122052_1  tuber-specific and sucrose-responsive e...    178   5e-52   Solanum tuberosum [potatoes]
ref|XP_002462029.1|  hypothetical protein SORBIDRAFT_02g013010          180   5e-52   Sorghum bicolor [broomcorn]
ref|XP_009140453.1|  PREDICTED: transcription factor MYB44              177   6e-52   Brassica rapa
gb|ADL36765.1|  MYB domain class transcription factor                   178   6e-52   Malus domestica [apple tree]
gb|KJB59854.1|  hypothetical protein B456_009G276400                    177   7e-52   Gossypium raimondii
ref|XP_008367655.1|  PREDICTED: transcription factor MYB44-like         178   7e-52   
dbj|BAJ86460.1|  predicted protein                                      178   7e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009418325.1|  PREDICTED: transcription factor MYB44-like         179   1e-51   
ref|NP_001151336.1|  sucrose responsive element binding protein         177   2e-51   Zea mays [maize]
gb|AHB59591.1|  putative R2R3 MYB protein 3                             175   2e-51   Arachis hypogaea [goober]
gb|ADX60118.1|  MYB-RELATED transcription factor                        177   2e-51   Zea mays [maize]
gb|AFV73403.1|  R2R3-MYB transcription factor                           176   3e-51   Jatropha curcas
ref|XP_008462845.1|  PREDICTED: transcription factor MYB44-like         176   3e-51   Cucumis melo [Oriental melon]
ref|XP_007136715.1|  hypothetical protein PHAVU_009G068000g             174   4e-51   Phaseolus vulgaris [French bean]
gb|ADN33728.1|  MYB transcription factor                                173   5e-51   Cucumis melo subsp. melo
gb|ABV02031.1|  sucrose responsive element binding factor 1             175   6e-51   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009415461.1|  PREDICTED: transcription factor MYB44-like         177   7e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR28330.1|  MYB transcription factor MYB8                           174   8e-51   Medicago truncatula
gb|KEH31491.1|  myb transcription factor                                174   8e-51   Medicago truncatula
gb|AGL76985.1|  MYB transcription factor                                174   1e-50   Cucumis melo [Oriental melon]
ref|XP_008444592.1|  PREDICTED: transcription factor MYB44-like         174   1e-50   
ref|XP_009418521.1|  PREDICTED: transcription factor MYB44-like         175   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385523.1|  PREDICTED: transcription factor MYB44-like         175   4e-50   
ref|XP_004142878.1|  PREDICTED: transcription factor MYB44-like         173   4e-50   Cucumis sativus [cucumbers]
gb|KJB58575.1|  hypothetical protein B456_009G215900                    173   4e-50   Gossypium raimondii
ref|XP_009587267.1|  PREDICTED: transcription factor MYB44-like         172   4e-50   
ref|NP_001183628.1|  putative MYB DNA-binding domain superfamily ...    172   5e-50   Zea mays [maize]
ref|XP_010558924.1|  PREDICTED: transcription factor MYB44-like i...    173   7e-50   Tarenaya hassleriana [spider flower]
ref|XP_008236375.1|  PREDICTED: transcription factor MYB44-like         172   9e-50   Prunus mume [ume]
ref|XP_007199299.1|  hypothetical protein PRUPE_ppa023154mg             172   1e-49   
ref|XP_009395856.1|  PREDICTED: transcription factor MYB44-like         174   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHN50422.1|  R2R3-type MYB transcription factor                      171   1e-49   Salicornia brachiata
ref|XP_004305954.1|  PREDICTED: transcription factor MYB44-like         171   1e-49   Fragaria vesca subsp. vesca
ref|XP_010057256.1|  PREDICTED: transcription factor MYB44-like         171   2e-49   Eucalyptus grandis [rose gum]
ref|XP_003575562.1|  PREDICTED: transcription factor MYB44-like         172   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_004151866.1|  PREDICTED: transcription factor MYB44-like         171   2e-49   
gb|AFK48638.1|  unknown                                                 170   2e-49   Medicago truncatula
ref|XP_008373085.1|  PREDICTED: transcription factor MYB44-like         171   2e-49   
ref|XP_004141275.1|  PREDICTED: transcription factor MYB44-like         170   3e-49   Cucumis sativus [cucumbers]
gb|KDP45901.1|  hypothetical protein JCGZ_15461                         170   3e-49   Jatropha curcas
ref|XP_004163238.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    170   3e-49   
ref|XP_011088207.1|  PREDICTED: transcription factor MYB44-like         170   4e-49   
gb|KJB77654.1|  hypothetical protein B456_012G149000                    169   5e-49   Gossypium raimondii
ref|XP_008452606.1|  PREDICTED: transcription factor MYB44-like         169   5e-49   Cucumis melo [Oriental melon]
gb|KDO59816.1|  hypothetical protein CISIN_1g040502mg                   168   7e-49   Citrus sinensis [apfelsine]
ref|XP_006422932.1|  hypothetical protein CICLE_v10029124mg             168   7e-49   Citrus clementina [clementine]
ref|XP_006487005.1|  PREDICTED: transcription factor MYB44-like         168   9e-49   Citrus sinensis [apfelsine]
ref|NP_001237693.1|  MYB transcription factor MYB70                     169   9e-49   
gb|AFH03055.1|  R2R3-MYB transcription factor MYB3                      170   9e-49   Epimedium sagittatum
gb|EYU36318.1|  hypothetical protein MIMGU_mgv1a022221mg                169   1e-48   Erythranthe guttata [common monkey flower]
gb|KJB32313.1|  hypothetical protein B456_005G234900                    167   1e-48   Gossypium raimondii
ref|XP_011001142.1|  PREDICTED: transcription factor MYB44-like         167   2e-48   Populus euphratica
ref|XP_002313145.1|  hypothetical protein POPTR_0009s09890g             167   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_010691674.1|  PREDICTED: transcription factor MYB44-like         167   2e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010547530.1|  PREDICTED: transcription factor MYB44-like         169   2e-48   Tarenaya hassleriana [spider flower]
gb|ABD60291.2|  R2R3-MYB transcription factor MYB6                      167   3e-48   Picea glauca
gb|ADL36760.1|  MYB domain class transcription factor                   167   4e-48   Malus domestica [apple tree]
ref|XP_002518677.1|  r2r3-myb transcription factor, putative            166   4e-48   Ricinus communis
emb|CDY01420.1|  BnaA07g11930D                                          166   5e-48   
ref|XP_009394543.1|  PREDICTED: transcription factor MYB44-like         168   5e-48   
gb|EPS70032.1|  myb-like protein                                        163   5e-48   Genlisea aurea
gb|KJB12279.1|  hypothetical protein B456_002G009300                    166   6e-48   Gossypium raimondii
emb|CDY12830.1|  BnaC07g16030D                                          166   6e-48   Brassica napus [oilseed rape]
ref|XP_009103434.1|  PREDICTED: transcription factor MYB44              167   7e-48   Brassica rapa
gb|AHN60125.1|  MYB transcription factor 44                             167   1e-47   Brassica napus [oilseed rape]
ref|XP_009396365.1|  PREDICTED: transcription factor MYB44-like         169   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001235715.1|  MYB transcription factor MYB68                     165   1e-47   Glycine max [soybeans]
ref|XP_010484518.1|  PREDICTED: transcription factor MYB44-like         167   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006279745.1|  hypothetical protein CARUB_v10027659mg             166   2e-47   Capsella rubella
ref|XP_006393928.1|  hypothetical protein EUTSA_v10004676mg             166   2e-47   Eutrema salsugineum [saltwater cress]
gb|KFK28404.1|  hypothetical protein AALP_AA8G510400                    166   2e-47   Arabis alpina [alpine rockcress]
ref|XP_002866710.1|  AtMYB44/AtMYBr1                                    166   2e-47   Arabidopsis lyrata subsp. lyrata
emb|CAA90809.1|  MYB-related protein                                    166   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64847.1|  myb-related protein, 33.3K                              166   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237709.1|  MYB transcription factor MYB81                     165   3e-47   
ref|NP_201531.1|  transcription factor MYB44                            166   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96490.1|  AT5g67300/K8K14_2                                       166   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464243.1|  PREDICTED: transcription factor MYB44              166   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010444669.1|  PREDICTED: transcription factor MYB44-like         166   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010550347.1|  PREDICTED: transcription factor MYB44-like         165   7e-47   Tarenaya hassleriana [spider flower]
ref|XP_006404067.1|  hypothetical protein EUTSA_v10010581mg             164   1e-46   Eutrema salsugineum [saltwater cress]
ref|XP_002877726.1|  myb family transcription factor                    164   1e-46   
ref|XP_001753593.1|  predicted protein                                  158   1e-46   
gb|ABD60281.1|  R2R3-MYB transcription factor MYB7                      166   2e-46   Pinus taeda
ref|XP_010096284.1|  Transcription factor                               164   2e-46   
gb|AHN60131.1|  MYB transcription factor 77                             162   2e-46   Brassica napus [oilseed rape]
gb|ABL97967.1|  R2R3-MYB transcription factor                           162   2e-46   Brassica rapa
emb|CDY57355.1|  BnaC08g48630D                                          162   3e-46   Brassica napus [oilseed rape]
gb|ABQ51222.1|  R2R3-MYB transcription factor MYB6                      164   3e-46   Picea glauca
ref|XP_010092183.1|  Transcription factor                               163   3e-46   
ref|XP_002285389.1|  PREDICTED: transcription factor MYB44              163   4e-46   Vitis vinifera
ref|NP_190575.1|  myb domain protein 77                                 162   6e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CAA90810.1|  MYB-related protein                                    162   7e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CAA74604.1|  R2R3-MYB transcription factor                          162   7e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010932223.1|  PREDICTED: transcription factor MYB44-like         160   7e-46   Elaeis guineensis
ref|XP_010515371.1|  PREDICTED: transcription factor MYB44-like         162   8e-46   Camelina sativa [gold-of-pleasure]
gb|KEH25080.1|  disease resistance protein (TIR-NBS-LRR class), p...    171   9e-46   Medicago truncatula
emb|CDY23023.1|  BnaC07g31640D                                          161   9e-46   Brassica napus [oilseed rape]
ref|XP_010426549.1|  PREDICTED: transcription factor MYB44-like         162   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009115687.1|  PREDICTED: transcription factor MYB44-like         160   1e-45   Brassica rapa
ref|XP_010547980.1|  PREDICTED: transcription factor MYB44-like         162   1e-45   Tarenaya hassleriana [spider flower]
emb|CDY02098.1|  BnaA03g40690D                                          161   1e-45   
ref|XP_006293134.1|  hypothetical protein CARUB_v10019440mg             161   2e-45   Capsella rubella
gb|ABD60288.2|  R2R3-MYB transcription factor MYB9                      159   2e-45   Picea glauca
gb|KFK34266.1|  hypothetical protein AALP_AA5G122700                    161   3e-45   Arabis alpina [alpine rockcress]
gb|ABR16702.1|  unknown                                                 163   3e-45   Picea sitchensis
ref|XP_002973727.1|  hypothetical protein SELMODRAFT_99462              155   3e-45   
gb|ABQ51225.1|  R2R3-MYB transcription factor MYB9                      163   3e-45   Picea glauca
ref|XP_008239060.1|  PREDICTED: transcription factor MYB44              160   3e-45   Prunus mume [ume]
emb|CDY30608.1|  BnaAnng03830D                                          159   3e-45   Brassica napus [oilseed rape]
ref|XP_008796508.1|  PREDICTED: transcription factor MYB44-like         159   4e-45   Phoenix dactylifera
ref|XP_002975777.1|  hypothetical protein SELMODRAFT_103999             155   4e-45   
ref|XP_002298748.1|  hypothetical protein POPTR_0001s30750g             158   5e-45   Populus trichocarpa [western balsam poplar]
gb|EYU37627.1|  hypothetical protein MIMGU_mgv1a026376mg                159   8e-45   Erythranthe guttata [common monkey flower]
ref|XP_009396271.1|  PREDICTED: transcription factor MYB44-like         160   9e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009136534.1|  PREDICTED: transcription factor MYB44-like         159   1e-44   Brassica rapa
gb|ABD60290.2|  R2R3-MYB transcription factor MYB7                      157   2e-44   Picea glauca
ref|XP_011030396.1|  PREDICTED: transcription factor MYB44-like         157   2e-44   Populus euphratica
ref|XP_002961364.1|  hypothetical protein SELMODRAFT_77255              152   2e-44   
ref|XP_004501595.1|  PREDICTED: transcriptional activator Myb-like      156   2e-44   Cicer arietinum [garbanzo]
ref|XP_007221111.1|  hypothetical protein PRUPE_ppa017892mg             156   3e-44   
ref|XP_009387830.1|  PREDICTED: transcription factor MYB44-like         155   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001753678.1|  predicted protein                                  151   5e-44   
gb|ABQ51223.1|  R2R3-MYB transcription factor MYB7                      159   5e-44   Picea glauca
ref|XP_010526144.1|  PREDICTED: transcriptional activator Myb-like      154   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_011030579.1|  PREDICTED: transcription factor MYB44-like         155   1e-43   Populus euphratica
ref|XP_010268609.1|  PREDICTED: transcriptional activator Myb-like      154   1e-43   Nelumbo nucifera [Indian lotus]
emb|CCU64175.1|  ScMYB23 protein                                        152   2e-43   Saccharum hybrid cultivar Co 86032
ref|XP_008234066.1|  PREDICTED: transcriptional activator Myb-like      154   2e-43   Prunus mume [ume]
emb|CDP07617.1|  unnamed protein product                                154   3e-43   Coffea canephora [robusta coffee]
ref|XP_006374997.1|  hypothetical protein POPTR_0014s03440g             153   4e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010920799.1|  PREDICTED: transcription factor MYB44-like         154   5e-43   Elaeis guineensis
gb|KDP38397.1|  hypothetical protein JCGZ_04322                         153   6e-43   Jatropha curcas
ref|XP_008792655.1|  PREDICTED: transcription factor MYB44-like         153   8e-43   Phoenix dactylifera
ref|XP_010031187.1|  PREDICTED: myb-related protein A-like              153   8e-43   Eucalyptus grandis [rose gum]
ref|NP_001235925.1|  MYB transcription factor MYB124                    152   8e-43   Glycine max [soybeans]
ref|XP_007136655.1|  hypothetical protein PHAVU_009G062700g             152   1e-42   Phaseolus vulgaris [French bean]
ref|XP_006578007.1|  PREDICTED: transcription factor MYB44-like         151   1e-42   Glycine max [soybeans]
ref|NP_001058148.1|  Os06g0637500                                       154   1e-42   
ref|XP_004951630.1|  PREDICTED: transcription factor MYB44-like         154   1e-42   
ref|NP_001147631.1|  LOC100281240                                       154   1e-42   
ref|XP_006434842.1|  hypothetical protein CICLE_v10002239mg             152   1e-42   
ref|XP_009412621.1|  PREDICTED: transcription factor MYB44-like         152   2e-42   
gb|KJB59839.1|  hypothetical protein B456_009G275100                    151   2e-42   
ref|XP_002451692.1|  hypothetical protein SORBIDRAFT_04g005940          154   2e-42   
emb|CDX83109.1|  BnaA01g21090D                                          149   2e-42   
ref|XP_002510273.1|  r2r3-myb transcription factor, putative            152   2e-42   
ref|XP_011017241.1|  PREDICTED: transcriptional activator Myb-like      151   2e-42   
gb|KDP44734.1|  hypothetical protein JCGZ_01234                         152   2e-42   
emb|CCU64155.1|  ScMYB3 protein                                         152   2e-42   
ref|XP_010268711.1|  PREDICTED: transcription factor MYB44-like         151   2e-42   
ref|XP_002438718.1|  hypothetical protein SORBIDRAFT_10g024950          153   3e-42   
ref|XP_010098722.1|  Transcription factor                               151   3e-42   
ref|NP_001159044.1|  MYB transcription factor TaMYB1                    152   4e-42   
gb|EAZ22021.1|  hypothetical protein OsJ_05678                          152   4e-42   
ref|NP_001046131.1|  Os02g0187700                                       152   5e-42   
gb|EAZ37752.1|  hypothetical protein OsJ_22090                          152   6e-42   
gb|KJB58408.1|  hypothetical protein B456_009G208900                    150   7e-42   
ref|XP_003603000.1|  Myb transcription factor                           149   7e-42   
ref|XP_002301201.1|  hypothetical protein POPTR_0002s13030g             150   8e-42   
ref|XP_009370160.1|  PREDICTED: transcriptional activator Myb-like      150   8e-42   
ref|XP_004169452.1|  PREDICTED: transcriptional activator Myb-like      150   8e-42   
ref|XP_008444647.1|  PREDICTED: transcription factor MYB44-like         150   8e-42   
dbj|BAK08030.1|  predicted protein                                      151   8e-42   
ref|XP_009345765.1|  PREDICTED: transcription factor MYB44-like         150   1e-41   
ref|XP_004152727.1|  PREDICTED: transcriptional activator Myb-like      150   1e-41   
ref|XP_007223827.1|  hypothetical protein PRUPE_ppa010735mg             149   1e-41   
ref|XP_008220156.1|  PREDICTED: transcription factor MYB44-like         149   1e-41   
gb|ABC86569.1|  MYB transcription factor TaMYB1                         151   1e-41   
ref|XP_011000247.1|  PREDICTED: transcription factor MYB44-like         149   2e-41   
ref|XP_008378059.1|  PREDICTED: transcriptional activator Myb-like      150   2e-41   
ref|XP_004141241.1|  PREDICTED: myb-related protein A-like              149   2e-41   
ref|XP_007008918.1|  Myb domain protein 73                              149   2e-41   
ref|XP_004173919.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...    149   2e-41   
gb|KJB76222.1|  hypothetical protein B456_012G078200                    149   2e-41   
ref|XP_010937896.1|  PREDICTED: transcription factor MYB44-like         150   2e-41   
ref|XP_008452503.1|  PREDICTED: transcriptional activator Myb-like      149   2e-41   
ref|XP_009101651.1|  PREDICTED: transcription factor MYB44-like         151   2e-41   
gb|AGN52029.1|  MYB-related transcription factor                        148   2e-41   
ref|XP_006657167.1|  PREDICTED: transcription factor MYB44-like         146   3e-41   
ref|XP_002528315.1|  r2r3-myb transcription factor, putative            149   3e-41   
ref|XP_002311241.1|  hypothetical protein POPTR_0008s07100g             149   4e-41   
ref|XP_009780273.1|  PREDICTED: transcription factor MYB44-like         149   4e-41   
gb|EYU40230.1|  hypothetical protein MIMGU_mgv1a021015mg                144   4e-41   
ref|XP_010253806.1|  PREDICTED: transcription factor MYB44-like         148   5e-41   
ref|XP_011470630.1|  PREDICTED: transcription factor MYB44-like         146   5e-41   
ref|XP_002272706.1|  PREDICTED: myb-related protein B                   148   5e-41   
ref|XP_007141751.1|  hypothetical protein PHAVU_008G222600g             148   5e-41   
ref|XP_008352004.1|  PREDICTED: transcription factor MYB44-like         147   5e-41   
ref|XP_010105436.1|  Transcription factor                               148   5e-41   
emb|CDX68566.1|  BnaC01g26440D                                          150   6e-41   
gb|KDO68919.1|  hypothetical protein CISIN_1g046570mg                   148   6e-41   
ref|XP_009367403.1|  PREDICTED: transcriptional activator Myb-like      147   7e-41   
ref|XP_004965791.1|  PREDICTED: transcription factor MYB44-like         149   7e-41   
ref|XP_004238184.1|  PREDICTED: transcription factor MYB44-like         147   8e-41   
ref|XP_006354921.1|  PREDICTED: transcription factor MYB44-like         147   8e-41   
ref|XP_002439611.1|  hypothetical protein SORBIDRAFT_09g016570          150   8e-41   
ref|XP_009400144.1|  PREDICTED: transcription factor MYB44-like         148   8e-41   
ref|XP_010059771.1|  PREDICTED: transcription factor MYB44-like         147   8e-41   
ref|XP_007017355.1|  Myb domain protein 77                              147   1e-40   
gb|EPS60436.1|  hypothetical protein M569_14368                         149   1e-40   
ref|XP_006435772.1|  hypothetical protein CICLE_v10032317mg             148   1e-40   
gb|AAG08961.1|AF122053_1  tuber-specific and sucrose-responsive e...    147   1e-40   
ref|XP_006843647.1|  hypothetical protein AMTR_s00007p00169630          147   1e-40   
ref|XP_010061776.1|  PREDICTED: transcription factor MYB44-like         146   1e-40   
ref|XP_008674458.1|  PREDICTED: transcription factor MYB44-like         147   2e-40   
emb|CCA29104.1|  putative MYB transcription factor                      147   2e-40   
emb|CCA29118.1|  putative MYB transcription factor                      147   2e-40   
ref|XP_004491024.1|  PREDICTED: transcription factor MYB44-like         147   2e-40   
ref|XP_009620130.1|  PREDICTED: transcription factor MYB44-like         147   2e-40   
ref|XP_008649548.1|  PREDICTED: transcription factor MYB48-like         149   3e-40   
ref|XP_008789179.1|  PREDICTED: transcription factor MYB44-like         147   3e-40   
gb|AHB59589.1|  putative R2R3 MYB protein 1                             145   3e-40   
ref|XP_011074463.1|  PREDICTED: transcription factor MYB44-like         145   4e-40   
ref|XP_009785340.1|  PREDICTED: myb protein-like                        146   4e-40   
ref|XP_006595859.1|  PREDICTED: transcription factor MYB44-like         145   4e-40   
ref|XP_004963854.1|  PREDICTED: transcription factor MYB44-like         148   5e-40   
ref|XP_011083803.1|  PREDICTED: transcription factor MYB44-like         145   5e-40   
ref|XP_004964242.1|  PREDICTED: transcriptional activator Myb-like      145   6e-40   
ref|XP_002284237.1|  PREDICTED: transcription factor MYB44              144   1e-39   
ref|XP_004291141.1|  PREDICTED: transcription factor MYB44-like         144   1e-39   
ref|XP_008374172.1|  PREDICTED: transcriptional activator Myb-like      144   2e-39   
ref|XP_004148201.1|  PREDICTED: uncharacterized protein LOC101207929    145   2e-39   
gb|KHN12754.1|  Transcription factor MYB44                              139   3e-39   
ref|XP_008805112.1|  PREDICTED: myb-related protein B-like              143   3e-39   
ref|NP_001132112.1|  uncharacterized protein LOC100193529               145   3e-39   
ref|XP_003518439.1|  PREDICTED: transcription factor MYB44              143   4e-39   
ref|XP_010666145.1|  PREDICTED: myb protein-like                        143   4e-39   
ref|XP_002489094.1|  hypothetical protein SORBIDRAFT_0088s002210        145   4e-39   
dbj|BAJ95362.1|  predicted protein                                      144   4e-39   
gb|ACF87327.1|  unknown                                                 144   5e-39   
gb|AIB05744.1|  MYB transcription factor                                144   5e-39   
gb|KJB63797.1|  hypothetical protein B456_010G016800                    141   7e-39   
ref|XP_001762255.1|  predicted protein                                  138   9e-39   
gb|EMS67867.1|  Transcription factor MYB44                              143   1e-38   
ref|XP_010464561.1|  PREDICTED: myb-related protein B-like              145   1e-38   
ref|XP_010486483.1|  PREDICTED: myb protein-like                        145   1e-38   
ref|XP_004157388.1|  PREDICTED: transcription factor MYB44-like         140   1e-38   
ref|XP_001765018.1|  predicted protein                                  138   1e-38   
ref|XP_009600873.1|  PREDICTED: transcription factor MYB44-like         143   1e-38   
ref|XP_003549412.2|  PREDICTED: myb-like protein A-like                 142   1e-38   
ref|XP_010922579.1|  PREDICTED: transcription factor MYB44-like         141   1e-38   
ref|XP_010558349.1|  PREDICTED: myb-like protein Q                      145   1e-38   
ref|XP_010553060.1|  PREDICTED: transcription factor MYB44              144   1e-38   
ref|XP_008369404.1|  PREDICTED: transcription factor MYB23-like         142   2e-38   
gb|AGN52077.1|  MYB-related transcription factor                        144   2e-38   
gb|EYU36282.1|  hypothetical protein MIMGU_mgv1a013600mg                140   2e-38   
ref|NP_001055277.1|  Os05g0350900                                       143   2e-38   
ref|XP_004140809.1|  PREDICTED: transcription factor MYB44-like         140   2e-38   
ref|XP_011094946.1|  PREDICTED: uncharacterized protein LOC105174515    144   3e-38   
ref|XP_010543715.1|  PREDICTED: transcription factor MYB44-like         139   4e-38   
ref|XP_010470301.1|  PREDICTED: myb-related protein B-like              144   4e-38   
ref|XP_010037759.1|  PREDICTED: myb-related protein A                   143   5e-38   
emb|CBI19574.3|  unnamed protein product                                145   6e-38   
ref|XP_011084888.1|  PREDICTED: transcriptional activator Myb-like      140   7e-38   
emb|CDP06538.1|  unnamed protein product                                143   8e-38   
ref|XP_003566355.1|  PREDICTED: transcription factor MYB44-like         141   9e-38   
ref|XP_010923173.1|  PREDICTED: myb-like protein Q                      142   1e-37   
ref|XP_004246368.1|  PREDICTED: myb-related protein 315                 142   1e-37   
gb|KFK38309.1|  hypothetical protein AALP_AA3G097200                    141   1e-37   
ref|XP_009407576.1|  PREDICTED: myb-like protein AA                     141   2e-37   
gb|EYU41812.1|  hypothetical protein MIMGU_mgv1a023010mg                142   2e-37   
ref|XP_008785463.1|  PREDICTED: myb-like protein Q                      141   3e-37   
ref|XP_006363093.1|  PREDICTED: myb-like protein AA-like                141   4e-37   
gb|EYU43428.1|  hypothetical protein MIMGU_mgv1a012392mg                138   4e-37   
ref|XP_003616662.1|  Myb transcription factor                           139   4e-37   
ref|XP_010931159.1|  PREDICTED: trichome differentiation protein ...    141   5e-37   
ref|XP_009402306.1|  PREDICTED: myb-like protein AA                     140   5e-37   
ref|XP_009783755.1|  PREDICTED: myb-related protein B-like              140   7e-37   
ref|XP_009613649.1|  PREDICTED: myb-related protein B                   140   8e-37   
ref|XP_007026835.1|  R2r3-myb transcription factor, putative            140   1e-36   
ref|XP_006297844.1|  hypothetical protein CARUB_v10013882mg             139   2e-36   
ref|XP_007205315.1|  hypothetical protein PRUPE_ppa006851mg             139   2e-36   
ref|XP_006407701.1|  hypothetical protein EUTSA_v10021963mg             139   2e-36   
ref|XP_010256736.1|  PREDICTED: uncharacterized protein LOC104597...    140   2e-36   
ref|XP_004147900.1|  PREDICTED: uncharacterized protein LOC101212170    139   2e-36   
ref|XP_004162756.1|  PREDICTED: uncharacterized LOC101212170            139   2e-36   
ref|XP_009416214.1|  PREDICTED: myb-related protein 315-like            139   2e-36   
ref|XP_008239931.1|  PREDICTED: uncharacterized protein LOC103338495    139   2e-36   
ref|XP_002276341.1|  PREDICTED: transcription factor RAX1               139   2e-36   
ref|XP_002882609.1|  ATMYB1                                             139   3e-36   
ref|XP_006848033.1|  hypothetical protein AMTR_s00029p00183640          139   3e-36   
ref|XP_008448879.1|  PREDICTED: transcription factor MYB86              139   3e-36   
gb|EEC79030.1|  hypothetical protein OsI_19572                          136   3e-36   
gb|EPS67829.1|  hypothetical protein M569_06945                         134   4e-36   
ref|XP_010533876.1|  PREDICTED: myb-related protein Myb4-like           137   4e-36   
ref|XP_011036027.1|  PREDICTED: transcription factor MYB76-like         139   5e-36   
ref|XP_002315183.2|  hypothetical protein POPTR_0010s20220g             138   5e-36   
ref|XP_010239722.1|  PREDICTED: transcription factor MYB44-like         136   5e-36   
gb|AHB59593.1|  putative R2R3 MYB protein 5                             137   6e-36   
ref|XP_002276375.1|  PREDICTED: uncharacterized protein LOC100256309    138   6e-36   
gb|AAR83899.1|  tuber-specific protein                                  137   6e-36   
ref|XP_011038690.1|  PREDICTED: transcriptional activator Myb-like      138   7e-36   
ref|XP_007160819.1|  hypothetical protein PHAVU_001G019200g             133   8e-36   
dbj|BAK05308.1|  predicted protein                                      135   8e-36   
ref|XP_010101850.1|  Transcription factor                               137   1e-35   
ref|XP_006645018.1|  PREDICTED: uncharacterized protein LOC102712209    137   1e-35   
ref|XP_010517362.1|  PREDICTED: uncharacterized protein LOC104792825    137   1e-35   
ref|XP_003545242.1|  PREDICTED: myb-related protein 306-like            137   1e-35   
gb|KHN20881.1|  Transcription factor MYB44                              137   1e-35   
gb|KFK36882.1|  hypothetical protein AALP_AA4G184000                    137   1e-35   
gb|KJB36867.1|  hypothetical protein B456_006G179700                    137   1e-35   
ref|XP_010508952.1|  PREDICTED: uncharacterized protein LOC104785436    137   2e-35   
ref|NP_001044814.1|  Os01g0850400                                       137   2e-35   
gb|EAY76504.1|  hypothetical protein OsI_04445                          137   2e-35   
gb|KHG04525.1|  Transcription factor MYB44 -like protein                137   2e-35   
gb|KDP44844.1|  hypothetical protein JCGZ_01344                         137   2e-35   
ref|XP_010262707.1|  PREDICTED: uncharacterized protein LOC104601164    137   2e-35   
ref|XP_004970585.1|  PREDICTED: myb-related protein 306-like            137   2e-35   
ref|NP_001141619.2|  MYB transcription factor                           137   2e-35   
emb|CBH32525.1|  Myb-like DNA-binding domain containing protein,e...    137   2e-35   
ref|XP_010505683.1|  PREDICTED: uncharacterized protein LOC104782447    136   2e-35   
ref|XP_010031265.1|  PREDICTED: myb-related protein B                   136   3e-35   
ref|XP_006646750.1|  PREDICTED: transcriptional activator Myb-like      132   3e-35   
ref|XP_002527890.1|  r2r3-myb transcription factor, putative            135   4e-35   
gb|KDP24518.1|  hypothetical protein JCGZ_25082                         136   4e-35   
gb|EPS64975.1|  hypothetical protein M569_09804                         134   4e-35   
ref|XP_007009127.1|  Myb domain protein 25, putative                    136   4e-35   
ref|XP_002458769.1|  hypothetical protein SORBIDRAFT_03g039950          135   6e-35   
ref|XP_002881682.1|  predicted protein                                  135   8e-35   
ref|XP_009615291.1|  PREDICTED: transcription factor MYB122-like        135   8e-35   
ref|XP_010690407.1|  PREDICTED: uncharacterized protein LOC104903953    135   8e-35   
ref|XP_006480929.1|  PREDICTED: myb-related protein B-like              134   9e-35   
gb|KDO58018.1|  hypothetical protein CISIN_1g017566mg                   134   9e-35   
ref|XP_006429252.1|  hypothetical protein CICLE_v10012003mg             134   1e-34   
ref|XP_010232563.1|  PREDICTED: uncharacterized protein LOC100827463    135   1e-34   
ref|XP_010648804.1|  PREDICTED: transcription factor MYB44-like         132   1e-34   
ref|XP_009781248.1|  PREDICTED: transcription factor MYB122-like        135   1e-34   
gb|KHG29583.1|  Transcription factor MYB44 -like protein                135   1e-34   
gb|KJB74193.1|  hypothetical protein B456_011G278500                    135   1e-34   
gb|AGN52047.1|  MYB-related transcription factor                        134   2e-34   
ref|XP_008233695.1|  PREDICTED: transcription factor RAX2-like          134   2e-34   
gb|EYU25387.1|  hypothetical protein MIMGU_mgv1a013005mg                130   2e-34   
ref|XP_003520943.1|  PREDICTED: transcription factor MYB44-like         133   2e-34   
ref|XP_010534544.1|  PREDICTED: transcription factor MYB86-like         133   2e-34   
gb|KEH28952.1|  myb transcription factor                                133   2e-34   
ref|NP_187534.1|  myb domain protein 1                                  133   3e-34   
ref|XP_003516915.1|  PREDICTED: myb protein-like                        132   3e-34   
ref|XP_008388098.1|  PREDICTED: transcription factor MYB44-like         133   3e-34   
gb|AAS10070.1|  MYB transcription factor                                133   4e-34   
ref|NP_191132.1|  myb domain protein 109                                133   4e-34   
gb|KDO69257.1|  hypothetical protein CISIN_1g012494mg                   134   4e-34   
ref|XP_006435568.1|  hypothetical protein CICLE_v10031463mg             134   5e-34   
ref|XP_006486452.1|  PREDICTED: uncharacterized protein LOC102618168    134   5e-34   
gb|AGN52092.1|  MYB-related transcription factor                        132   5e-34   
ref|XP_009116273.1|  PREDICTED: uncharacterized protein LOC103841480    132   6e-34   
emb|CDY27271.1|  BnaA09g35310D                                          132   6e-34   
ref|XP_009346994.1|  PREDICTED: myb-related protein 306-like            132   7e-34   
ref|XP_006294397.1|  hypothetical protein CARUB_v10023414mg             132   7e-34   
gb|EYU35744.1|  hypothetical protein MIMGU_mgv1a022052mg                124   8e-34   
emb|CDX72208.1|  BnaC08g26660D                                          131   1e-33   
gb|KCW50449.1|  hypothetical protein EUGRSUZ_J00189                     128   1e-33   
ref|XP_008649550.1|  PREDICTED: transcription factor MYB21-like         130   1e-33   
ref|XP_011076754.1|  PREDICTED: uncharacterized protein LOC105160924    132   1e-33   
ref|XP_002950366.1|  transcription factor Myb9                          125   1e-33   
ref|XP_008345508.1|  PREDICTED: transcription factor MYB59-like         131   1e-33   
gb|ADL36766.1|  MYB domain class transcription factor                   131   2e-33   
ref|XP_008370028.1|  PREDICTED: transcription factor MYB59-like         131   2e-33   
ref|XP_006403424.1|  hypothetical protein EUTSA_v10010431mg             131   2e-33   
ref|XP_003535042.1|  PREDICTED: transcription factor MYB44-like         125   2e-33   



>ref|XP_007155887.1| hypothetical protein PHAVU_003G240200g [Phaseolus vulgaris]
 gb|ESW27881.1| hypothetical protein PHAVU_003G240200g [Phaseolus vulgaris]
Length=289

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M ++SRKDMDR+KGPWSPEEDE LQ+LV++HGPRNWSLIS+SIPGRSGKSCRLRWCNQLS
Sbjct  1    MMAVSRKDMDRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTD
Sbjct  61   PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTD  99



>gb|ACJ85153.1| unknown [Medicago truncatula]
Length=199

 Score =   194 bits (494),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +2

Query  134  ISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQV  313
            I+RK+MDR+KGPWSPEEDE LQ+LV+KHGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQV
Sbjct  6    INRKEMDRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQV  65

Query  314  EHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            EHRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTD
Sbjct  66   EHRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTD  101



>gb|AHB59606.1| putative MYB-related protein 20 [Arachis hypogaea]
Length=352

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            +++RKDMDR+KGPWSPEED+ LQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  9    AVTRKDMDRIKGPWSPEEDDALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  68

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTD
Sbjct  69   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTD  105



>gb|AFK47194.1| unknown [Medicago truncatula]
Length=326

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +2

Query  134  ISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQV  313
            I+RK+MDR+KGPWSPEEDE LQ+LV+KHGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQV
Sbjct  6    INRKEMDRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQV  65

Query  314  EHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            EHRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTD
Sbjct  66   EHRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTD  101



>ref|XP_006339846.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=371

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 97/99 (98%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS S++DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-SKRDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  60   PQVEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_003524661.1| PREDICTED: transcription factor MYB44 [Glycine max]
Length=295

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M +++RKDMDR+KGPWSPEEDE LQ+LV++HGPRNWSLIS+SIPGRSGKSCRLRWCNQLS
Sbjct  1    MIAVARKDMDRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHRAFTPEED+TIIRAHARFGNKWATIARLL+GRTD
Sbjct  61   PQVEHRAFTPEEDETIIRAHARFGNKWATIARLLSGRTD  99



>ref|XP_009588514.1| PREDICTED: transcription factor MYB44 [Nicotiana tomentosiformis]
Length=361

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            S+KDMDRVKGPWSPEEDELLQQLV KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  8    SKKDMDRVKGPWSPEEDELLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  67

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  68   HRAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  102



>gb|KJB43824.1| hypothetical protein B456_007G218100 [Gossypium raimondii]
Length=310

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +2

Query  140  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  319
            RK+MDR+KGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  9    RKEMDRIKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  68

Query  320  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            RAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  69   RAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  102



>gb|AEO27498.1| MYB2 [Chrysanthemum x morifolium]
Length=315

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MA++S+KDMDR+KGPWSP+EDE+L  LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MATVSKKDMDRIKGPWSPDEDEMLTNLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAFTPEED+TI+RAHARFGNKWATIARLL+GRTD
Sbjct  61   PEVEHRAFTPEEDETILRAHARFGNKWATIARLLSGRTD  99



>ref|XP_004511885.1| PREDICTED: transcription factor MYB44-like [Cicer arietinum]
Length=323

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
             +I+RK+MDR+KGPWSPEEDE LQ LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP
Sbjct  3    TTITRKEMDRIKGPWSPEEDEALQNLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  62

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHRAFTPEEDDTI+RAHARFGNKWATIARLL+GRTD
Sbjct  63   QVEHRAFTPEEDDTIVRAHARFGNKWATIARLLSGRTD  100



>ref|XP_007205522.1| hypothetical protein PRUPE_ppa008450mg [Prunus persica]
 gb|EMJ06721.1| hypothetical protein PRUPE_ppa008450mg [Prunus persica]
Length=331

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++SRKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ALSRKDMDRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_009798591.1| PREDICTED: transcription factor MYB44 [Nicotiana sylvestris]
Length=357

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
            ++ S+KDMDRVKGPWSPEEDELLQQLV KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP
Sbjct  5    SNCSKKDMDRVKGPWSPEEDELLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  64

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  65   QVEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  102



>ref|NP_001235731.1| MYB transcription factor MYB178 [Glycine max]
 gb|ABH02834.1| MYB transcription factor MYB178 [Glycine max]
Length=178

 Score =   191 bits (486),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M +++RK+MDR+KGPWSPEEDE LQ+LV++HGPRNWSLIS+SIPGRSGKSCRLRWCNQLS
Sbjct  1    MMAVARKEMDRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHRAFTPEED+TIIRAHARFGNKWATIARLL+GRTD
Sbjct  61   PQVEHRAFTPEEDETIIRAHARFGNKWATIARLLSGRTD  99



>ref|XP_010315996.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=372

 Score =   197 bits (502),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            S++DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  8    SKRDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  67

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  68   HRAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  102



>ref|XP_008360495.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44-like, 
partial [Malus domestica]
Length=199

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++ RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVIRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTD  98



>gb|AHN19845.1| MYB6 [Malus hybrid cultivar]
Length=310

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++SRKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTD  98



>gb|AIK01747.1| MYB [Chrysanthemum indicum var. aromaticum]
Length=315

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS+S+KDMDR+KGPWSP+EDE+L  LV+KHGPRNWSLISKSIPGRSGKSCRLRWCN+LS
Sbjct  1    MASVSKKDMDRIKGPWSPDEDEMLTNLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNRLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P VEHRAFTPEED+TI+RAHARFGNKWATIARLL+GRTD
Sbjct  61   PDVEHRAFTPEEDETILRAHARFGNKWATIARLLSGRTD  99



>ref|XP_010244270.1| PREDICTED: transcription factor MYB44 [Nelumbo nucifera]
Length=330

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+S SRKD DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSSSSRKDQDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHRAFTPEED+TIIRAHA+FGNKWATIARLL+GRTD
Sbjct  61   PQVEHRAFTPEEDETIIRAHAKFGNKWATIARLLSGRTD  99



>ref|XP_009372447.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=316

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++SRKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTD  98



>gb|AFH03065.1| R2R3-MYB transcription factor MYB13 [Epimedium sagittatum]
Length=350

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
            +S SRKDMDR+KGPWSPEED+ L +LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP
Sbjct  3    SSSSRKDMDRIKGPWSPEEDDSLTKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  62

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHRAFTPEEDDTIIRAHA+FGNKWATIARLL+GRTD
Sbjct  63   QVEHRAFTPEEDDTIIRAHAKFGNKWATIARLLSGRTD  100



>ref|XP_007047395.1| Myb domain protein 73, putative [Theobroma cacao]
 gb|EOX91552.1| Myb domain protein 73, putative [Theobroma cacao]
Length=312

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RK+MDR+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  8    NRKEMDRIKGPWSPEEDDLLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  67

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  68   HRAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  102



>ref|XP_011099313.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=360

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +2

Query  140  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  319
            + DMDR+KGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  12   KMDMDRIKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  71

Query  320  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            RAFTPEED+TIIRAHA+FGNKWATIARLL+GRTD
Sbjct  72   RAFTPEEDETIIRAHAKFGNKWATIARLLSGRTD  105



>ref|XP_008391509.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=313

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++ RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVIRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTD  98



>gb|AAZ20429.1| MYB6 [Malus domestica]
 gb|ADL36770.1| MYB domain class transcription factor [Malus domestica]
Length=312

 Score =   194 bits (493),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++SRKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSRKDMDRIKGPWSPEEDDSLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTD  98



>emb|CBI19466.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   192 bits (488),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS S+KD+DR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  12   MAS-SKKDLDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  70

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHRAFTPEED TIIRAHARFGNKWATIARLL GRTD
Sbjct  71   PQVEHRAFTPEEDATIIRAHARFGNKWATIARLLVGRTD  109



>ref|XP_008338349.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=312

 Score =   193 bits (491),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++SRKDMDR+KGPWSPEED+ LQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSRKDMDRIKGPWSPEEDDSLQXLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_009367649.1| PREDICTED: transcription factor MYB44 [Pyrus x bretschneideri]
Length=323

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++ RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVIRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTD  98



>emb|CDP02540.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +2

Query  140  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  319
            RKD DR+KGPWSPEED+LLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  17   RKDADRIKGPWSPEEDDLLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  76

Query  320  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            RAFTPEEDD IIRAHA+FGNKWATIARLL+GRTD
Sbjct  77   RAFTPEEDDAIIRAHAKFGNKWATIARLLSGRTD  110



>ref|XP_008351390.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=255

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++ RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVIRKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_010271172.1| PREDICTED: transcription factor MYB44-like [Nelumbo nucifera]
Length=329

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            S SRKD+DR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    SSSRKDVDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEED+TII+AHA+FGNKWATIARLL+GRTD
Sbjct  62   VEHRAFTPEEDETIIKAHAKFGNKWATIARLLSGRTD  98



>ref|XP_004238123.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=328

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 97/100 (97%), Gaps = 1/100 (1%)
 Frame = +2

Query  125  MASIS-RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  301
            MA+I+ RKD DR+KGPWSPEEDELLQ LV+KHGPRNW+LISKS+PGRSGKSCRLRWCNQL
Sbjct  1    MAAITQRKDSDRIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPGRSGKSCRLRWCNQL  60

Query  302  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            SPQVEHRAFTPEEDDTIIRAHA+FGNKWATIARLL+GRTD
Sbjct  61   SPQVEHRAFTPEEDDTIIRAHAKFGNKWATIARLLSGRTD  100



>gb|AGN52088.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52198.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=305

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +2

Query  140  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  319
            + D+DR+KGPWSPEED+LLQQLVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  3    KTDIDRIKGPWSPEEDDLLQQLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  62

Query  320  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            RAFTPEEDDTIIRAHARFGNKWATIARLL+GRTD
Sbjct  63   RAFTPEEDDTIIRAHARFGNKWATIARLLSGRTD  96



>gb|AHN19846.1| MYB6 [Malus hybrid cultivar]
Length=312

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++S KDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVSTKDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDMIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_002285015.1| PREDICTED: transcription factor MYB44-like [Vitis vinifera]
Length=313

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 95/99 (96%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS S+KD+DR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-SKKDLDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHRAFTPEED TIIRAHARFGNKWATIARLL GRTD
Sbjct  60   PQVEHRAFTPEEDATIIRAHARFGNKWATIARLLVGRTD  98



>gb|KDP31997.1| hypothetical protein JCGZ_12458 [Jatropha curcas]
 gb|AIT52201.1| MYB family protein [Jatropha curcas]
Length=326

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            +++ KD+DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVTNKDVDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  98



>gb|AAG08959.1|AF122051_1 tuber-specific and sucrose-responsive element binding factor 
[Solanum tuberosum]
Length=364

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/91 (98%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  61   TPEEDETIIRAHARFGNKWATIARLLNGRTD  91



>ref|XP_006367421.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=320

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 97/100 (97%), Gaps = 1/100 (1%)
 Frame = +2

Query  125  MASIS-RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  301
            MA+I+ RKD DR+KGPWSPEEDELLQ LV+KHGPRNW+LISKS+PGRSGKSCRLRWCNQL
Sbjct  1    MAAITQRKDSDRIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPGRSGKSCRLRWCNQL  60

Query  302  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            SPQVEHRAFTPEEDDTIIRAHA++GNKWATIARLL+GRTD
Sbjct  61   SPQVEHRAFTPEEDDTIIRAHAKYGNKWATIARLLSGRTD  100



>ref|XP_006425988.1| hypothetical protein CICLE_v10026107mg [Citrus clementina]
 gb|ABQ10816.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|ESR39228.1| hypothetical protein CICLE_v10026107mg [Citrus clementina]
Length=317

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTD  98



>gb|KJB40285.1| hypothetical protein B456_007G055600 [Gossypium raimondii]
Length=314

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            ++K+MDR+KGPWSPEED+LLQ+LVQK+GPRNWSL+SKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  8    NKKEMDRIKGPWSPEEDDLLQKLVQKYGPRNWSLVSKSIPGRSGKSCRLRWCNQLSPQVE  67

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  68   HRAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  102



>ref|XP_009109365.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=305

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+S  RK+M+R+KGPWSPEEDELLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSSSVRKNMERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEED+TIIRAHARFGNKWATI+RLL+GRTD
Sbjct  61   PEVEHRGFSPEEDETIIRAHARFGNKWATISRLLSGRTD  99



>gb|ABQ10819.1| putative R2R3-Myb transcription factor [Citrus sinensis]
Length=317

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTD  98



>emb|CDY22442.1| BnaC03g61550D [Brassica napus]
Length=275

 Score =   190 bits (483),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+S  RK+M+R+KGPWSPEEDELLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSSSVRKNMERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEED+TI+RAHARFGNKWATI+RLL+GRTD
Sbjct  61   PEVEHRGFSPEEDETIVRAHARFGNKWATISRLLSGRTD  99



>ref|NP_001275856.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|ABQ10817.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|KDO79070.1| hypothetical protein CISIN_1g021071mg [Citrus sinensis]
Length=317

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTD  98



>gb|ABQ10818.1| putative R2R3-Myb transcription factor [Citrus sinensis]
Length=317

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_009795719.1| PREDICTED: transcription factor MYB44-like [Nicotiana sylvestris]
Length=332

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 97/100 (97%), Gaps = 1/100 (1%)
 Frame = +2

Query  125  MASIS-RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  301
            MA+I+ RKD DR+KGPWSPEEDELLQ LV+KHGPRNWSLISKS+PGRSGKSCRLRWCNQL
Sbjct  1    MAAITQRKDSDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWCNQL  60

Query  302  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            SPQVEHRAFTPEED+TIIRAHA+FGNKWATIARLL+GRTD
Sbjct  61   SPQVEHRAFTPEEDETIIRAHAKFGNKWATIARLLSGRTD  100



>ref|XP_011006987.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=330

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            +I+RK+MDR+KGPWSPEEDE LQ+LVQKHG RNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AITRKEMDRIKGPWSPEEDEALQKLVQKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHR FTP+EDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRPFTPDEDDTIIRAHARFGNKWATIARLLYGRTD  98



>emb|CDY44045.1| BnaA08g15610D [Brassica napus]
Length=285

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+S  RK+M+R+KGPWSPEEDELLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSSSVRKNMERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEED+TIIRAHARFGNKWATI+RLL+GRTD
Sbjct  61   PEVEHRGFSPEEDETIIRAHARFGNKWATISRLLSGRTD  99



>gb|KDO79069.1| hypothetical protein CISIN_1g021071mg [Citrus sinensis]
Length=278

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            + +R+++DR+KGPWSPEEDE LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AFNRREVDRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEED+ IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDEMIIRAHARFGNKWATIARLLNGRTD  98



>ref|NP_001235688.1| MYB transcription factor MYB61 [Glycine max]
 gb|ABH02829.1| MYB transcription factor MYB61 [Glycine max]
Length=305

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M +++RKDMDR+KGPWSPEEDE L +LV++HGPRNWSLIS+SIPGRSGKSC LRWCNQLS
Sbjct  1    MIAVARKDMDRIKGPWSPEEDEALHKLVERHGPRNWSLISRSIPGRSGKSCMLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHRAFTPEED+TIIRAHARFGNKWATIARLL+GRTD
Sbjct  61   PQVEHRAFTPEEDETIIRAHARFGNKWATIARLLSGRTD  99



>ref|XP_002310702.1| hypothetical protein POPTR_0007s10490g [Populus trichocarpa]
 gb|EEE91152.1| hypothetical protein POPTR_0007s10490g [Populus trichocarpa]
Length=330

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            +I+RK+MDR+KGPWSPEEDE LQ+LVQKHG RNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AITRKEMDRIKGPWSPEEDEALQKLVQKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHR FTP+EDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRPFTPDEDDTIIRAHARFGNKWATIARLLYGRTD  98



>ref|XP_011010210.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=335

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            + +RK+MDR+KGPWSPEEDE LQ+LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ATTRKEMDRIKGPWSPEEDEALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDKIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_003611666.1| R2R3-MYB transcription factor [Medicago truncatula]
 gb|AES94624.1| myb transcription factor [Medicago truncatula]
Length=316

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE LQ+LV+KHGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEEDDTIIRAHARFGNKWATIARLL+GRTD
Sbjct  61   TPEEDDTIIRAHARFGNKWATIARLLSGRTD  91



>ref|XP_010679545.1| PREDICTED: transcription factor MYB44 [Beta vulgaris subsp. vulgaris]
Length=313

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RK++DR+KGPWSPEEDE L +LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  14   NRKEVDRIKGPWSPEEDEALTRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  73

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFTPEEDDTIIRAHARFGNKWATIARLL+GRTD
Sbjct  74   HRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTD  108



>ref|XP_010531261.1| PREDICTED: transcription factor MYB44 [Tarenaya hassleriana]
Length=326

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  SR++M+R+KGPWSPEED+LLQ+LV KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRREMERIKGPWSPEEDDLLQKLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  99



>emb|CAN75196.1| hypothetical protein VITISV_014739 [Vitis vinifera]
Length=301

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RKD+DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  4    TRKDVDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  63

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFT EEDDTI+RAHARFGNKWATIARLL+GRTD
Sbjct  64   HRAFTSEEDDTIMRAHARFGNKWATIARLLSGRTD  98



>ref|XP_008440323.1| PREDICTED: transcription factor MYB44 [Cucumis melo]
Length=303

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            +++RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ALTRKDMDRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHR F+PEED+TIIRAHA FGN+WATIARLL GRTD
Sbjct  62   VEHRPFSPEEDETIIRAHANFGNRWATIARLLTGRTD  98



>ref|XP_004141899.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004157164.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN48557.1| Sucrose responsive element binding protein [Cucumis sativus]
Length=301

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            +++RKDMDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ALTRKDMDRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHR F+PEED+TIIRAHA FGN+WATIARLL GRTD
Sbjct  62   VEHRPFSPEEDETIIRAHANFGNRWATIARLLTGRTD  98



>gb|AGN52031.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52141.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=317

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +R + DR+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  3    ARSEADRIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  62

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFTPEED+TIIRAHARFGNKWATIARLL+GRTD
Sbjct  63   HRAFTPEEDETIIRAHARFGNKWATIARLLSGRTD  97



>ref|XP_010943207.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=370

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            KDMDR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  10   KDMDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  69

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTPEEDDTIIRAH RFGNKWATIARLL+GRTD
Sbjct  70   PFTPEEDDTIIRAHRRFGNKWATIARLLSGRTD  102



>ref|XP_002306488.2| hypothetical protein POPTR_0005s18620g [Populus trichocarpa]
 gb|EEE93484.2| hypothetical protein POPTR_0005s18620g [Populus trichocarpa]
Length=351

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            + +RK+MDR+KGPWSPEEDE L++LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    ATTRKEMDRIKGPWSPEEDEALKKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDDRIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_006411909.1| hypothetical protein EUTSA_v10025742mg [Eutrema salsugineum]
 gb|ESQ53362.1| hypothetical protein EUTSA_v10025742mg [Eutrema salsugineum]
Length=321

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPTRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAF+PEED+TIIRAHARFGNKWATI+RLL GRTD
Sbjct  61   PEVEHRAFSPEEDETIIRAHARFGNKWATISRLLNGRTD  99



>ref|XP_002524926.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF37423.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=339

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            +++ K++DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AVTGKEVDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHRAFTPEED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  62   VEHRAFTPEEDETIIRAHARFGNKWATIARLLNGRTD  98



>dbj|BAJ40867.1| transcriptional factor MYB-1 [Coptis japonica]
Length=312

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 2/101 (2%)
 Frame = +2

Query  125  MASIS--RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQ  298
            MASIS  R+D+DR+KGPWSPEED+LL +LV KHGPRNWSLISKSIPGRSGKSCRLRWCNQ
Sbjct  1    MASISSSRRDLDRIKGPWSPEEDDLLTKLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQ  60

Query  299  LSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            LSPQVEHRAF+ EEDDTIIRAHA+FGNKWATIARLL GRTD
Sbjct  61   LSPQVEHRAFSSEEDDTIIRAHAKFGNKWATIARLLNGRTD  101



>ref|NP_001268121.1| sucrose responsive element binding protein [Vitis vinifera]
 gb|AAY28930.1| sucrose responsive element binding protein [Vitis vinifera]
Length=312

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RKD DR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  4    TRKDADRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  63

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFT EEDDTI+RAHARFGNKWATIARLL+GRTD
Sbjct  64   HRAFTSEEDDTIMRAHARFGNKWATIARLLSGRTD  98



>ref|XP_010070607.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW59483.1| hypothetical protein EUGRSUZ_H02226 [Eucalyptus grandis]
Length=339

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            SRK++DR+KGPWSPEEDE L+ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  3    SRKEVDRIKGPWSPEEDEALRLLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  62

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFTPEEDD I+RAHARFGNKWATIARLL+GRTD
Sbjct  63   HRAFTPEEDDIIVRAHARFGNKWATIARLLSGRTD  97



>ref|XP_002880492.1| hypothetical protein ARALYDRAFT_481200 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56751.1| hypothetical protein ARALYDRAFT_481200 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MA  +RK+MDR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAGSTRKEMDRIKGPWSPEEDDLLQTLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT EEDDTII AHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRGFTAEEDDTIILAHARFGNKWATIARLLNGRTD  99



>ref|XP_007156759.1| hypothetical protein PHAVU_002G015100g [Phaseolus vulgaris]
 gb|ESW28753.1| hypothetical protein PHAVU_002G015100g [Phaseolus vulgaris]
Length=300

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE LQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEEDDTI+RAHARFGNKWATIARLL GRTD
Sbjct  61   TPEEDDTIVRAHARFGNKWATIARLLQGRTD  91



>ref|XP_010548433.1| PREDICTED: transcription factor MYB44 isoform X2 [Tarenaya hassleriana]
 ref|XP_010548434.1| PREDICTED: transcription factor MYB44 isoform X3 [Tarenaya hassleriana]
Length=328

 Score =   189 bits (481),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  SR++M+R+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRREMERIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAFT EED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRAFTSEEDETIIRAHARFGNKWATIARLLTGRTD  99



>ref|XP_010548432.1| PREDICTED: transcription factor MYB44 isoform X1 [Tarenaya hassleriana]
Length=328

 Score =   189 bits (481),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  SR++M+R+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRREMERIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAFT EED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRAFTSEEDETIIRAHARFGNKWATIARLLTGRTD  99



>emb|CDX69287.1| BnaC01g01660D [Brassica napus]
Length=306

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  SRK+M+R+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRKNMERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAFT EED+TIIRAHARFGNKWATI+RLL GRTD
Sbjct  61   PEVEHRAFTAEEDETIIRAHARFGNKWATISRLLNGRTD  99



>emb|CDX75635.1| BnaA01g00670D [Brassica napus]
Length=299

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  SRK+M+R+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRKNMERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAFT EED+TIIRAHARFGNKWATI+RLL GRTD
Sbjct  61   PEVEHRAFTAEEDETIIRAHARFGNKWATISRLLNGRTD  99



>ref|XP_004287994.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=309

 Score =   188 bits (477),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEED+ LQ LVQKHGPRNWSLISK+IPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  11   MDRIKGPWSPEEDDALQSLVQKHGPRNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHRAF  70

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEEDDTIIRAHARFGNKWATIARLL+GRTD
Sbjct  71   TPEEDDTIIRAHARFGNKWATIARLLSGRTD  101



>ref|XP_011074411.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=327

 Score =   188 bits (478),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 1/100 (1%)
 Frame = +2

Query  125  MASIS-RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  301
            MAS   +K+ DR+KGPWSPEED+LLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  1    MASTDQKKETDRIKGPWSPEEDDLLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  60

Query  302  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            SPQVEHRAFTPEEDDTII+AHA+FGNKWATIARLL+GRTD
Sbjct  61   SPQVEHRAFTPEEDDTIIKAHAKFGNKWATIARLLSGRTD  100



>ref|XP_010095320.1| Transcription factor [Morus notabilis]
 gb|EXB59531.1| Transcription factor [Morus notabilis]
Length=304

 Score =   187 bits (476),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TP+ED+TIIRAHARFGNKWATIARLL GRTD
Sbjct  61   TPDEDETIIRAHARFGNKWATIARLLNGRTD  91



>ref|XP_009137661.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
 gb|AHN60130.1| MYB transcription factor 73 [Brassica napus]
Length=328

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  SRK+M+R+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPSRKNMERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAFT EED+TIIRAHARFGNKWATI+RLL GRTD
Sbjct  61   PEVEHRAFTAEEDETIIRAHARFGNKWATISRLLNGRTD  99



>gb|AAM65553.1| putative MYB family transcription factor [Arabidopsis thaliana]
Length=309

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+MDR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMDRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT EEDDTII AHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRGFTAEEDDTIILAHARFGNKWATIARLLNGRTD  99



>gb|KDP41681.1| hypothetical protein JCGZ_16088 [Jatropha curcas]
 gb|AIT52202.1| MYB family protein [Jatropha curcas]
Length=313

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS +RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MASAARKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT +EDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRPFTADEDDTIIRAHARFGNKWATIARLLNGRTD  99



>gb|AHB59592.1| putative R2R3 MYB protein 4 [Arachis hypogaea]
Length=316

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            ++SR++MDR+KGPWSPEEDE LQ+LV++HGPRNW+LISK IPGRSGKSCRLRWCNQLSPQ
Sbjct  2    AMSRREMDRIKGPWSPEEDEALQRLVERHGPRNWTLISKYIPGRSGKSCRLRWCNQLSPQ  61

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHR FTP+ED+TIIRAHARFGNKWATIARLL+GRTD
Sbjct  62   VEHRGFTPDEDETIIRAHARFGNKWATIARLLSGRTD  98



>gb|KJB63910.1| hypothetical protein B456_010G023500 [Gossypium raimondii]
Length=273

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS +RKDMDR+KGPWSPEEDE LQ+LVQ +GPRNW+LISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TRKDMDRIKGPWSPEEDEALQRLVQTYGPRNWTLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FTPEEDDTIIRAHAR GNKWATIARLL GRTD
Sbjct  60   PEVEHRPFTPEEDDTIIRAHARVGNKWATIARLLNGRTD  98



>gb|AFK46950.1| unknown [Medicago truncatula]
Length=316

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE LQ+LV+K GPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKRGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEEDDTIIRAHARFGNKWATIARLL+GRTD
Sbjct  61   TPEEDDTIIRAHARFGNKWATIARLLSGRTD  91



>gb|ADL36764.1| MYB domain class transcription factor [Malus domestica]
Length=306

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEED+ LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  61   TPEEDDTIIRAHARFGNKWATIARLLNGRTD  91



>ref|XP_010417080.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=304

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+MDR+KGPWSPEED+LLQ LV+KHGPRNWSLI+KS+PGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMDRIKGPWSPEEDDLLQTLVEKHGPRNWSLITKSVPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT EEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRGFTAEEDDTIIRAHARFGNKWATIARLLNGRTD  99



>ref|XP_006404809.1| hypothetical protein EUTSA_v10000438mg [Eutrema salsugineum]
 gb|ESQ46262.1| hypothetical protein EUTSA_v10000438mg [Eutrema salsugineum]
Length=296

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKETDRIKGPWSPEEDDLLQTLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAF+ EEDDTI+RAHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRAFSAEEDDTILRAHARFGNKWATIARLLNGRTD  99



>ref|XP_010429274.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=306

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+MDR+KGPWSPEED+LLQ LV+KHGPRNWSLISKSIPGR GKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMDRIKGPWSPEEDDLLQTLVEKHGPRNWSLISKSIPGRPGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT EEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRGFTAEEDDTIIRAHARFGNKWATIARLLNGRTD  99



>ref|XP_011097391.1| PREDICTED: transcription factor MYB44 [Sesamum indicum]
Length=385

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 95/100 (95%), Gaps = 2/100 (2%)
 Frame = +2

Query  128  ASIS--RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  301
            A+IS  + D+DR+KGPWSPEED+LLQQLV KHGPRNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  5    ANISGRKMDVDRIKGPWSPEEDDLLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  64

Query  302  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            SPQVEHRAFTPEED+TIIRAHA+FGNKWATIARLL GRTD
Sbjct  65   SPQVEHRAFTPEEDETIIRAHAKFGNKWATIARLLPGRTD  104



>ref|NP_179910.1| myb domain protein 70 [Arabidopsis thaliana]
 gb|AAB87103.1| MYB family transcription factor [Arabidopsis thaliana]
 dbj|BAC41938.1| putative MYB family transcription factor [Arabidopsis thaliana]
 gb|AAP37702.1| At2g23280 [Arabidopsis thaliana]
 gb|AAS10044.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEC07437.1| myb domain protein 70 [Arabidopsis thaliana]
Length=309

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+MDR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMDRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT EEDDTII AHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRGFTAEEDDTIILAHARFGNKWATIARLLNGRTD  99



>ref|XP_010472329.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=309

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+M+R+KGPWSPEED+LLQ LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKEMNRIKGPWSPEEDDLLQTLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT EEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRGFTAEEDDTIIRAHARFGNKWATIARLLNGRTD  99



>gb|KDO84060.1| hypothetical protein CISIN_1g022144mg [Citrus sinensis]
Length=302

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++KD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHR FTPEED+TI+RAHARFGNKWATIARLL+GRTD
Sbjct  60   PQVEHRPFTPEEDETILRAHARFGNKWATIARLLSGRTD  98



>ref|NP_001275798.1| putative R2R3-MYB transcription factor [Citrus sinensis]
 gb|AEK32395.1| putative R2R3-MYB transcription factor [Citrus sinensis]
Length=302

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++KD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHR FTPEED+TI+RAHARFGNKWATIARLL+GRTD
Sbjct  60   PQVEHRPFTPEEDETILRAHARFGNKWATIARLLSGRTD  98



>ref|XP_006434697.1| hypothetical protein CICLE_v10001979mg [Citrus clementina]
 gb|ESR47937.1| hypothetical protein CICLE_v10001979mg [Citrus clementina]
Length=302

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 95/99 (96%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++KD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PQVEHR FTPEED+TI+RAHARFGNKWATIARLL+GRTD
Sbjct  60   PQVEHRPFTPEEDETILRAHARFGNKWATIARLLSGRTD  98



>ref|NP_001238087.1| MYB transcription factor MYB50 [Glycine max]
 gb|ABH02824.1| MYB transcription factor MYB50 [Glycine max]
 gb|KHN12962.1| Transcription factor MYB44 [Glycine soja]
Length=297

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE LQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            T EEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  61   TAEEDDTIIRAHARFGNKWATIARLLHGRTD  91



>gb|EYU25477.1| hypothetical protein MIMGU_mgv1a010338mg [Erythranthe guttata]
Length=315

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +2

Query  140  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  319
            R D DR+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  4    RNDSDRIKGPWSPEEDELLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  63

Query  320  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            RAF+PEED+TI+RAHA+FGNKWATIAR+L GRTD
Sbjct  64   RAFSPEEDETIVRAHAKFGNKWATIARMLCGRTD  97



>dbj|BAC53938.1| Myb-like protein [Nicotiana tabacum]
Length=329

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
            A+  RK+ DR+KGPWSPEEDELLQ LV+KHGPRNWSLISKS+PGRSGKSCRLRWCNQLSP
Sbjct  3    ANTQRKESDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWCNQLSP  62

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHRAFT EED+TIIRAHA+FGNKWATIARLL+GRTD
Sbjct  63   QVEHRAFTSEEDETIIRAHAKFGNKWATIARLLSGRTD  100



>ref|XP_009586849.1| PREDICTED: transcription factor MYB44-like [Nicotiana tomentosiformis]
Length=329

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
            A+  RK+ DR+KGPWSPEEDELLQ LV+KHGPRNWSLISKS+PGRSGKSCRLRWCNQLSP
Sbjct  3    ANTQRKESDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWCNQLSP  62

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHRAFT EED+TIIRAHA+FGNKWATIARLL+GRTD
Sbjct  63   QVEHRAFTSEEDETIIRAHAKFGNKWATIARLLSGRTD  100



>ref|XP_010446682.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=319

 Score =   186 bits (473),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +2

Query  134  ISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQV  313
            ++RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+V
Sbjct  5    MTRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEV  64

Query  314  EHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            EHRAF+ EEDDTIIRAHARFGNKWATI+RLL GRTD
Sbjct  65   EHRAFSQEEDDTIIRAHARFGNKWATISRLLNGRTD  100



>ref|NP_195443.1| myb domain protein 73 [Arabidopsis thaliana]
 emb|CAB16756.1| myb-related protein [Arabidopsis thaliana]
 emb|CAB80392.1| myb-related protein [Arabidopsis thaliana]
 gb|AAL36268.1| putative myb-related protein [Arabidopsis thaliana]
 gb|AAM14206.1| putative myb-related protein [Arabidopsis thaliana]
 gb|AAS10083.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE86774.1| myb domain protein 73 [Arabidopsis thaliana]
Length=320

 Score =   186 bits (473),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M++ +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSNPTRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAF+ EED+TIIRAHARFGNKWATI+RLL GRTD
Sbjct  61   PEVEHRAFSQEEDETIIRAHARFGNKWATISRLLNGRTD  99



>ref|XP_010437245.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=312

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  6    TRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  65

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAF+ EEDDTIIRAHARFGNKWATI+RLL GRTD
Sbjct  66   HRAFSQEEDDTIIRAHARFGNKWATISRLLNGRTD  100



>ref|NP_001235142.1| MYB transcription factor MYB112 [Glycine max]
 gb|ABH02852.1| MYB transcription factor MYB112 [Glycine max]
Length=305

 Score =   186 bits (471),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE LQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            T EEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  61   THEEDDTIIRAHARFGNKWATIARLLHGRTD  91



>ref|XP_010432074.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=322

 Score =   186 bits (472),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  6    TRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  65

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAF+ EEDDTIIRAHARFGNKWATI+RLL GRTD
Sbjct  66   HRAFSQEEDDTIIRAHARFGNKWATISRLLNGRTD  100



>gb|AFS65096.1| sucrose responsive element-binding protein [Elaeis guineensis]
Length=372

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 2/100 (2%)
 Frame = +2

Query  128  ASISR--KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  301
            ASIS   KDMDR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  3    ASISNRGKDMDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  62

Query  302  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            SPQVEHR FT EED+TIIRAH RFGNKWATIARLL+GRTD
Sbjct  63   SPQVEHRPFTAEEDETIIRAHRRFGNKWATIARLLSGRTD  102



>ref|XP_009398678.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            KD+DR+KGPWSPEEDE LQ+LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  11   KDVDRIKGPWSPEEDEALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  70

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTPEED+TIIRAH RFGNKWATIARLL+GRTD
Sbjct  71   PFTPEEDETIIRAHRRFGNKWATIARLLSGRTD  103



>ref|XP_010928389.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=372

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 2/100 (2%)
 Frame = +2

Query  128  ASISR--KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  301
            ASIS   KDMDR+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  3    ASISNRGKDMDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  62

Query  302  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            SPQVEHR FT EED+TIIRAH RFGNKWATIARLL+GRTD
Sbjct  63   SPQVEHRPFTAEEDETIIRAHRRFGNKWATIARLLSGRTD  102



>ref|XP_006294656.1| hypothetical protein CARUB_v10023692mg [Capsella rubella]
 gb|EOA27554.1| hypothetical protein CARUB_v10023692mg [Capsella rubella]
Length=308

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  6    TRKETDRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  65

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HR FT EEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  66   HRGFTAEEDDAIIRAHARFGNKWATIARLLNGRTD  100



>ref|XP_008799576.1| PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]
Length=366

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            KDMDR+KGPWSPEEDE L +LVQKHG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  10   KDMDRIKGPWSPEEDEALHKLVQKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  69

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTPEEDDTIIRAH RFGNKWATIARLL+GRTD
Sbjct  70   PFTPEEDDTIIRAHRRFGNKWATIARLLSGRTD  102



>gb|ABN11121.1| MYB transcription factor [Capsicum annuum]
Length=345

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQ SPQVEHR  
Sbjct  1    MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQSSPQVEHRPL  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEEDDTIIR HARFGNKWATIARLL GRTD
Sbjct  61   TPEEDDTIIRPHARFGNKWATIARLLNGRTD  91



>ref|XP_006286095.1| hypothetical protein CARUB_v10007638mg [Capsella rubella]
 gb|EOA18993.1| hypothetical protein CARUB_v10007638mg [Capsella rubella]
Length=319

 Score =   184 bits (467),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RK+M+R+KGPWSPEED+LLQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  6    TRKNMERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  65

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAF+ EED+TIIRAHARFGNKWATI+RLL GRTD
Sbjct  66   HRAFSQEEDETIIRAHARFGNKWATISRLLNGRTD  100



>ref|XP_002510155.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF52342.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=295

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  131  SISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQ  310
            S +RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+
Sbjct  6    STARKDVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPE  65

Query  311  VEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            VEHR FTPEED+TI+RAH+RFGNKWATIARLL GRTD
Sbjct  66   VEHRPFTPEEDETIMRAHSRFGNKWATIARLLNGRTD  102



>emb|CDP01282.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   184 bits (466),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 95/100 (95%), Gaps = 1/100 (1%)
 Frame = +2

Query  125  MASIS-RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  301
            M +I+ RK+ DR+KGPWSPEEDELLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  1    MGTIAHRKESDRIKGPWSPEEDELLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQL  60

Query  302  SPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            SPQVEHRAFT +ED+ IIRAHA+FGNKWATIARLL+GRTD
Sbjct  61   SPQVEHRAFTADEDEKIIRAHAKFGNKWATIARLLSGRTD  100



>ref|XP_010059753.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW66164.1| hypothetical protein EUGRSUZ_F000021 [Eucalyptus grandis]
Length=339

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  140  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  319
            RKD DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  11   RKDADRIKGPWSPEEDEALQRLVQSYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  70

Query  320  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            R FTPEED+ I+RAHARFGNKWATIARLL GRTD
Sbjct  71   RPFTPEEDEAIVRAHARFGNKWATIARLLNGRTD  104



>gb|KFK30351.1| hypothetical protein AALP_AA7G250300 [Arabis alpina]
Length=309

 Score =   183 bits (464),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+ ++RK+M+R+KGPWSPEED+LLQ LV KHGPRNWSLISKSI GRSGKSCRLRWCNQLS
Sbjct  1    MSGLNRKNMERIKGPWSPEEDDLLQSLVSKHGPRNWSLISKSISGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAF+ EED+TIIRAHARFGNKWATI+RLL GRTD
Sbjct  61   PEVEHRAFSTEEDETIIRAHARFGNKWATISRLLNGRTD  99



>emb|CDX72621.1| BnaC07g46430D [Brassica napus]
Length=265

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+M+R+KGPWSPEED+LLQ+LV+KHGP+NWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MSGPTRKNMERIKGPWSPEEDDLLQKLVEKHGPKNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEED+ I+RAHAR+GNKWAT++RLL+GRTD
Sbjct  61   PEVEHRGFSPEEDEMIVRAHARYGNKWATVSRLLSGRTD  99



>gb|AGN52056.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52166.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=257

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEED+LLQ+LV+KHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDDLLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            T EEDDTII+AHA+FGNKWATIAR L+GRTD
Sbjct  61   TAEEDDTIIKAHAKFGNKWATIARFLSGRTD  91



>emb|CAN81361.1| hypothetical protein VITISV_028904 [Vitis vinifera]
Length=309

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +2

Query  155  RVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTP  334
            R+KGPWSPEEDE LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTP
Sbjct  6    RIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTP  65

Query  335  EEDDTIIRAHARFGNKWATIARLLAGRTD  421
            EED TIIRAHARFGNKWATIARLL GRTD
Sbjct  66   EEDATIIRAHARFGNKWATIARLLVGRTD  94



>ref|XP_007042527.1| Myb domain protein 73, putative [Theobroma cacao]
 gb|EOX98358.1| Myb domain protein 73, putative [Theobroma cacao]
Length=245

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            +D DRVKGPWSPEEDELL++LV + GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  3    QDFDRVKGPWSPEEDELLRKLVLRLGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  62

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            AFTPEED+TI+RAHAR+GNKWATIARLL GRTD
Sbjct  63   AFTPEEDETIVRAHARYGNKWATIARLLNGRTD  95



>ref|XP_008811216.1| PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]
Length=372

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            KDMDR+KGPWSPEEDE LQ+LVQKHG RNWSLISK+IPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  10   KDMDRIKGPWSPEEDESLQKLVQKHGARNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHR  69

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTPEEDD IIRAH RFGNKWATIARLL+GRTD
Sbjct  70   PFTPEEDDAIIRAHRRFGNKWATIARLLSGRTD  102



>ref|XP_011017151.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=305

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS +RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TRKDVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+ EEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSAEEDDAIIRAHARFGNKWATIARLLNGRTD  98



>emb|CDX89554.1| BnaC04g35730D [Brassica napus]
Length=293

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISK I GRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKETDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAF+PEED+TI+ AHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRAFSPEEDETILLAHARFGNKWATIARLLNGRTD  99



>ref|XP_002302428.2| hypothetical protein POPTR_0002s12410g, partial [Populus trichocarpa]
 gb|EEE81701.2| hypothetical protein POPTR_0002s12410g, partial [Populus trichocarpa]
Length=321

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            ++ I RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  18   LSYILRKDVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  77

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+ EEDD IIRAHARFGNKWATIARLL GRTD
Sbjct  78   PEVEHRPFSAEEDDAIIRAHARFGNKWATIARLLNGRTD  116



>ref|XP_006374871.1| hypothetical protein POPTR_0014s02260g [Populus trichocarpa]
 gb|ERP52668.1| hypothetical protein POPTR_0014s02260g [Populus trichocarpa]
Length=311

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS SRKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-SRKDVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+ EEDDTIIRAHAR GNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSAEEDDTIIRAHARIGNKWATIARLLNGRTD  98



>ref|XP_006844027.1| hypothetical protein AMTR_s00006p00225600 [Amborella trichopoda]
 gb|ERN05702.1| hypothetical protein AMTR_s00006p00225600 [Amborella trichopoda]
Length=303

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE L++LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDEQLRKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            T EED+TI+RAHA+FGNKWATIARLL+GRTD
Sbjct  61   TAEEDETIVRAHAQFGNKWATIARLLSGRTD  91



>ref|XP_004291065.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=326

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 2/101 (2%)
 Frame = +2

Query  125  MASISRKDM--DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQ  298
            MAS S K    DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQ
Sbjct  1    MASSSTKKAAADRIKGPWSPEEDEALQRLVQSYGPRNWSLISKSIPGRSGKSCRLRWCNQ  60

Query  299  LSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            LSP+VEHR FTPEEDDTIIRAHARFGNKWATI+RLL GRTD
Sbjct  61   LSPEVEHRPFTPEEDDTIIRAHARFGNKWATISRLLNGRTD  101



>dbj|BAD34048.1| myb-related transcription factor-like [Oryza sativa Japonica 
Group]
 gb|EAZ43731.1| hypothetical protein OsJ_28356 [Oryza sativa Japonica Group]
Length=318

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 92/102 (90%), Gaps = 3/102 (3%)
 Frame = +2

Query  125  MASISRK---DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  295
            MAS  R    D+DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCN
Sbjct  1    MASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCN  60

Query  296  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QLSPQVEHR FTPEEDDTI+RAHARFGNKWATIARLLAGRTD
Sbjct  61   QLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRTD  102



>gb|EAZ08096.1| hypothetical protein OsI_30362 [Oryza sativa Indica Group]
Length=318

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 92/102 (90%), Gaps = 3/102 (3%)
 Frame = +2

Query  125  MASISRK---DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  295
            MAS  R    D+DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCN
Sbjct  1    MASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCN  60

Query  296  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QLSPQVEHR FTPEEDDTI+RAHARFGNKWATIARLLAGRTD
Sbjct  61   QLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRTD  102



>emb|CCU64171.1| ScMYB19 protein [Saccharum hybrid cultivar Co 86032]
Length=215

 Score =   178 bits (451),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  146  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  325
            D+DR+KGPWSPEEDE LQ+LV +HG RNWSLIS+SIPGRSGKSCRLRWCNQLSPQVEHR 
Sbjct  17   DVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHRP  76

Query  326  FTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            FTPEEDDTI+RAHARFGNKWATIARLL+GRTD
Sbjct  77   FTPEEDDTILRAHARFGNKWATIARLLSGRTD  108



>ref|NP_001062562.1| Os09g0106700 [Oryza sativa Japonica Group]
 dbj|BAF24476.1| Os09g0106700 [Oryza sativa Japonica Group]
 dbj|BAG89840.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 92/102 (90%), Gaps = 3/102 (3%)
 Frame = +2

Query  125  MASISRK---DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  295
            MAS  R    D+DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCN
Sbjct  2    MASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCN  61

Query  296  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QLSPQVEHR FTPEEDDTI+RAHARFGNKWATIARLLAGRTD
Sbjct  62   QLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRTD  103



>ref|XP_009392116.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
             D+DR+KGPWSPEED+ LQ+LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  15   NDVDRIKGPWSPEEDDALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  74

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTPEED+TIIRAH RFGNKWATIARLL+GRTD
Sbjct  75   PFTPEEDETIIRAHRRFGNKWATIARLLSGRTD  107



>ref|XP_006660414.1| PREDICTED: transcription factor MYB44-like [Oryza brachyantha]
Length=312

 Score =   181 bits (458),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            +D+DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  12   RDVDRIKGPWSPEEDEALQRLVARHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  71

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTP+EDDTI+RAHARFGNKWATIARLLAGRTD
Sbjct  72   PFTPDEDDTILRAHARFGNKWATIARLLAGRTD  104



>ref|XP_011029247.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=311

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS +RKD+DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TRKDVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+ EEDDTIIRAHAR GNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSAEEDDTIIRAHARIGNKWATIARLLNGRTD  98



>ref|NP_001287808.1| transcription factor MYB44-like [Malus domestica]
 gb|ADL36769.1| MYB domain class transcription factor [Malus domestica]
Length=319

 Score =   181 bits (458),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEALQNLVKNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSPEEDDTIIRAHARFGNKWATIARLLNGRTD  98



>gb|EYU34554.1| hypothetical protein MIMGU_mgv1a011398mg [Erythranthe guttata]
Length=283

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +2

Query  146  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  325
            +MDR+KGPWSPEED+LLQ LVQ+HGPRNW+LIS+SIPGRSGKSCRLRWCNQL P VEHR 
Sbjct  4    NMDRIKGPWSPEEDDLLQSLVQRHGPRNWTLISRSIPGRSGKSCRLRWCNQLCPHVEHRP  63

Query  326  FTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            FTPEEDD IIRAH+RFGNKWATIARLL+GRTD
Sbjct  64   FTPEEDDAIIRAHSRFGNKWATIARLLSGRTD  95



>ref|XP_009354151.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=319

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEALQNLVKTYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSPEEDDTIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_010556427.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=316

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            KD DR+KGPWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  10   KDTDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  69

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  70   PFTAEEDDTIIRAHARFGNKWATIARLLNGRTD  102



>ref|XP_010101670.1| Transcription factor [Morus notabilis]
 gb|EXB89236.1| Transcription factor [Morus notabilis]
Length=303

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RK++DR+KGPWSPEEDE L++LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  4    TRKNLDRIKGPWSPEEDEALRRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  63

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HR F+PEEDDTIIRAHA +GNKWATIARLL GRTD
Sbjct  64   HRPFSPEEDDTIIRAHATYGNKWATIARLLNGRTD  98



>ref|XP_009138487.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
 emb|CDY29542.1| BnaA03g53870D [Brassica napus]
Length=265

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  SRK+M+R+KGPWSPEED+LLQ++V++HGPRNWSLISKSIP RSGKSCRLRWCNQLS
Sbjct  1    MSGPSRKNMERIKGPWSPEEDDLLQKVVEEHGPRNWSLISKSIPARSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+ EED+TI+RAHAR+GNKWATI+RLL+GRTD
Sbjct  61   PEVEHRGFSAEEDETIVRAHARYGNKWATISRLLSGRTD  99



>ref|XP_007160886.1| hypothetical protein PHAVU_001G025200g [Phaseolus vulgaris]
 gb|ESW32880.1| hypothetical protein PHAVU_001G025200g [Phaseolus vulgaris]
Length=276

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS SR DMDRVKGPWSPEEDE LQ+LVQ  GPRNW++ISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MASGSR-DMDRVKGPWSPEEDEALQRLVQALGPRNWTVISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEEDD I+RAH RFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSPEEDDAIVRAHGRFGNKWATIARLLNGRTD  98



>ref|XP_008220277.1| PREDICTED: transcription factor MYB44-like [Prunus mume]
Length=312

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++K  DR+KGPWSPEEDE LQ+LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVADRIKGPWSPEEDEALQKLVKNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+P+EDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSPDEDDTIIRAHARFGNKWATIARLLNGRTD  98



>emb|CDY38933.1| BnaA04g13540D [Brassica napus]
Length=292

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M+  +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISK I GRSGKSCRLRWCNQLS
Sbjct  1    MSGSTRKETDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAF+PEED+ I+ AHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRAFSPEEDEMILLAHARFGNKWATIARLLNGRTD  99



>ref|XP_007227715.1| hypothetical protein PRUPE_ppa008979mg [Prunus persica]
 gb|EMJ28914.1| hypothetical protein PRUPE_ppa008979mg [Prunus persica]
Length=312

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++K  DR+KGPWSPEEDE LQ+LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKLADRIKGPWSPEEDEALQKLVKNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+P+EDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSPDEDDTIIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_008351984.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=317

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEEDDT IRAHARFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSPEEDDTJIRAHARFGNKWATIARLLNGRTD  98



>ref|XP_009360105.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=315

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEELQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSPEEDDTIIRAHARFGNKWATIARLLNGRTD  98



>gb|AAG08960.1|AF122052_1 tuber-specific and sucrose-responsive element binding factor 
[Solanum tuberosum]
Length=306

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +2

Query  155  RVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTP  334
            R+KGPWSPEEDELLQ LV+KHGPRNW+LISKS+P RSGKSCRLRWCNQLSPQVEHRAFTP
Sbjct  1    RIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPRRSGKSCRLRWCNQLSPQVEHRAFTP  60

Query  335  EEDDTIIRAHARFGNKWATIARLLAGRTD  421
            EEDDTIIRAHA++GNKWATIARLL+GRTD
Sbjct  61   EEDDTIIRAHAKYGNKWATIARLLSGRTD  89



>ref|XP_002462029.1| hypothetical protein SORBIDRAFT_02g013010 [Sorghum bicolor]
 gb|EER98550.1| hypothetical protein SORBIDRAFT_02g013010 [Sorghum bicolor]
Length=366

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            ++ D+DR+KGPWSPEEDE LQ+LV +HG RNWSLIS+SIPGRSGKSCRLRWCNQLSPQVE
Sbjct  13   NKADVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVE  72

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HR FTPEEDDTI+RAHARFGNKWATIARLL+GRTD
Sbjct  73   HRPFTPEEDDTILRAHARFGNKWATIARLLSGRTD  107



>ref|XP_009140453.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
Length=292

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            M   +RK+ DR+KGPWSPEED+LLQ LVQKHGPRNWSLISK I GRSGKSCRLRWCNQLS
Sbjct  1    MPGSTRKETDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAF+PEED+ I+ AHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRAFSPEEDEMILLAHARFGNKWATIARLLNGRTD  99



>gb|ADL36765.1| MYB domain class transcription factor [Malus domestica]
Length=317

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS + K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TEKVVDRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEEDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSPEEDDTIIRAHARFGNKWATIARLLNGRTD  98



>gb|KJB59854.1| hypothetical protein B456_009G276400 [Gossypium raimondii]
Length=284

 Score =   177 bits (449),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            +RKD+DR+KGPWSPEEDE L++LVQ +G RNWSL+SKSIPGRSGKSCRLRWCNQLSP VE
Sbjct  4    TRKDIDRIKGPWSPEEDEALKRLVQTYGSRNWSLVSKSIPGRSGKSCRLRWCNQLSPDVE  63

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HR FTPEEDDTI RAH RFGNKWATIAR L GRTD
Sbjct  64   HRPFTPEEDDTIARAHTRFGNKWATIARFLNGRTD  98



>ref|XP_008367655.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=317

 Score =   178 bits (451),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS ++K +DR+KGPWSPEEDE LQ LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MAS-TKKVVDRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR F+PEEDDT+IRAHARFGNKWATIARLL GRTD
Sbjct  60   PEVEHRPFSPEEDDTLIRAHARFGNKWATIARLLNGRTD  98



>dbj|BAJ86460.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   178 bits (452),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            KD+DR+KGPWSPEED+ LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  13   KDVDRIKGPWSPEEDDALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  72

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTP+EDDTI+RAHARFGNKWATIARLL+GRTD
Sbjct  73   PFTPDEDDTILRAHARFGNKWATIARLLSGRTD  105



>ref|XP_009418325.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=365

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            KD+ R+KGPWSPEEDE L++LVQ++GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  9    KDLGRIKGPWSPEEDEALRKLVQRNGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  68

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTPEED+TIIRAH RFGN+WATIARLL+GRTD
Sbjct  69   PFTPEEDETIIRAHRRFGNRWATIARLLSGRTD  101



>ref|NP_001151336.1| sucrose responsive element binding protein [Zea mays]
 gb|ACG42418.1| sucrose responsive element binding protein [Zea mays]
 tpg|DAA60650.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=345

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
             S  + D+DR+KGPWSPEEDE LQ+LV +HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP
Sbjct  10   GSGGKSDVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSP  69

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHR FT EEDDTI+RAHARFGNKWATIARLL+GRTD
Sbjct  70   QVEHRPFTAEEDDTILRAHARFGNKWATIARLLSGRTD  107



>gb|AHB59591.1| putative R2R3 MYB protein 3 [Arachis hypogaea]
Length=253

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDRVKGPWSPEEDE L++LV  HGPRNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRAF
Sbjct  1    MDRVKGPWSPEEDETLRRLVGAHGPRNWTIISKSIPGRSGKSCRLRWCNQLSPEVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEEDD I+RAHA FGNKWATIARLL GRTD
Sbjct  61   TPEEDDIIVRAHAEFGNKWATIARLLNGRTD  91



>gb|ADX60118.1| MYB-RELATED transcription factor [Zea mays]
Length=347

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
             S  + D+DR+KGPWSPEEDE LQ+LV +HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP
Sbjct  10   GSGGKSDVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSP  69

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHR FT EEDDTI+RAHARFGNKWATIARLL+GRTD
Sbjct  70   QVEHRPFTAEEDDTILRAHARFGNKWATIARLLSGRTD  107



>gb|AFV73403.1| R2R3-MYB transcription factor [Jatropha curcas]
Length=313

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MAS +RKD+   K PWSPEEDE LQ+LVQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MASAARKDVIGSKVPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  60

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT +EDDTIIRAHARFGNKWATIARLL GRTD
Sbjct  61   PEVEHRPFTADEDDTIIRAHARFGNKWATIARLLNGRTD  99



>ref|XP_008462845.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=301

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K +DR+KGPWSPEED+ LQ+LV K+GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  3    KQIDRIKGPWSPEEDDALQRLVHKYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  62

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            AFTPEED+TII A A +GNKWATIARLL+GRTD
Sbjct  63   AFTPEEDETIINAQALYGNKWATIARLLSGRTD  95



>ref|XP_007136715.1| hypothetical protein PHAVU_009G068000g [Phaseolus vulgaris]
 gb|ESW08709.1| hypothetical protein PHAVU_009G068000g [Phaseolus vulgaris]
Length=262

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            S KDMDR+KGPWSPEEDE L++ VQ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  3    SAKDMDRIKGPWSPEEDEALRRFVQIYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  62

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HR FT +ED+TI++AHARFGNKWATIAR L GRTD
Sbjct  63   HRPFTAKEDETIVKAHARFGNKWATIARFLNGRTD  97



>gb|ADN33728.1| MYB transcription factor [Cucumis melo subsp. melo]
Length=211

 Score =   173 bits (438),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K++DR+KGPWSPEEDE L++LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  6    KNVDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  65

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EEDD IIRAHA+FGNKWATIARLL GRTD
Sbjct  66   PFTAEEDDAIIRAHAKFGNKWATIARLLNGRTD  98



>gb|ABV02031.1| sucrose responsive element binding factor 1 [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=282

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K+  R+KGPW+PEEDELLQ+LV++HGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  5    KETGRIKGPWNPEEDELLQRLVEEHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHR  64

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EED+TI++AHA+FGNKWATIARLL+GRTD
Sbjct  65   PFTAEEDETILKAHAKFGNKWATIARLLSGRTD  97



>ref|XP_009415461.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            SRKD+DR+ GPWS EEDE LQ LVQ+HGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE
Sbjct  3    SRKDVDRITGPWSQEEDEALQSLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  62

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HR FT EED+ I+RAH RFGNKWATIARLL+GRTD
Sbjct  63   HRHFTAEEDEIIVRAHRRFGNKWATIARLLSGRTD  97



>gb|ABR28330.1| MYB transcription factor MYB8 [Medicago truncatula]
Length=269

 Score =   174 bits (441),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE L +LV ++GPRNWSLIS++IPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            +PEED+ IIRAHA+FGNKWATIARLL+GRTD
Sbjct  61   SPEEDNIIIRAHAQFGNKWATIARLLSGRTD  91



>gb|KEH31491.1| myb transcription factor [Medicago truncatula]
Length=271

 Score =   174 bits (441),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE L +LV ++GPRNWSLIS++IPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPWSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            +PEED+ IIRAHA+FGNKWATIARLL+GRTD
Sbjct  61   SPEEDNIIIRAHAQFGNKWATIARLLSGRTD  91



>gb|AGL76985.1| MYB transcription factor [Cucumis melo]
Length=294

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K++DR+KGPWSPEEDE L++LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  6    KNVDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  65

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EEDD IIRAHA+FGNKWATIARLL GRTD
Sbjct  66   PFTAEEDDAIIRAHAKFGNKWATIARLLNGRTD  98



>ref|XP_008444592.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=296

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K++DR+KGPWSPEEDE L++LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  6    KNVDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  65

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EEDD IIRAHA+FGNKWATIARLL GRTD
Sbjct  66   PFTAEEDDAIIRAHAKFGNKWATIARLLNGRTD  98



>ref|XP_009418521.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=339

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K MDR+KGPWS EEDE L++LV++HGPRNW+LIS+SIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  14   KGMDRIKGPWSIEEDEALRRLVERHGPRNWTLISRSIPGRSGKSCRLRWCNQLSPQVEHR  73

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTPEED+TIIRAH RFGNKWATIARLL+GRTD
Sbjct  74   PFTPEEDETIIRAHRRFGNKWATIARLLSGRTD  106



>ref|XP_009385523.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
            +S S KD+DR+KGPWSP+ED  LQ+LVQ+HGPRNWS ISKSIPGRSGKSCRLRWCNQLSP
Sbjct  15   SSSSSKDVDRIKGPWSPDEDAALQRLVQRHGPRNWSPISKSIPGRSGKSCRLRWCNQLSP  74

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHR FT EED+ IIRAH RFGNKWATIARLL+GRTD
Sbjct  75   QVEHRPFTAEEDEIIIRAHRRFGNKWATIARLLSGRTD  112



>ref|XP_004142878.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004156374.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN62477.1| hypothetical protein Csa_2G355030 [Cucumis sativus]
Length=290

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K++DR+KGPWSPEEDE L++LV+ +GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  6    KNVDRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  65

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             F+ EEDD IIRAHA+FGNKWATIARLL GRTD
Sbjct  66   PFSAEEDDAIIRAHAKFGNKWATIARLLNGRTD  98



>gb|KJB58575.1| hypothetical protein B456_009G215900 [Gossypium raimondii]
Length=293

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  134  ISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQV  313
            I  KD+DR+KGPWSP EDE LQ+LV  +GP+NWSLISKSIPGRSGKSCRLRWCNQLSP+V
Sbjct  22   IYVKDLDRIKGPWSPGEDEALQRLVHTYGPKNWSLISKSIPGRSGKSCRLRWCNQLSPEV  81

Query  314  EHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            +HR FTPEEDDTII+AHA+FGNKWA IARLL GRTD
Sbjct  82   QHRPFTPEEDDTIIQAHAQFGNKWAIIARLLNGRTD  117



>ref|XP_009587267.1| PREDICTED: transcription factor MYB44-like [Nicotiana tomentosiformis]
Length=269

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K+  R+KGPWSPEEDELLQ+LV++HGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  5    KETGRIKGPWSPEEDELLQRLVEEHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHR  64

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EED+TI++AHA+ GNKWATIAR L+GRTD
Sbjct  65   PFTAEEDETILKAHAKLGNKWATIARFLSGRTD  97



>ref|NP_001183628.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACR37800.1| unknown [Zea mays]
 tpg|DAA39569.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04986.1| MYB transcription factor, partial [Zea mays]
Length=285

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            +DR+KGPWSPEEDE LQ+LV++HG RNWSLIS+S+PGRSGKSCRLRWCNQLSP+VEHR F
Sbjct  17   VDRIKGPWSPEEDEALQRLVRRHGARNWSLISRSVPGRSGKSCRLRWCNQLSPRVEHRPF  76

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TP+EDD I+RAHARFGNKWATIARLL+GRTD
Sbjct  77   TPDEDDAILRAHARFGNKWATIARLLSGRTD  107



>ref|XP_010558924.1| PREDICTED: transcription factor MYB44-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558931.1| PREDICTED: transcription factor MYB44-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010558937.1| PREDICTED: transcription factor MYB44-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010558944.1| PREDICTED: transcription factor MYB44-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010558950.1| PREDICTED: transcription factor MYB44-like isoform X5 [Tarenaya 
hassleriana]
Length=311

 Score =   173 bits (438),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEED+ L++LV K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSPQVEHR FT
Sbjct  3    DRIKGPWSPEEDDQLRRLVVKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPQVEHRPFT  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEEDDTI+RAHA+FGNKWATIARLL GRTD
Sbjct  63   PEEDDTILRAHAQFGNKWATIARLLNGRTD  92



>ref|XP_008236375.1| PREDICTED: transcription factor MYB44-like [Prunus mume]
Length=302

 Score =   172 bits (436),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  116  VLEMASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  295
             ++ ++ +++++DRVKGPWSP+EDE L+QLVQ HG RNWSLISKS+PGRSGKSCRLRWCN
Sbjct  7    AMDSSAQAQRELDRVKGPWSPDEDEKLRQLVQHHGARNWSLISKSVPGRSGKSCRLRWCN  66

Query  296  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QLSP+VEHRAFTPEED+ I  AHA++GNKWATIARLL GRTD
Sbjct  67   QLSPEVEHRAFTPEEDEIIAGAHAKYGNKWATIARLLNGRTD  108



>ref|XP_007199299.1| hypothetical protein PRUPE_ppa023154mg [Prunus persica]
 gb|EMJ00498.1| hypothetical protein PRUPE_ppa023154mg [Prunus persica]
Length=292

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            S++++DRVKGPWSP+EDE L+QLVQ HG RNWSLISKS+PGRSGKSCRLRWCNQLSP+VE
Sbjct  4    SQRELDRVKGPWSPDEDEKLRQLVQHHGARNWSLISKSVPGRSGKSCRLRWCNQLSPEVE  63

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HRAFTPEED+ I  AHA++GNKWATIARLL GRTD
Sbjct  64   HRAFTPEEDEIIAGAHAKYGNKWATIARLLNGRTD  98



>ref|XP_009395856.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=364

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K+ DR+KGPWSP EDE LQ+LVQ+HGPRNWS+ISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  14   KEADRIKGPWSPAEDEALQRLVQRHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHR  73

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EED+ I+RAH RFGNKWATIARLL+GRTD
Sbjct  74   PFTDEEDEIIVRAHRRFGNKWATIARLLSGRTD  106



>gb|AHN50422.1| R2R3-type MYB transcription factor [Salicornia brachiata]
Length=269

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            ++S   K  DR+KGPWSPEED+LL++LV KHG RNWS ISKSIPGRSGKSCRLRWCNQLS
Sbjct  7    LSSSRLKAADRIKGPWSPEEDDLLKKLVDKHGARNWSEISKSIPGRSGKSCRLRWCNQLS  66

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHRAF PEED+ I++AHARFGNKWATIARLL GRTD
Sbjct  67   PEVEHRAFLPEEDEIIVKAHARFGNKWATIARLLNGRTD  105



>ref|XP_004305954.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=270

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  119  LEMASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQ  298
            ++  S+ ++++DRVKGPWSPEED+LL++LVQ+HG RNW+LISKSIPGRSGKSCRLRWCNQ
Sbjct  1    MDCESVQQRELDRVKGPWSPEEDDLLRKLVQRHGARNWTLISKSIPGRSGKSCRLRWCNQ  60

Query  299  LSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            LSP+VEHRAFT EED+ I  AH+++GNKWATIARLL GRTD
Sbjct  61   LSPEVEHRAFTAEEDEIIAAAHSKYGNKWATIARLLNGRTD  101



>ref|XP_010057256.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW74299.1| hypothetical protein EUGRSUZ_E02958 [Eucalyptus grandis]
Length=296

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            SR+D DRVKGPWSP+ED+LL++LVQ+HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP VE
Sbjct  10   SRRDADRVKGPWSPDEDDLLRKLVQRHGARNWSLISRSIPGRSGKSCRLRWCNQLSPGVE  69

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HR FT EEDD I+RAHA++GN+WATIARLL+GRTD
Sbjct  70   HRPFTAEEDDLIVRAHAKYGNRWATIARLLSGRTD  104



>ref|XP_003575562.1| PREDICTED: transcription factor MYB44-like [Brachypodium distachyon]
Length=336

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            KD DR+KGPWSPEEDE LQ+LV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  18   KDADRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  77

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT +ED+ I+RAHARFGNKWATIARLL GRTD
Sbjct  78   PFTADEDEAILRAHARFGNKWATIARLLNGRTD  110



>ref|XP_004151866.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004156766.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN63306.1| hypothetical protein Csa_2G427310 [Cucumis sativus]
Length=301

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K  DR+KGPWSPEED+ LQ+LV K+GPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  3    KQTDRIKGPWSPEEDDALQRLVHKYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  62

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            AFTP+ED+ II A A +GNKWATIARLL+GRTD
Sbjct  63   AFTPDEDEAIINAQALYGNKWATIARLLSGRTD  95



>gb|AFK48638.1| unknown [Medicago truncatula]
Length=253

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGP SPEEDE L +LV ++GPRNWSLIS++IPGRSGKSCRLRWCNQLSPQVEHRAF
Sbjct  1    MDRIKGPRSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWCNQLSPQVEHRAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            +PEED+ IIRAHA+FGNKWATIARLL+GRTD
Sbjct  61   SPEEDNIIIRAHAQFGNKWATIARLLSGRTD  91



>ref|XP_008373085.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=302

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +2

Query  116  VLEMASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCN  295
             +E +++ ++++DRVKGPWSP+EDE L+Q+VQ++G RNWS+ISKS+PGRSGKSCRLRWCN
Sbjct  8    AMESSAMVQRELDRVKGPWSPDEDEKLRQIVQRYGARNWSVISKSVPGRSGKSCRLRWCN  67

Query  296  QLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QLSP+VEHRAFTPEED+ I  AHA++GNKWATIARLL GRTD
Sbjct  68   QLSPEVEHRAFTPEEDEIIAGAHAKYGNKWATIARLLNGRTD  109



>ref|XP_004141275.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN55237.1| hypothetical protein Csa_4G641690 [Cucumis sativus]
Length=263

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 4/99 (4%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MA+I+    DR+KGPWSP+EDELL++LV  +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MATIT----DRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  56

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT +EDDTII+AH+RFGNKWATIARLL GRTD
Sbjct  57   PEVEHRPFTSDEDDTIIQAHSRFGNKWATIARLLNGRTD  95



>gb|KDP45901.1| hypothetical protein JCGZ_15461 [Jatropha curcas]
 gb|AIT52203.1| MYB family protein [Jatropha curcas]
Length=267

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            +DRVKGPWSPEED+LLQ+ VQ+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR F
Sbjct  7    IDRVKGPWSPEEDQLLQKFVQRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  66

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEED+ II AHA+ GNKWATIARLL GRTD
Sbjct  67   TPEEDEIIINAHAKQGNKWATIARLLNGRTD  97



>ref|XP_004163238.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44-like 
[Cucumis sativus]
Length=262

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 4/99 (4%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MA+I+    DR+KGPWSP+EDELL++LV  +GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  1    MATIT----DRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSIPGRSGKSCRLRWCNQLS  56

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+VEHR FT +EDDTII+AH+RFGNKWATIARLL GRTD
Sbjct  57   PEVEHRPFTSDEDDTIIQAHSRFGNKWATIARLLNGRTD  95



>ref|XP_011088207.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=286

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDELL++LVQ+HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP+VEHRAFT
Sbjct  9    DRIKGPWSPEEDELLRKLVQRHGARNWSLISRSIPGRSGKSCRLRWCNQLSPEVEHRAFT  68

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             +ED+ I++AHA+FGNKWATIARLL GRTD
Sbjct  69   ADEDEIILKAHAQFGNKWATIARLLNGRTD  98



>gb|KJB77654.1| hypothetical protein B456_012G149000 [Gossypium raimondii]
Length=246

 Score =   169 bits (427),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            +D+DRVKGPWSPEEDELL++LV +HG RNWSL+S+SIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  3    RDVDRVKGPWSPEEDELLRKLVHRHGARNWSLVSRSIPGRSGKSCRLRWCNQLSPEVEHR  62

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EED  I++AHA++GNKWATIARLL GRTD
Sbjct  63   PFTSEEDGVIVKAHAKYGNKWATIARLLNGRTD  95



>ref|XP_008452606.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=269

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSP+EDELL++LV  +GPRNWSLISKSI GRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  5    DRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSISGRSGKSCRLRWCNQLSPEVEHRPFT  64

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+EDDTII+AH+RFGNKWATIARLL GRTD
Sbjct  65   PDEDDTIIQAHSRFGNKWATIARLLNGRTD  94



>gb|KDO59816.1| hypothetical protein CISIN_1g040502mg [Citrus sinensis]
Length=252

 Score =   168 bits (426),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            +RVKGPWSPEED+LL +LVQ++G RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  8    ERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRTFT  67

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+ED+ II+AHAR+GNKWATIARLL GRTD
Sbjct  68   PDEDEIIIKAHARYGNKWATIARLLNGRTD  97



>ref|XP_006422932.1| hypothetical protein CICLE_v10029124mg [Citrus clementina]
 gb|ESR36172.1| hypothetical protein CICLE_v10029124mg [Citrus clementina]
Length=252

 Score =   168 bits (426),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            +RVKGPWSPEED+LL +LVQ++G RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  8    ERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRTFT  67

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+ED+ II+AHAR+GNKWATIARLL GRTD
Sbjct  68   PDEDEIIIKAHARYGNKWATIARLLNGRTD  97



>ref|XP_006487005.1| PREDICTED: transcription factor MYB44-like [Citrus sinensis]
Length=252

 Score =   168 bits (426),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            +RVKGPWSPEED+LL +LVQ++G RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  8    ERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRTFT  67

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+ED+ II+AHAR+GNKWATIARLL GRTD
Sbjct  68   PDEDEIIIKAHARYGNKWATIARLLNGRTD  97



>ref|NP_001237693.1| MYB transcription factor MYB70 [Glycine max]
 gb|ABH02833.1| MYB transcription factor MYB70 [Glycine max]
Length=268

 Score =   169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 1/92 (1%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDRVKGPWSPEEDE L++LVQ HGPRNWS+ISKS+PGRSGKSCRLRWCNQLSPQV HR F
Sbjct  1    MDRVKGPWSPEEDEALRRLVQAHGPRNWSVISKSVPGRSGKSCRLRWCNQLSPQVAHRPF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLL-AGRTD  421
            +P+ED+ I+RAHARFGNKWATIARLL  GRTD
Sbjct  61   SPDEDEAIVRAHARFGNKWATIARLLNNGRTD  92



>gb|AFH03055.1| R2R3-MYB transcription factor MYB3 [Epimedium sagittatum]
Length=308

 Score =   170 bits (430),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  158  VKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPE  337
            +KGPWSPEED+LLQ+LVQ HG RNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT E
Sbjct  22   IKGPWSPEEDDLLQKLVQTHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTAE  81

Query  338  EDDTIIRAHARFGNKWATIARLLAGRTD  421
            ED+TII+AH +FGNKWATIARLL GRTD
Sbjct  82   EDETIIKAHEKFGNKWATIARLLNGRTD  109



>gb|EYU36318.1| hypothetical protein MIMGU_mgv1a022221mg, partial [Erythranthe 
guttata]
Length=288

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSP+ED+LLQ+LV+KHGPRNWSLISKSI GRSGKSCRLRWCNQLSPQVEHR FT
Sbjct  3    DRIKGPWSPDEDDLLQRLVEKHGPRNWSLISKSILGRSGKSCRLRWCNQLSPQVEHRPFT  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P+EDD II AH ++GNKWATIAR L+GRTD
Sbjct  63   PQEDDAIIEAHFKYGNKWATIARFLSGRTD  92



>gb|KJB32313.1| hypothetical protein B456_005G234900 [Gossypium raimondii]
Length=236

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            +D+DRVKGPW PEEDE L++LVQ HGPRNWSLIS+SIPGRSGKSCRLRWCNQLSP+V HR
Sbjct  3    QDIDRVKGPWGPEEDESLRKLVQLHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPEVAHR  62

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EED+ II+AHA+FGNKWATIARLL GRTD
Sbjct  63   PFTAEEDEIIIKAHAKFGNKWATIARLLNGRTD  95



>ref|XP_011001142.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=243

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +2

Query  146  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  325
            D +RVKGPWSPEED+LL+ LV KHGPRNW++I++++PGRSGKSCRLRWCNQLSP+VEHRA
Sbjct  2    DNNRVKGPWSPEEDDLLKHLVIKHGPRNWTMIARAVPGRSGKSCRLRWCNQLSPEVEHRA  61

Query  326  FTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            FT EED+ II AHA++GNKWATIARLL GRTD
Sbjct  62   FTREEDEIIINAHAKYGNKWATIARLLDGRTD  93



>ref|XP_002313145.1| hypothetical protein POPTR_0009s09890g [Populus trichocarpa]
 gb|EEE87100.1| hypothetical protein POPTR_0009s09890g [Populus trichocarpa]
Length=245

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +2

Query  146  DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  325
            D +RVKGPWSPEED+LL+ LV KHGPRNW++I++++PGRSGKSCRLRWCNQLSP+VEHRA
Sbjct  2    DNNRVKGPWSPEEDDLLKHLVIKHGPRNWTMIARAVPGRSGKSCRLRWCNQLSPEVEHRA  61

Query  326  FTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            FT EED+ II AHA++GNKWATIARLL GRTD
Sbjct  62   FTREEDEIIINAHAKYGNKWATIARLLDGRTD  93



>ref|XP_010691674.1| PREDICTED: transcription factor MYB44-like [Beta vulgaris subsp. 
vulgaris]
Length=264

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDELLQ+LVQKHG RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  15   DRIKGPWSPEEDELLQKLVQKHGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  74

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+ I+RAHA+ GNKWATI+RLL GRTD
Sbjct  75   TEEDEIIVRAHAQHGNKWATISRLLNGRTD  104



>ref|XP_010547530.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=315

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEED+ L++LV K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSPQVEHR FT
Sbjct  3    DRIKGPWSPEEDDQLRRLVDKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPQVEHRPFT  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TIIRAHA+FGNKWATIARLL GRTD
Sbjct  63   TEEDETIIRAHAQFGNKWATIARLLNGRTD  92



>gb|ABD60291.2| R2R3-MYB transcription factor MYB6 [Picea glauca]
Length=252

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEED  LQ  VQK GPRNWSLISK+IPGRSGKSCRLRWCNQLSPQVEHR FT
Sbjct  4    DRIKGPWSPEEDAALQHFVQKCGPRNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHRPFT  63

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED TIIRAHA+ GNKWATIAR+L+GRTD
Sbjct  64   PEEDATIIRAHAQHGNKWATIARVLSGRTD  93



>gb|ADL36760.1| MYB domain class transcription factor [Malus domestica]
Length=289

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  140  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  319
            ++++DRVKGPWSP+EDE L+Q+VQ++G RNWS+ISKS+PGRSGKSCRLRWCNQLSP+VEH
Sbjct  3    QRELDRVKGPWSPDEDEKLRQIVQRYGARNWSVISKSVPGRSGKSCRLRWCNQLSPEVEH  62

Query  320  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            RAFTPEED+ I  AHA++GNKWATIARLL GRTD
Sbjct  63   RAFTPEEDEIIAGAHAKYGNKWATIARLLNGRTD  96



>ref|XP_002518677.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF43602.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=245

 Score =   166 bits (421),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  137  SRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  316
            S    DRVKGPWSPEED LL++LVQ+HG RNW+LISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  3    SESAFDRVKGPWSPEEDLLLKKLVQRHGARNWTLISKSIPGRSGKSCRLRWCNQLSPEVE  62

Query  317  HRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            HR F PEED+ I+ AH+RFGNKWA IARLL GRTD
Sbjct  63   HRPFAPEEDEIIVDAHSRFGNKWAAIARLLNGRTD  97



>emb|CDY01420.1| BnaA07g11930D [Brassica napus]
Length=263

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|XP_009394543.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=309

 Score =   168 bits (425),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR KG WS EEDE L++LV++HGPRNW+LI +SIPGRSGKSCRLRWCNQLSPQVEHR F
Sbjct  1    MDRTKGSWSTEEDEALRRLVERHGPRNWTLIGRSIPGRSGKSCRLRWCNQLSPQVEHRPF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEED+TIIRAH RFGNKWATIARLL+GRTD
Sbjct  61   TPEEDETIIRAHRRFGNKWATIARLLSGRTD  91



>gb|EPS70032.1| myb-like protein, partial [Genlisea aurea]
Length=147

 Score =   163 bits (412),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  125  MASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  304
            MA+   +  +R KGPWSPEED LL++LV+K GPRNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  4    MAARKEESSERAKGPWSPEEDGLLRRLVEKQGPRNWSLISKSIPGRSGKSCRLRWCNQLS  63

Query  305  PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P VEHRAFT EED TIIRAH   GNKWA IARLL+GRTD
Sbjct  64   PAVEHRAFTAEEDATIIRAHGELGNKWAAIARLLSGRTD  102



>gb|KJB12279.1| hypothetical protein B456_002G009300 [Gossypium raimondii]
Length=252

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            +D+DRV+GPWSPEEDELL++LVQ++GPRNW++IS SIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  3    QDIDRVRGPWSPEEDELLRKLVQRYGPRNWTVISTSIPGRSGKSCRLRWCNQLSPEVEHR  62

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            AFT EED  I +AHA +GNKWATIARLL GRTD
Sbjct  63   AFTAEEDRIIRKAHALYGNKWATIARLLNGRTD  95



>emb|CDY12830.1| BnaC07g16030D [Brassica napus]
Length=253

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|XP_009103434.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
Length=296

 Score =   167 bits (423),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>gb|AHN60125.1| MYB transcription factor 44 [Brassica napus]
Length=300

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|XP_009396365.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=375

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            K+  R+KGPWSPEED  LQ+LVQ+HGPRNWSLIS+SIPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  11   KEAARIKGPWSPEEDTSLQRLVQRHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHR  70

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT EED+ IIRAH RFGNKWATIAR+L+GRTD
Sbjct  71   PFTAEEDEIIIRAHRRFGNKWATIARILSGRTD  103



>ref|NP_001235715.1| MYB transcription factor MYB68 [Glycine max]
 gb|ABH02831.1| MYB transcription factor MYB68 [Glycine max]
Length=259

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE L++LVQ +GPRNWS+ISKSIPGRSGKSCRLRWCNQLSP+VE R F
Sbjct  1    MDRIKGPWSPEEDEALRRLVQTYGPRNWSVISKSIPGRSGKSCRLRWCNQLSPEVERRPF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            T EED+ I++AHARFGNKWATIAR L GRTD
Sbjct  61   TAEEDEAILKAHARFGNKWATIARFLNGRTD  91



>ref|XP_010484518.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=309

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR+F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRSFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   TEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|XP_006279745.1| hypothetical protein CARUB_v10027659mg [Capsella rubella]
 gb|EOA12643.1| hypothetical protein CARUB_v10027659mg [Capsella rubella]
Length=300

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|XP_006393928.1| hypothetical protein EUTSA_v10004676mg [Eutrema salsugineum]
 gb|ESQ31214.1| hypothetical protein EUTSA_v10004676mg [Eutrema salsugineum]
Length=301

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   SEEDETIARAHAQFGNKWATIARLLNGRTD  92



>gb|KFK28404.1| hypothetical protein AALP_AA8G510400 [Arabis alpina]
Length=309

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|XP_002866710.1| AtMYB44/AtMYBr1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42969.1| AtMYB44/AtMYBr1 [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>emb|CAA90809.1| MYB-related protein [Arabidopsis thaliana]
Length=305

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>gb|AAM64847.1| myb-related protein, 33.3K [Arabidopsis thaliana]
Length=305

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|NP_001237709.1| MYB transcription factor MYB81 [Glycine max]
 gb|ABH02837.1| MYB transcription factor MYB81 [Glycine max]
Length=273

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            ++MDRVKGPWSPEEDE L+ LVQ HGPRNWS+ISKSIPGR  KSCRLRWCNQLSPQV HR
Sbjct  9    REMDRVKGPWSPEEDEALRALVQAHGPRNWSVISKSIPGRFRKSCRLRWCNQLSPQVAHR  68

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             F+ EED+ II AHA+FGNKWATIARLL GRTD
Sbjct  69   PFSQEEDEAIIMAHAKFGNKWATIARLLNGRTD  101



>ref|NP_201531.1| transcription factor MYB44 [Arabidopsis thaliana]
 sp|Q9FDW1.1|MYB44_ARATH RecName: Full=Transcription factor MYB44; AltName: Full=Myb-related 
protein 44; Short=AtMYB44; AltName: Full=Myb-related 
protein R1; Short=AtMYBR1 [Arabidopsis thaliana]
 gb|AAG41459.1|AF326877_1 putative myb-related protein, 33.3K [Arabidopsis thaliana]
 gb|AAK00380.1|AF339698_1 putative myb-related protein, 33.3K [Arabidopsis thaliana]
 dbj|BAB09015.1| myb-related protein, 33.3K [Arabidopsis thaliana]
 gb|AAS10118.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED98326.1| transcription factor MYB44 [Arabidopsis thaliana]
 dbj|BAP16463.1| myb-related protein, 33.3K [Cloning vector pTACAtg1]
Length=305

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>gb|AAK96490.1| AT5g67300/K8K14_2 [Arabidopsis thaliana]
 gb|AAL31250.1| AT5g67300/K8K14_2 [Arabidopsis thaliana]
Length=305

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|XP_010464243.1| PREDICTED: transcription factor MYB44 [Camelina sativa]
Length=309

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|XP_010444669.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=310

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEEDE L++LV K+GPRNW++ISKSIPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  3    DRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI RAHA+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIARAHAQFGNKWATIARLLNGRTD  92



>ref|XP_010550347.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=305

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            +DR+KGPWS EEDE L++LV+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F
Sbjct  2    VDRIKGPWSVEEDEQLRRLVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            T EED+TI+RAH +FGNKWATIARLL GRTD
Sbjct  62   TAEEDETIVRAHTQFGNKWATIARLLNGRTD  92



>ref|XP_006404067.1| hypothetical protein EUTSA_v10010581mg [Eutrema salsugineum]
 gb|ESQ45520.1| hypothetical protein EUTSA_v10010581mg [Eutrema salsugineum]
Length=300

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRKMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTD  92



>ref|XP_002877726.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53985.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=285

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVTARAKFGNKWATIARLLNGRTD  92



>ref|XP_001753593.1| predicted protein [Physcomitrella patens]
 gb|EDQ81816.1| predicted protein, partial [Physcomitrella patens]
Length=117

 Score =   158 bits (400),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            +++DR+KGPWSPEED  LQQLV K+GPRNWSLI K IPGRSGKSCRLRWCNQLSPQV+HR
Sbjct  11   EEVDRIKGPWSPEEDSALQQLVDKYGPRNWSLIGKGIPGRSGKSCRLRWCNQLSPQVQHR  70

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT  ED+TII AH++ GNKWATIARLL GRTD
Sbjct  71   PFTTVEDETIIAAHSQHGNKWATIARLLPGRTD  103



>gb|ABD60281.1| R2R3-MYB transcription factor MYB7 [Pinus taeda]
Length=374

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            +D+DR+KGPWSPEED  LQ+LVQK+GPRNW+LISK IPGRSGKSCRLRWCNQLSPQVEHR
Sbjct  10   EDLDRIKGPWSPEEDASLQRLVQKYGPRNWTLISKGIPGRSGKSCRLRWCNQLSPQVEHR  69

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FTP ED  I++AHA+ GNKWATIAR L GRTD
Sbjct  70   PFTPSEDAAILQAHAQHGNKWATIARALPGRTD  102



>ref|XP_010096284.1| Transcription factor [Morus notabilis]
 gb|EXB63679.1| Transcription factor [Morus notabilis]
Length=299

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            D+VKGPWS EEDELLQ LVQ++GPRNWS+IS+SIPGRSGKSCRLRWCNQLSP+V+HR F+
Sbjct  8    DKVKGPWSHEEDELLQSLVQRYGPRNWSIISRSIPGRSGKSCRLRWCNQLSPEVQHRPFS  67

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EEDD I+ AHA++GNKWATIARLL GRTD
Sbjct  68   AEEDDIIVHAHAKYGNKWATIARLLNGRTD  97



>gb|AHN60131.1| MYB transcription factor 77 [Brassica napus]
Length=265

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTD  92



>gb|ABL97967.1| R2R3-MYB transcription factor [Brassica rapa]
Length=266

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTD  92



>emb|CDY57355.1| BnaC08g48630D [Brassica napus]
Length=278

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTD  92



>gb|ABQ51222.1| R2R3-MYB transcription factor MYB6 [Picea glauca]
Length=350

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DR+KGPWSPEED  LQ  VQK  PRNWSLISK+IPGRSGKSCRLRWCNQLSPQVEHR FT
Sbjct  12   DRIKGPWSPEEDAALQHFVQKCWPRNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHRPFT  71

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED TIIRAHA+ GNKWATIAR+L+GRTD
Sbjct  72   PEEDATIIRAHAQHGNKWATIARMLSGRTD  101



>ref|XP_010092183.1| Transcription factor [Morus notabilis]
 gb|EXB50409.1| Transcription factor [Morus notabilis]
Length=310

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            D+VKGPWS EEDELLQ LVQ++GPRNWS+IS+SIPGRSGKSCRLRWCNQLSP+V+HR F+
Sbjct  8    DKVKGPWSHEEDELLQSLVQRYGPRNWSIISRSIPGRSGKSCRLRWCNQLSPEVQHRPFS  67

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EEDD I+ AHA++GNKWATIARLL GRTD
Sbjct  68   AEEDDIIVHAHAKYGNKWATIARLLNGRTD  97



>ref|XP_002285389.1| PREDICTED: transcription factor MYB44 [Vitis vinifera]
Length=303

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +2

Query  140  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  319
            + + DRVKGPWSP+ED+ LQ LV+++G RNWSLIS+SIPGRSGKSCRLRWCNQLSPQVEH
Sbjct  5    QNEADRVKGPWSPQEDQALQCLVKRYGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVEH  64

Query  320  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            R FTPEED  II AHA++GNKWATIAR+L GRTD
Sbjct  65   RPFTPEEDRRIIEAHAKYGNKWATIARMLNGRTD  98



>ref|NP_190575.1| myb domain protein 77 [Arabidopsis thaliana]
 gb|AAL11582.1|AF424588_1 AT3g50060/F3A4_140 [Arabidopsis thaliana]
 emb|CAB62114.1| R2R3-MYB transcription factor [Arabidopsis thaliana]
 gb|AAM70537.1| AT3g50060/F3A4_140 [Arabidopsis thaliana]
 gb|AAS10068.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE78622.1| myb domain protein 77 [Arabidopsis thaliana]
Length=301

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVTARAQFGNKWATIARLLNGRTD  92



>emb|CAA90810.1| MYB-related protein [Arabidopsis thaliana]
Length=304

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVTARAQFGNKWATIARLLNGRTD  92



>emb|CAA74604.1| R2R3-MYB transcription factor [Arabidopsis thaliana]
Length=304

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVTARAQFGNKWATIARLLNGRTD  92



>ref|XP_010932223.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=243

 Score =   160 bits (405),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            +R+KGPWSPEEDE L++L++ HGPRNWS ISK +PGRSGKSCRLRWCNQLSP VEHR FT
Sbjct  4    ERIKGPWSPEEDEALRRLIEIHGPRNWSAISKGVPGRSGKSCRLRWCNQLSPVVEHRPFT  63

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+ I+RAH RFGNKWATIARLLAGRTD
Sbjct  64   AEEDEAIVRAHRRFGNKWATIARLLAGRTD  93



>ref|XP_010515371.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=304

 Score =   162 bits (410),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRMMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVTARAKFGNKWATIARLLNGRTD  92



>gb|KEH25080.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1513

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +2

Query  149  MDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  328
            MDR+KGPWSPEEDE LQ+LV+KHG RNWS++SKSIPGRSGKSCRL WCNQLSPQVE  AF
Sbjct  1    MDRIKGPWSPEEDEALQKLVEKHGARNWSILSKSIPGRSGKSCRLPWCNQLSPQVERGAF  60

Query  329  TPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            TPEED+ IIRAHARFGNKWATIARLL G+TD
Sbjct  61   TPEEDEAIIRAHARFGNKWATIARLLPGQTD  91



>emb|CDY23023.1| BnaC07g31640D [Brassica napus]
Length=290

 Score =   161 bits (408),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGN+WATIARLL GRTD
Sbjct  63   PEEDETILSARAKFGNRWATIARLLNGRTD  92



>ref|XP_010426549.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=311

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVTARAKFGNKWATIARLLNGRTD  92



>ref|XP_009115687.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=266

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGNKWATIARLL GRT+
Sbjct  63   PEEDETIVSARAKFGNKWATIARLLNGRTN  92



>ref|XP_010547980.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=319

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +2

Query  140  RKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  319
            +K++DRVKGPWSPEED+LL++LVQ+HG RNW+ ISKSIPGRSGKSCRLRWCNQLSP+VEH
Sbjct  4    QKNLDRVKGPWSPEEDQLLRRLVQQHGARNWTGISKSIPGRSGKSCRLRWCNQLSPEVEH  63

Query  320  RAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            R FT EED+ I+RAH   GNKWATIAR L GRTD
Sbjct  64   RPFTAEEDEIIVRAHVEHGNKWATIARRLNGRTD  97



>emb|CDY02098.1| BnaA03g40690D [Brassica napus]
Length=293

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A A+FGN+WATIARLL GRTD
Sbjct  63   PEEDETILSARAKFGNRWATIARLLNGRTD  92



>ref|XP_006293134.1| hypothetical protein CARUB_v10019440mg [Capsella rubella]
 gb|EOA26032.1| hypothetical protein CARUB_v10019440mg [Capsella rubella]
Length=309

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TI+ A ++FGNKWATIARLL GRTD
Sbjct  63   PEEDETIVTARSKFGNKWATIARLLNGRTD  92



>gb|ABD60288.2| R2R3-MYB transcription factor MYB9 [Picea glauca]
Length=260

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            +R+KGPWSPEED  L +LV+K+GPRNWS IS+ IPGRSGKSCRLRWCNQLSPQVEHR F+
Sbjct  4    ERIKGPWSPEEDATLHRLVEKYGPRNWSQISRGIPGRSGKSCRLRWCNQLSPQVEHRPFS  63

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            P ED TII+AHAR GNKWATIARLL GRTD
Sbjct  64   PHEDATIIQAHARHGNKWATIARLLPGRTD  93



>gb|KFK34266.1| hypothetical protein AALP_AA5G122700 [Arabis alpina]
Length=311

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+++V K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRRMVDKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            PEED+TII A  +FGNKWATIARLL GRTD
Sbjct  63   PEEDETIISARGKFGNKWATIARLLNGRTD  92



>gb|ABR16702.1| unknown [Picea sitchensis]
Length=418

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
            A+++    +R+KGPWSPEED  L +LV+K+GPRNWS IS+ IPGRSGKSCRLRWCNQLSP
Sbjct  8    AAVTMAVAERIKGPWSPEEDATLHRLVEKYGPRNWSQISRGIPGRSGKSCRLRWCNQLSP  67

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHR F+P ED TII+AHAR GNKWATIARLL GRTD
Sbjct  68   QVEHRPFSPHEDATIIQAHARHGNKWATIARLLPGRTD  105



>ref|XP_002973727.1| hypothetical protein SELMODRAFT_99462, partial [Selaginella moellendorffii]
 gb|EFJ25387.1| hypothetical protein SELMODRAFT_99462, partial [Selaginella moellendorffii]
Length=122

 Score =   155 bits (391),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  143  KDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  322
            +++DR+KGPWSPEED  LQ+LV K+G RNWSLISK I GRSGKSCRLRWCNQLSPQVEHR
Sbjct  16   EELDRIKGPWSPEEDAALQKLVDKYGARNWSLISKGIAGRSGKSCRLRWCNQLSPQVEHR  75

Query  323  AFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             FT  ED TII+AH++ GNKWATIARLL GRTD
Sbjct  76   PFTAAEDATIIKAHSQHGNKWATIARLLPGRTD  108



>gb|ABQ51225.1| R2R3-MYB transcription factor MYB9 [Picea glauca]
Length=416

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  128  ASISRKDMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSP  307
            A+++    +R+KGPWSPEED  L +LV+K+GPRNWS IS+ IPGRSGKSCRLRWCNQLSP
Sbjct  8    AAVTMAVAERIKGPWSPEEDATLHRLVEKYGPRNWSQISRGIPGRSGKSCRLRWCNQLSP  67

Query  308  QVEHRAFTPEEDDTIIRAHARFGNKWATIARLLAGRTD  421
            QVEHR F+P ED TII+AHAR GNKWATIARLL GRTD
Sbjct  68   QVEHRPFSPHEDATIIQAHARHGNKWATIARLLPGRTD  105



>ref|XP_008239060.1| PREDICTED: transcription factor MYB44, partial [Prunus mume]
Length=310

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/76 (97%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = +2

Query  194  LQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPEEDDTIIRAHARF  373
            LQ+LVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPEEDDTIIRAHARF
Sbjct  2    LQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTPEEDDTIIRAHARF  61

Query  374  GNKWATIARLLAGRTD  421
            GNKWATIARLL GRTD
Sbjct  62   GNKWATIARLLNGRTD  77



>emb|CDY30608.1| BnaAnng03830D [Brassica napus]
Length=265

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  152  DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  331
            DRVKGPWS EEDE L+ +V+K+GPRNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  3    DRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  62

Query  332  PEEDDTIIRAHARFGNKWATIARLLAGRTD  421
             EED+TI+ A A+FGNKWATIARLL GRTD
Sbjct  63   AEEDETIVSARAKFGNKWATIARLLNGRTD  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557844602525