BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005N09

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   5e-44   Solanum lycopersicum
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   6e-44   Solanum tuberosum [potatoes]
ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   2e-43   Nicotiana sylvestris
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    158   2e-42   Solanum tuberosum [potatoes]
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   5e-42   Nicotiana tomentosiformis
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   1e-41   
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                154   5e-41   Erythranthe guttata [common monkey flower]
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                154   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   5e-40   Sesamum indicum [beniseed]
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   5e-40   Solanum lycopersicum
gb|KDP28482.1|  hypothetical protein JCGZ_14253                         151   7e-40   Jatropha curcas
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   2e-39   Sesamum indicum [beniseed]
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   3e-39   Nicotiana sylvestris
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             147   3e-38   Citrus clementina [clementine]
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                146   4e-38   Erythranthe guttata [common monkey flower]
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    146   4e-38   Citrus sinensis [apfelsine]
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             142   8e-37   
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   6e-36   Populus euphratica
ref|XP_002892074.1|  aspartyl protease family protein                   140   8e-36   
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...    139   1e-35   Ricinus communis
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             140   1e-35   Eutrema salsugineum [saltwater cress]
emb|CDY15187.1|  BnaC05g00660D                                          139   2e-35   Brassica napus [oilseed rape]
emb|CBI40559.3|  unnamed protein product                                138   3e-35   Vitis vinifera
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   3e-35   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   3e-35   
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   4e-35   Vitis vinifera
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   5e-35   Populus euphratica
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             137   8e-35   Medicago truncatula
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   8e-35   Cucumis sativus [cucumbers]
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   9e-35   
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   2e-34   
ref|XP_002320868.1|  aspartyl protease family protein                   135   4e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  135   5e-34   Morus notabilis
emb|CDP08669.1|  unnamed protein product                                134   7e-34   Coffea canephora [robusta coffee]
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   1e-33   Eucalyptus grandis [rose gum]
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   2e-33   Pyrus x bretschneideri [bai li]
gb|KJB49569.1|  hypothetical protein B456_008G125700                    133   3e-33   Gossypium raimondii
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   8e-33   Nelumbo nucifera [Indian lotus]
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   1e-32   Malus domestica [apple tree]
gb|EPS66029.1|  hypothetical protein M569_08742                         130   1e-32   Genlisea aurea
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-32   Fragaria vesca subsp. vesca
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   2e-32   Camelina sativa [gold-of-pleasure]
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      130   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302634.2|  aspartyl protease family protein                   130   3e-32   Populus trichocarpa [western balsam poplar]
ref|NP_171637.1|  aspartyl protease family protein                      129   6e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90023.1|  BnaA10g00590D                                          128   1e-31   
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   1e-31   Brassica rapa
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    127   3e-31   Arabis alpina [alpine rockcress]
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g             127   5e-31   Phaseolus vulgaris [French bean]
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   2e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    125   2e-30   Arabis alpina [alpine rockcress]
ref|XP_002878415.1|  aspartyl protease family protein                   124   3e-30   
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   4e-30   Camelina sativa [gold-of-pleasure]
emb|CDY43952.1|  BnaC04g21580D                                          124   4e-30   Brassica napus [oilseed rape]
emb|CDX89133.1|  BnaA04g00530D                                          124   5e-30   
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             123   7e-30   Capsella rubella
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   1e-29   Brassica rapa
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   1e-29   Cucumis melo [Oriental melon]
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   2e-29   Tarenaya hassleriana [spider flower]
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein          120   1e-28   Phaseolus vulgaris [French bean]
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g             120   1e-28   Phaseolus vulgaris [French bean]
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor             119   1e-28   Phaseolus vulgaris [French bean]
emb|CDY25081.1|  BnaC06g18230D                                          118   4e-28   Brassica napus [oilseed rape]
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...    118   4e-28   
gb|AAK64003.1|  AT3g61820/F15G16_210                                    116   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   1e-27   Cucumis sativus [cucumbers]
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       117   1e-27   Cucumis sativus [cucumbers]
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...    118   1e-27   
ref|NP_191741.1|  aspartyl protease                                     117   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   4e-27   Glycine max [soybeans]
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   4e-27   Elaeis guineensis
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   6e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   8e-27   Camelina sativa [gold-of-pleasure]
gb|KJB09628.1|  hypothetical protein B456_001G154400                    114   1e-26   Gossypium raimondii
gb|KJB09626.1|  hypothetical protein B456_001G154400                    114   1e-26   Gossypium raimondii
gb|KJB41527.1|  hypothetical protein B456_007G108800                    113   2e-26   Gossypium raimondii
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   4e-26   Phoenix dactylifera
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   5e-26   Brassica rapa
ref|XP_011461997.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   6e-26   Fragaria vesca subsp. vesca
gb|ABK24467.1|  unknown                                                 112   7e-26   Picea sitchensis
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   1e-25   Glycine max [soybeans]
emb|CDX67868.1|  BnaA07g19080D                                          111   1e-25   
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   4e-24   Elaeis guineensis
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   4e-24   
ref|NP_001043485.1|  Os01g0598600                                       105   2e-23   
gb|EAZ12575.1|  hypothetical protein OsJ_02481                          105   4e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg             103   9e-23   Eutrema salsugineum [saltwater cress]
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   9e-23   Setaria italica
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   6e-22   Brachypodium distachyon [annual false brome]
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660          101   9e-22   Amborella trichopoda
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.2    7e-21   Glycine max [soybeans]
ref|XP_002440367.1|  hypothetical protein SORBIDRAFT_09g030430        98.2    8e-21   
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358            98.2    1e-20   
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein          97.8    2e-20   Medicago truncatula
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.4    2e-20   Nelumbo nucifera [Indian lotus]
gb|ABK24480.1|  unknown                                               97.8    2e-20   Picea sitchensis
gb|ABK25248.1|  unknown                                               96.3    2e-20   Picea sitchensis
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.7    4e-20   Populus euphratica
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.7    4e-20   Populus euphratica
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.3    5e-20   Nelumbo nucifera [Indian lotus]
gb|ABR17085.1|  unknown                                               95.9    8e-20   Picea sitchensis
gb|KHN16429.1|  Aspartic proteinase nepenthesin-1                     90.1    9e-20   Glycine soja [wild soybean]
gb|KJB49971.1|  hypothetical protein B456_008G147500                  95.1    1e-19   Gossypium raimondii
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.5    1e-19   Tarenaya hassleriana [spider flower]
gb|AAT38006.1|  unknow protein                                        95.1    1e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99240.1|  hypothetical protein OsI_21202                        95.1    1e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001056485.1|  Os05g0590000                                     95.1    1e-19   
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg           94.7    2e-19   Prunus persica
gb|KJB77420.1|  hypothetical protein B456_012G135900                  94.7    2e-19   Gossypium raimondii
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    2e-19   Prunus mume [ume]
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g           94.7    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    2e-19   Cicer arietinum [garbanzo]
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    3e-19   Nicotiana tomentosiformis
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    3e-19   Brassica rapa
emb|CDX92240.1|  BnaA05g21670D                                        94.0    4e-19   
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    4e-19   Pyrus x bretschneideri [bai li]
gb|ABR16474.1|  unknown                                               94.0    5e-19   Picea sitchensis
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    5e-19   Pyrus x bretschneideri [bai li]
gb|KDP40474.1|  hypothetical protein JCGZ_24473                       93.2    5e-19   Jatropha curcas
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    6e-19   Setaria italica
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.2    6e-19   Solanum tuberosum [potatoes]
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.2    7e-19   Populus euphratica
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970        93.2    7e-19   
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g           93.2    8e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg           92.8    8e-19   Eutrema salsugineum [saltwater cress]
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g           92.8    9e-19   Phaseolus vulgaris [French bean]
ref|XP_010541885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    1e-18   
emb|CDY24483.1|  BnaC05g34710D                                        92.8    1e-18   Brassica napus [oilseed rape]
gb|KJB79793.1|  hypothetical protein B456_013G067200                  92.0    1e-18   Gossypium raimondii
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg           92.0    2e-18   Capsella rubella
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    2e-18   Phoenix dactylifera
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg           92.0    2e-18   Citrus clementina [clementine]
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    2e-18   Citrus sinensis [apfelsine]
ref|XP_003637421.1|  Aspartic proteinase nepenthesin-1                90.1    2e-18   
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                 92.0    2e-18   Citrus sinensis [apfelsine]
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.7    3e-18   Brassica rapa
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.3    3e-18   Glycine max [soybeans]
ref|XP_011459743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    3e-18   Fragaria vesca subsp. vesca
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750        91.3    3e-18   Amborella trichopoda
dbj|BAJ86414.1|  predicted protein                                    91.3    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    4e-18   Elaeis guineensis
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g           90.9    4e-18   Phaseolus vulgaris [French bean]
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    4e-18   Cucumis sativus [cucumbers]
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.3    4e-18   Tarenaya hassleriana [spider flower]
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                  90.9    4e-18   Arabis alpina [alpine rockcress]
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    4e-18   
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    4e-18   
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    4e-18   
emb|CDY69364.1|  BnaCnng63170D                                        90.9    5e-18   Brassica napus [oilseed rape]
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    6e-18   Glycine max [soybeans]
gb|KJB37242.1|  hypothetical protein B456_006G195400                  90.5    6e-18   Gossypium raimondii
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    7e-18   Solanum lycopersicum
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                 90.5    7e-18   Citrus sinensis [apfelsine]
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein          89.7    9e-18   Medicago truncatula
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg           90.1    9e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    9e-18   Tarenaya hassleriana [spider flower]
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg           89.7    1e-17   
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   Citrus sinensis [apfelsine]
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    1e-17   Camelina sativa [gold-of-pleasure]
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg              89.4    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    1e-17   
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    2e-17   
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    2e-17   Cicer arietinum [garbanzo]
emb|CDY25371.1|  BnaA05g19130D                                        88.2    2e-17   Brassica napus [oilseed rape]
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    2e-17   
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative      89.0    2e-17   
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    2e-17   Malus domestica [apple tree]
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                89.0    3e-17   Morus notabilis
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...  88.2    3e-17   Ricinus communis
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1           88.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  88.6    4e-17   Malus domestica [apple tree]
gb|KDP20100.1|  hypothetical protein JCGZ_05869                       88.2    4e-17   Jatropha curcas
emb|CDY24567.1|  BnaC05g32510D                                        87.4    4e-17   Brassica napus [oilseed rape]
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    4e-17   Vitis vinifera
ref|XP_002885351.1|  pepsin A                                         88.2    4e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971            87.4    4e-17   
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    4e-17   Nicotiana sylvestris
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  88.2    4e-17   Sesamum indicum [beniseed]
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    5e-17   
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    5e-17   Solanum tuberosum [potatoes]
emb|CBI35367.3|  unnamed protein product                              88.2    5e-17   Vitis vinifera
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein     87.8    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  87.8    6e-17   
ref|XP_002885261.1|  aspartyl protease family protein                 87.8    6e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg           87.4    7e-17   Eutrema salsugineum [saltwater cress]
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                  87.0    7e-17   Arabis alpina [alpine rockcress]
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    7e-17   Cucumis sativus [cucumbers]
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    7e-17   
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    8e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    8e-17   Cucumis melo [Oriental melon]
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    8e-17   Brassica rapa
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    8e-17   
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg           87.0    9e-17   Capsella rubella
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g           87.0    9e-17   Phaseolus vulgaris [French bean]
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  87.0    9e-17   
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    1e-16   Cucumis sativus [cucumbers]
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    1e-16   Cucumis melo [Oriental melon]
emb|CDY24395.1|  BnaCnng04620D                                        86.7    1e-16   Brassica napus [oilseed rape]
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    1e-16   Cucumis melo [Oriental melon]
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2           86.7    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    1e-16   
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    1e-16   Pyrus x bretschneideri [bai li]
emb|CDX75968.1|  BnaC03g40510D                                        86.7    1e-16   
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    2e-16   Fragaria vesca subsp. vesca
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    2e-16   Populus euphratica
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504            86.3    2e-16   
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.3    2e-16   Brassica rapa
emb|CDX82342.1|  BnaA03g34790D                                        86.3    2e-16   
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    2e-16   Cucumis sativus [cucumbers]
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    2e-16   Eucalyptus grandis [rose gum]
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966            84.3    3e-16   
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    3e-16   Nicotiana tomentosiformis
emb|CDY51131.1|  BnaA07g37140D                                        85.1    3e-16   Brassica napus [oilseed rape]
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    3e-16   Cicer arietinum [garbanzo]
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    4e-16   Camelina sativa [gold-of-pleasure]
emb|CDP04865.1|  unnamed protein product                              85.5    4e-16   Coffea canephora [robusta coffee]
ref|NP_173922.1|  aspartyl protease family protein                    85.1    4e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDM83204.1|  unnamed protein product                              85.1    4e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010688619.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.5    4e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK24255.1|  unknown                                               85.1    5e-16   Picea sitchensis
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    5e-16   Solanum tuberosum [potatoes]
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    5e-16   Setaria italica
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    5e-16   Elaeis guineensis
emb|CBI27051.3|  unnamed protein product                              82.8    5e-16   Vitis vinifera
ref|XP_003589787.1|  Aspartic proteinase nepenthesin-2                84.7    5e-16   
dbj|BAK07248.1|  predicted protein                                    85.1    6e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    6e-16   Brachypodium distachyon [annual false brome]
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    6e-16   Oryza brachyantha
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.7    6e-16   Nelumbo nucifera [Indian lotus]
gb|AES60038.2|  aspartic protease in GUARD CELL-like protein          84.7    6e-16   Medicago truncatula
gb|ABR17396.1|  unknown                                               83.2    6e-16   Picea sitchensis
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg           84.7    6e-16   Capsella rubella
gb|KCW86348.1|  hypothetical protein EUGRSUZ_B03036                   84.7    6e-16   Eucalyptus grandis [rose gum]
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    6e-16   Prunus mume [ume]
gb|KDO70057.1|  hypothetical protein CISIN_1g0117491mg                82.4    6e-16   Citrus sinensis [apfelsine]
ref|XP_001757102.1|  predicted protein                                84.0    7e-16   
ref|XP_002315953.1|  aspartyl protease family protein                 84.7    7e-16   Populus trichocarpa [western balsam poplar]
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg           84.7    7e-16   
ref|XP_001759252.1|  predicted protein                                83.6    8e-16   
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...  84.3    8e-16   Ricinus communis
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    8e-16   Vitis vinifera
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  84.3    8e-16   Eucalyptus grandis [rose gum]
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g           84.3    8e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    9e-16   Nicotiana sylvestris
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    9e-16   Camelina sativa [gold-of-pleasure]
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    1e-15   Sesamum indicum [beniseed]
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Populus euphratica
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Brassica rapa
ref|XP_004238952.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Solanum lycopersicum
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    1e-15   Prunus mume [ume]
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Glycine max [soybeans]
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Solanum lycopersicum
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.0    1e-15   Cicer arietinum [garbanzo]
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    1e-15   Phoenix dactylifera
ref|XP_002890686.1|  aspartyl protease family protein                 83.6    2e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    2e-15   Nicotiana tomentosiformis
gb|EMS50115.1|  Aspartic proteinase nepenthesin-2                     80.9    2e-15   Triticum urartu
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.6    2e-15   Tarenaya hassleriana [spider flower]
gb|KDP29378.1|  hypothetical protein JCGZ_18299                       83.6    2e-15   Jatropha curcas
gb|KJB52970.1|  hypothetical protein B456_008G285900                  83.6    2e-15   Gossypium raimondii
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein      83.2    2e-15   
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.2    2e-15   Brassica rapa
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg           83.2    2e-15   Citrus clementina [clementine]
emb|CDM80984.1|  unnamed protein product                              83.2    2e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.2    2e-15   Citrus sinensis [apfelsine]
ref|XP_010092769.1|  Aspartic proteinase nepenthesin-1                83.2    2e-15   Morus notabilis
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.2    2e-15   
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    3e-15   
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    3e-15   
ref|XP_003517994.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    3e-15   
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.8    3e-15   
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230            82.0    3e-15   
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369           82.0    3e-15   
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    3e-15   
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    3e-15   
ref|XP_003520035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    4e-15   
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                  82.4    4e-15   
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039            82.4    4e-15   
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    4e-15   
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...  82.0    5e-15   
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.0    5e-15   
ref|XP_002442591.1|  hypothetical protein SORBIDRAFT_08g022580        82.0    5e-15   
gb|KJB50738.1|  hypothetical protein B456_008G185200                  82.0    6e-15   
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.6    7e-15   
emb|CDP20336.1|  unnamed protein product                              81.6    7e-15   
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135            80.5    8e-15   
ref|XP_006341626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.6    8e-15   
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134            80.1    8e-15   
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g           81.3    9e-15   
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.3    9e-15   
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.3    1e-14   
gb|EAY72467.1|  hypothetical protein OsI_00323                        81.3    1e-14   
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900        80.9    1e-14   
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.9    1e-14   
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630        80.9    1e-14   
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048            80.1    1e-14   
dbj|BAJ97639.1|  predicted protein                                    80.5    2e-14   
ref|XP_007046283.1|  Eukaryotic aspartyl protease family protein      80.9    2e-14   
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.9    2e-14   
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.5    2e-14   
emb|CDY03848.1|  BnaC07g10730D                                        80.5    2e-14   
ref|XP_004972145.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.1    2e-14   
ref|XP_009800603.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.1    3e-14   
emb|CAE05761.2|  OSJNBa0064G10.12                                     79.3    4e-14   
gb|EPS61272.1|  hypothetical protein M569_13524                       79.7    4e-14   
ref|NP_001054261.2|  Os04g0677100                                     79.3    4e-14   
gb|EAZ32412.1|  hypothetical protein OsJ_16623                        79.3    4e-14   
emb|CAJ86229.1|  H0402C08.5                                           79.3    4e-14   
gb|EAY72465.1|  hypothetical protein OsI_00321                        78.2    4e-14   
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210        79.3    4e-14   
ref|XP_011072934.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.3    6e-14   
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.0    6e-14   
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  79.0    6e-14   
ref|XP_010911344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.0    8e-14   
emb|CDP20730.1|  unnamed protein product                              78.6    9e-14   
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440        78.6    1e-13   
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  78.6    1e-13   
ref|XP_002446596.1|  hypothetical protein SORBIDRAFT_06g018693        74.7    1e-13   
ref|NP_001041979.1|  Os01g0140100                                     78.2    1e-13   
ref|XP_010105777.1|  Aspartic proteinase nepenthesin-1                78.2    1e-13   
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg              78.2    1e-13   
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  78.2    1e-13   
ref|XP_002442590.1|  hypothetical protein SORBIDRAFT_08g022570        77.8    2e-13   
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470            77.0    2e-13   
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.4    2e-13   
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  76.6    3e-13   
gb|EAY75637.1|  hypothetical protein OsI_03542                        76.6    3e-13   
dbj|BAB84414.1|  chloroplast nucleoid DNA-binding protein cnd41-like  76.6    3e-13   
ref|XP_006646269.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  76.3    3e-13   
ref|XP_001784204.1|  predicted protein                                75.9    4e-13   
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  76.6    4e-13   
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg           77.0    4e-13   
gb|EAZ13356.1|  hypothetical protein OsJ_03278                        76.3    4e-13   
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  76.3    5e-13   
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.9    7e-13   
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg              75.1    1e-12   
ref|XP_002443631.1|  hypothetical protein SORBIDRAFT_08g022620        74.7    2e-12   
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.6    4e-12   
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016            73.9    4e-12   
ref|XP_004500468.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.6    5e-12   
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161            72.0    8e-12   
emb|CDM84701.1|  unnamed protein product                              72.4    9e-12   
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein          72.4    1e-11   
ref|XP_002524401.1|  basic 7S globulin 2 precursor small subunit,...  71.6    2e-11   
ref|XP_001751688.1|  predicted protein                                71.6    2e-11   
emb|CDO98452.1|  unnamed protein product                              70.9    3e-11   
ref|XP_003552901.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    5e-11   
ref|XP_008778737.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    5e-11   
ref|XP_010524109.1|  PREDICTED: aspartic proteinase nepenthesin-1...  70.5    6e-11   
ref|XP_008393394.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.4    6e-11   
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075        69.7    7e-11   
ref|XP_001779661.1|  predicted protein                                69.7    7e-11   
ref|XP_003537377.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.1    8e-11   
gb|KHN24691.1|  Aspartic proteinase nepenthesin-2                     70.1    8e-11   
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046  70.1    8e-11   
ref|XP_002865165.1|  predicted protein                                66.2    9e-11   
ref|XP_010525594.1|  PREDICTED: aspartic proteinase nepenthesin-2     69.7    1e-10   
ref|XP_003580821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    1e-10   
ref|XP_002986201.1|  hypothetical protein SELMODRAFT_234982           68.9    2e-10   
ref|XP_007215315.1|  hypothetical protein PRUPE_ppa003547mg           69.3    2e-10   
ref|NP_174430.1|  aspartyl protease-like protein                      68.9    2e-10   
ref|XP_008380197.1|  PREDICTED: aspartic proteinase nepenthesin-2     68.9    2e-10   
ref|XP_002985015.1|  hypothetical protein SELMODRAFT_121417           68.9    2e-10   
ref|XP_010508488.1|  PREDICTED: aspartic proteinase CDR1-like         68.6    2e-10   
gb|EEE64882.1|  hypothetical protein OsJ_19741                        68.6    2e-10   
ref|XP_006354419.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.6    2e-10   
ref|XP_010499694.1|  PREDICTED: probable aspartic protease At2g35615  68.2    2e-10   
ref|XP_010035929.1|  PREDICTED: aspartic proteinase nepenthesin-2...  68.6    2e-10   
ref|XP_004239252.1|  PREDICTED: aspartic proteinase nepenthesin-1...  68.6    2e-10   
ref|XP_009377195.1|  PREDICTED: aspartic proteinase nepenthesin-2...  68.6    2e-10   
ref|XP_011467594.1|  PREDICTED: aspartic proteinase nepenthesin-2     68.2    3e-10   
gb|KDO51883.1|  hypothetical protein CISIN_1g041228mg                 68.2    3e-10   
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748  68.6    3e-10   
ref|XP_006437136.1|  hypothetical protein CICLE_v10031104mg           68.2    4e-10   
ref|XP_004243605.1|  PREDICTED: aspartic proteinase nepenthesin-2...  68.2    4e-10   
gb|KGN63809.1|  hypothetical protein Csa_1G022480                     67.8    4e-10   
ref|XP_004170576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    4e-10   
ref|XP_004138237.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    4e-10   
ref|XP_006357686.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    4e-10   
ref|XP_010506150.1|  PREDICTED: aspartic proteinase CDR1-like         67.8    4e-10   
ref|XP_010517850.1|  PREDICTED: aspartic proteinase CDR1-like         67.8    4e-10   
ref|XP_006373545.1|  hypothetical protein POPTR_0016s00260g           67.8    4e-10   
gb|KFK37140.1|  hypothetical protein AALP_AA4G218300                  67.8    4e-10   
ref|XP_009142895.1|  PREDICTED: aspartic proteinase nepenthesin-2     67.8    4e-10   
ref|XP_008353635.1|  PREDICTED: aspartic proteinase nepenthesin-2...  67.8    4e-10   
ref|XP_006826832.1|  hypothetical protein AMTR_s00010p00081970        67.4    4e-10   
ref|XP_008670374.1|  PREDICTED: aspartic proteinase nepenthesin-2...  67.8    4e-10   
emb|CDP15730.1|  unnamed protein product                              67.8    5e-10   
ref|XP_008784432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.8    5e-10   
ref|XP_006296519.1|  hypothetical protein CARUB_v10025708mg           67.4    5e-10   
ref|XP_007048981.1|  Eukaryotic aspartyl protease family protein ...  67.8    5e-10   
ref|XP_010480892.1|  PREDICTED: probable aspartic protease At2g35615  67.0    5e-10   
ref|NP_001046662.1|  Os02g0314600                                     67.4    5e-10   
gb|EAY85563.1|  hypothetical protein OsI_06935                        67.4    5e-10   
ref|XP_006582668.1|  PREDICTED: probable aspartic protease At2g35...  65.5    5e-10   
ref|XP_007146932.1|  hypothetical protein PHAVU_006G083000g           67.4    5e-10   
emb|CDX79836.1|  BnaA05g03200D                                        67.4    6e-10   
emb|CDX98347.1|  BnaC06g17080D                                        67.4    6e-10   
ref|XP_002279141.2|  PREDICTED: aspartic proteinase nepenthesin-2     67.4    6e-10   
gb|KHN11976.1|  Aspartic proteinase nepenthesin-1                     67.4    6e-10   
ref|XP_002520371.1|  basic 7S globulin 2 precursor small subunit,...  67.4    6e-10   
ref|XP_011044763.1|  PREDICTED: aspartic proteinase nepenthesin-2...  67.4    6e-10   
ref|XP_010241281.1|  PREDICTED: aspartic proteinase nepenthesin-1...  67.4    6e-10   
ref|XP_009356142.1|  PREDICTED: aspartic proteinase nepenthesin-1     67.0    6e-10   
dbj|BAJ53226.1|  JHL06P13.6                                           67.0    6e-10   
ref|XP_006847614.1|  hypothetical protein AMTR_s00014p00246430        67.4    6e-10   
ref|XP_007146226.1|  hypothetical protein PHAVU_006G022800g           67.4    6e-10   
ref|XP_010241283.1|  PREDICTED: aspartic proteinase nepenthesin-1...  67.4    7e-10   
ref|XP_007048982.1|  Eukaryotic aspartyl protease family protein ...  67.0    7e-10   
gb|KDP37099.1|  hypothetical protein JCGZ_06155                       66.6    7e-10   
emb|CDY53652.1|  BnaC04g52860D                                        67.0    7e-10   
ref|XP_003553140.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    7e-10   
ref|XP_010087862.1|  Aspartic proteinase nepenthesin-1                67.0    7e-10   
gb|KJB08584.1|  hypothetical protein B456_001G092100                  67.0    7e-10   
ref|XP_002307559.2|  hypothetical protein POPTR_0005s22630g           67.0    7e-10   
ref|XP_003573011.1|  PREDICTED: aspartic proteinase nepenthesin-2...  67.0    8e-10   
ref|NP_181826.1|  aspartyl protease-like protein                      67.0    8e-10   
ref|XP_011100548.1|  PREDICTED: aspartic proteinase nepenthesin-2...  67.0    8e-10   
ref|XP_002881883.1|  hypothetical protein ARALYDRAFT_903676           67.0    8e-10   
gb|KHN18625.1|  Aspartic proteinase nepenthesin-2                     66.6    9e-10   
ref|XP_006648575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.6    9e-10   
ref|XP_009759829.1|  PREDICTED: aspartic proteinase nepenthesin-2...  66.6    1e-09   
gb|KDP26966.1|  hypothetical protein JCGZ_22200                       66.6    1e-09   
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...  67.0    1e-09   
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...  67.0    1e-09   
ref|XP_010058011.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    1e-09   
ref|XP_003617399.1|  60S ribosomal protein L18a                       67.0    1e-09   
ref|XP_001778328.1|  predicted protein                                63.5    1e-09   
gb|KHN38336.1|  Aspartic proteinase nepenthesin-2                     66.6    1e-09   
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...  67.0    1e-09   
ref|XP_004295663.1|  PREDICTED: uncharacterized protein LOC101292685  64.3    1e-09   
ref|XP_002460653.1|  hypothetical protein SORBIDRAFT_02g032590        66.6    1e-09   
ref|XP_011040081.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    1e-09   
ref|XP_006415326.1|  hypothetical protein EUTSA_v10009809mg           66.2    1e-09   
gb|EYU42788.1|  hypothetical protein MIMGU_mgv1a008084mg              65.9    1e-09   
ref|XP_009356605.1|  PREDICTED: aspartic proteinase nepenthesin-2...  66.2    1e-09   
ref|XP_007141420.1|  hypothetical protein PHAVU_008G193900g           66.2    1e-09   
ref|XP_010688898.1|  PREDICTED: aspartic proteinase nepenthesin-1     66.2    1e-09   
ref|XP_004952344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  66.2    1e-09   
gb|AET00358.2|  eukaryotic aspartyl protease family protein           66.2    1e-09   
ref|XP_002460980.1|  hypothetical protein SORBIDRAFT_02g038700        65.9    2e-09   
ref|XP_009421481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    2e-09   
gb|KEH33552.1|  eukaryotic aspartyl protease family protein           65.9    2e-09   
ref|XP_009625562.1|  PREDICTED: aspartic proteinase nepenthesin-2...  65.9    2e-09   
ref|XP_008453383.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    2e-09   
ref|XP_010093388.1|  Aspartic proteinase nepenthesin-2                65.9    2e-09   
ref|XP_002278677.2|  PREDICTED: aspartic proteinase nepenthesin-1     65.5    2e-09   
ref|XP_007227595.1|  hypothetical protein PRUPE_ppa017015mg           65.5    2e-09   
ref|XP_006411570.1|  hypothetical protein EUTSA_v10016513mg           65.5    2e-09   
ref|NP_001154646.1|  aspartyl protease family protein                 64.7    2e-09   
ref|XP_010904875.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    2e-09   
ref|XP_008465452.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    3e-09   
ref|XP_004503002.1|  PREDICTED: aspartic proteinase nepenthesin-1...  65.1    3e-09   
ref|XP_006597643.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.1    3e-09   
gb|KFK44926.1|  hypothetical protein AALP_AA1G320800                  65.1    3e-09   
ref|XP_002876487.1|  hypothetical protein ARALYDRAFT_486375           65.5    3e-09   
emb|CDX67775.1|  BnaA07g18150D                                        65.5    3e-09   
ref|XP_010504886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    3e-09   
ref|XP_009759588.1|  PREDICTED: aspartic proteinase CDR1-like         65.1    3e-09   
ref|XP_011085418.1|  PREDICTED: aspartic proteinase nepenthesin-2...  65.5    3e-09   
gb|KFK35067.1|  hypothetical protein AALP_AA5G230900                  65.1    3e-09   
ref|NP_001030891.1|  aspartyl protease family protein                 65.1    3e-09   
gb|KGN54937.1|  hypothetical protein Csa_4G608130                     65.1    3e-09   
ref|XP_006303624.1|  hypothetical protein CARUB_v10011499mg           64.7    3e-09   
ref|XP_010516578.1|  PREDICTED: aspartic proteinase nepenthesin-2...  65.1    3e-09   
ref|XP_010512138.1|  PREDICTED: aspartic proteinase nepenthesin-1...  65.1    3e-09   
ref|XP_004166596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.5    3e-09   
ref|XP_004144680.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  65.5    4e-09   
ref|XP_006402723.1|  hypothetical protein EUTSA_v10005882mg           65.1    4e-09   
ref|XP_010512140.1|  PREDICTED: aspartic proteinase nepenthesin-1...  65.1    4e-09   
ref|XP_010516575.1|  PREDICTED: aspartic proteinase nepenthesin-2...  65.1    4e-09   
ref|XP_009104182.1|  PREDICTED: aspartic proteinase nepenthesin-2     65.1    4e-09   
ref|XP_006290872.1|  hypothetical protein CARUB_v10016982mg           64.7    4e-09   
ref|XP_010516577.1|  PREDICTED: aspartic proteinase nepenthesin-1...  64.7    4e-09   
ref|NP_191467.1|  aspartyl protease family protein                    64.7    4e-09   
ref|XP_010512139.1|  PREDICTED: aspartic proteinase nepenthesin-2...  64.7    4e-09   
ref|XP_009390735.1|  PREDICTED: aspartic proteinase nepenthesin-2...  64.7    4e-09   
ref|XP_002891144.1|  predicted protein                                64.7    4e-09   
ref|XP_006291121.1|  hypothetical protein CARUB_v10017234mg           64.7    4e-09   
ref|XP_010916060.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  64.7    4e-09   
ref|NP_189198.1|  aspartyl protease family protein                    64.3    5e-09   
ref|XP_007133780.1|  hypothetical protein PHAVU_011G208400g           64.3    5e-09   
ref|XP_004964917.1|  PREDICTED: aspartic proteinase nepenthesin-1...  64.3    6e-09   
ref|XP_009760965.1|  PREDICTED: aspartic proteinase nepenthesin-2...  64.3    6e-09   
gb|KHN37654.1|  Putative aspartic protease                            63.9    6e-09   
ref|XP_007153336.1|  hypothetical protein PHAVU_003G026700g           63.9    6e-09   
gb|EYU25643.1|  hypothetical protein MIMGU_mgv1a027134mg              63.9    6e-09   



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 118/153 (77%), Gaps = 17/153 (11%)
 Frame = +1

Query  64   IFA---SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAA  234
            IFA   SL YQTL+L PLP  Q  SLS +PQ S       D+ENTLS+ LHH+DL+S ++
Sbjct  14   IFAAAHSLQYQTLTLNPLPQLQ--SLSWEPQLSS------DNENTLSVQLHHVDLLSPSS  65

Query  235  VNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRL  414
             NATP ALF  RLQRDA RAK+LSLL+A     N+T G+DFSSSVISGL+QGSGEYFTR+
Sbjct  66   FNATPHALFKLRLQRDAIRAKSLSLLSA-----NST-GKDFSSSVISGLSQGSGEYFTRI  119

Query  415  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            G+GTP KY ++VLDTGSD+VW+QC PC KCY+Q
Sbjct  120  GIGTPVKYVYLVLDTGSDIVWIQCLPCSKCYSQ  152



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 103/155 (66%), Gaps = 10/155 (6%)
 Frame = +1

Query  73   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPK  252
            SL YQTL L  LP  Q  SL    Q         D +NTLSL LHH+DL+S ++ NATP 
Sbjct  24   SLQYQTLLLHSLPLTQLQSLDFDAQLLSGDGSDLDPDNTLSLQLHHVDLVSPSSFNATPH  83

Query  253  ALFVKRLQRDa--------arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFT  408
            ALF  RLQRDA          A   ++   A  PH    GRDFSSSV+SGL+QGSGEYFT
Sbjct  84   ALFKLRLQRDAYRAKAISDLAAANATVGRRAGKPHAG--GRDFSSSVVSGLSQGSGEYFT  141

Query  409  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            R+GVGTPPKY +MVLDTGSDVVW+QCSPC+KCY Q
Sbjct  142  RIGVGTPPKYVYMVLDTGSDVVWIQCSPCKKCYTQ  176



>ref|XP_009800816.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=474

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 111/146 (76%), Gaps = 6/146 (4%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLIS--SAAVNATPKA  255
            YQTL+LR LP  Q  SLS   Q S    QP +SENTL++ LHH+DLI+  ++  N TP A
Sbjct  28   YQTLTLRSLPEPQ--SLSWATQDSNDF-QPLNSENTLAVQLHHVDLITPYTSLSNTTPHA  84

Query  256  LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  435
            LF  RLQRDA RAK LS LA A    NAT  +DFSSSVISGLAQGSGEYFTR+G+GTPPK
Sbjct  85   LFKLRLQRDAVRAKLLSNLAEAVANANATV-KDFSSSVISGLAQGSGEYFTRIGIGTPPK  143

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YA+MVLDTGSDVVW+QC PCR+CY Q
Sbjct  144  YAYMVLDTGSDVVWIQCLPCRQCYNQ  169



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 116/147 (79%), Gaps = 11/147 (7%)
 Frame = +1

Query  73   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPK  252
            SL YQTL+L  LP  Q  SLS +PQ S       D+ENTLS+ LHH+DL+S ++ NATP 
Sbjct  20   SLQYQTLTLNSLPQLQ--SLSWEPQLSS------DNENTLSVQLHHVDLLSPSSFNATPH  71

Query  253  ALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  432
            ALF  RLQRDA RAK+LSLL+A+A   N+T G+DFSSSVISGL+QGSGEYFTR+G+GTP 
Sbjct  72   ALFKLRLQRDAIRAKSLSLLSASA--ANST-GKDFSSSVISGLSQGSGEYFTRIGIGTPT  128

Query  433  KYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            KY ++VLDTGSD+VW+QC PC KCY+Q
Sbjct  129  KYVYLVLDTGSDIVWIQCLPCAKCYSQ  155



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 111/155 (72%), Gaps = 11/155 (7%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSENTLSLDLHHIDLISSAAVNATP  249
            YQTL L  LP ++  SLS   +  +  +  D    D + TLS+ LHH+DL+S ++ NATP
Sbjct  52   YQTLVLNSLPNSEPQSLSWATEDFEAQLSGDGSNPDPDTTLSVQLHHVDLVSPSSFNATP  111

Query  250  KALFVKRLQRDaarakalsllaaaa-------PPHNATRGRDFSSSVISGLAQGSGEYFT  408
             ALF  RLQRDAARAKALS LAAA          H+    RDFSSSV SGLAQGSGEYFT
Sbjct  112  HALFKLRLQRDAARAKALSDLAAANITVGRRGGGHHVVGSRDFSSSVTSGLAQGSGEYFT  171

Query  409  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            RLGVGTPPKYA+MVLDTGSDVVW+QCSPC+KCY Q
Sbjct  172  RLGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCYTQ  206



>ref|XP_009600181.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 112/146 (77%), Gaps = 6/146 (4%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLIS--SAAVNATPKA  255
            YQTL+LR LP  Q  S +++  Y     QP +S+NTL++ LHH+DLI+  ++  N TP A
Sbjct  28   YQTLTLRSLPEPQSLSWATQDSYD---FQPLNSQNTLAVQLHHVDLITPYTSLFNTTPHA  84

Query  256  LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  435
            LF  RLQRDA RA+ LS LA AA   NAT  +DFSSSVISGLAQGSGEYFTR+G+GTPPK
Sbjct  85   LFKLRLQRDAVRAELLSKLAEAAANANATV-KDFSSSVISGLAQGSGEYFTRIGIGTPPK  143

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YA++VLDTGSDVVW+QC PCR+CY Q
Sbjct  144  YAYLVLDTGSDVVWIQCLPCRQCYNQ  169



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 114/152 (75%), Gaps = 13/152 (9%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLS-SKPQYSQTLVQPDDSENTLSLDLHHIDLI---SSAAVNA  243
            L YQTL L  LP  Q  SLS    Q S + ++P+ S+ TLSLDLHH+D +   +SAA ++
Sbjct  22   LHYQTLVLTSLPNPQSQSLSWPTQQQSDSQIRPE-SDTTLSLDLHHVDNLPPSASAAFSS  80

Query  244  TPKALFVKRLQRDaarakalsllaaaaPPHNATRGR--DFSSSVISGLAQGSGEYFTRLG  417
            TP++LF  RL+RDA R +ALS +A      N + GR  DFSSS++SGLAQGSGEYFTR+G
Sbjct  81   TPQSLFKLRLRRDAVRVRALSTIA------NVSVGRPGDFSSSIVSGLAQGSGEYFTRIG  134

Query  418  VGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +GTPPKY +MVLDTGSDVVW+QCSPCRKCY+Q
Sbjct  135  IGTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQ  166



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 113/150 (75%), Gaps = 11/150 (7%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLS-SKPQYSQTLVQPDDSENTLSLDLHHID-LISSAAVNATP  249
            L YQTL L  LP  Q  SLS    Q S + ++P+ S+ TLSLDLHH+D L  SAA ++TP
Sbjct  22   LHYQTLVLTSLPNPQSQSLSWPTQQQSDSQIRPE-SDTTLSLDLHHLDNLPPSAAFSSTP  80

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRGR--DFSSSVISGLAQGSGEYFTRLGVG  423
            ++LF  RL+RDA R +ALS LA      N + GR  DFSSS++SGLAQGSGEYFTR+G+G
Sbjct  81   QSLFKLRLRRDAVRVRALSTLA------NVSGGRPGDFSSSIVSGLAQGSGEYFTRIGIG  134

Query  424  TPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            TPPKY +MVLDTGSDVVW+QCSPCRKCY+Q
Sbjct  135  TPPKYVYMVLDTGSDVVWVQCSPCRKCYSQ  164



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 112/151 (74%), Gaps = 6/151 (4%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            A L YQT  L  LP  Q  S  ++ Q S+T VQP  S  TLSLDLHH+D +S    N+TP
Sbjct  24   APLQYQTFLLTSLPNPQSLSWPTQ-QDSETQVQPH-SHTTLSLDLHHVDNLS-PDFNSTP  80

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGV  420
            ++LF  RL+RDA R KALS ++A +  + + + R   DFSSSVISGLAQGSGEYFTR+G+
Sbjct  81   QSLFKLRLRRDAIRVKALSTISAVSQTNVSGQPRAAGDFSSSVISGLAQGSGEYFTRIGI  140

Query  421  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GTPPKY +MVLDTGSDVVW+QCSPCRKCY+Q
Sbjct  141  GTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQ  171



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 102/159 (64%), Gaps = 17/159 (11%)
 Frame = +1

Query  73   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSENTLSLDLHHIDLISSAAVN  240
            SL Y TL L  LP  Q   L     +   L+  D    D +N LSL LHH+DL+S ++ N
Sbjct  43   SLQYHTLLLHSLPLTQ---LQKSLHFDAQLLSGDGSDLDPDNALSLQLHHVDLVSPSSFN  99

Query  241  ATPKALFVKRLQRDa--------arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSG  396
            ATP ALF  RLQRDA          +   ++   A  PH    GRDFSSSV+SGL+QGSG
Sbjct  100  ATPHALFKLRLQRDAYRAKAISDLASANATVGRRAGKPHPG--GRDFSSSVVSGLSQGSG  157

Query  397  EYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            EYFTR+GVGTP KY +MVLDTGSDVVW+QCSPC+KCY Q
Sbjct  158  EYFTRIGVGTPSKYVYMVLDTGSDVVWIQCSPCKKCYTQ  196



>gb|KDP28482.1| hypothetical protein JCGZ_14253 [Jatropha curcas]
Length=478

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 108/149 (72%), Gaps = 7/149 (5%)
 Frame = +1

Query  76   LDYQTLSLRPLP--TAQHY-SLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNAT  246
            LDYQTL L PLP  TA  + +  S+ +  QTL    DS  T SL LHHID +S+   N T
Sbjct  28   LDYQTLVLNPLPRQTALSWPAADSEAETLQTLTDTADS-TTFSLQLHHIDALSN---NKT  83

Query  247  PKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  426
            P+ LF +RLQRDA R +ALS +AA+A       G  FSSSVISGLAQGSGEYFTR+GVGT
Sbjct  84   PQDLFGERLQRDAFRVEALSSVAASAVGAGGRVGTGFSSSVISGLAQGSGEYFTRIGVGT  143

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PP+Y +MVLDTGSD+VW+QC+PC KCY+Q
Sbjct  144  PPRYVYMVLDTGSDIVWIQCAPCNKCYSQ  172



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 107/151 (71%), Gaps = 8/151 (5%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            A L YQTL L PLPT Q  S    P   ++ + P  SENT SL+LHH+D +S  A N+TP
Sbjct  28   APLQYQTLVLTPLPTPQTLSW---PSQQESELGPL-SENTFSLNLHHVDSLS-PAFNSTP  82

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRGRD---FSSSVISGLAQGSGEYFTRLGV  420
            ++LF  RL RD  R KALS LAAA   + + R R    FSSSV SGLAQGSGEYFTRLGV
Sbjct  83   ESLFKLRLHRDGVRVKALSTLAAATQTNVSARARGAPGFSSSVTSGLAQGSGEYFTRLGV  142

Query  421  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GTP KY +MVLDTGSDVVW+QCSPCR+CY Q
Sbjct  143  GTPAKYVYMVLDTGSDVVWVQCSPCRRCYTQ  173



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 111/155 (72%), Gaps = 11/155 (7%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSENTLSLDLHHIDLISSAAVNATP  249
            YQTL L  LP +Q  SLS   +  +  +  D    D + TLS+ LHH+DL+S ++ NATP
Sbjct  33   YQTLVLNSLPNSQPQSLSWATEDFEAQLSGDGSNPDPDYTLSVQLHHVDLVSPSSFNATP  92

Query  250  KALFVKRLQRDaarakalsllaaaa-------PPHNATRGRDFSSSVISGLAQGSGEYFT  408
              LF  RLQRDAARAKALS LAAA          H+   GRDFSSSV SGLAQGSGEYFT
Sbjct  93   HTLFKLRLQRDAARAKALSDLAAANITVGRRGGGHHVVGGRDFSSSVTSGLAQGSGEYFT  152

Query  409  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            RLGVGTPPKYA+MVLDTGSDVVW+QCSPC+KCY Q
Sbjct  153  RLGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCYTQ  187



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 104/158 (66%), Gaps = 13/158 (8%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYS---LSSKPQYSQTLVQPD-DSENTLSLDLHHIDLISSAAV  237
            ASL YQT  L  LPT    S     S  +   +L  P  D+E++LSL LHH+D +S    
Sbjct  21   ASLQYQTFVLNSLPTQSTLSWPESVSVSESESSLPLPAPDAESSLSLRLHHVDSLS---F  77

Query  238  NATPKALFVKRLQRDa---arakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGE  399
            N TP+ LF  R+QRD        A +  A   PP N +RGR    FSSSVISGLAQGSGE
Sbjct  78   NRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSRGRANGGFSSSVISGLAQGSGE  137

Query  400  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YFTRLGVGTPP+Y +MVLDTGSDVVW+QC+PC+KCY+Q
Sbjct  138  YFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQ  175



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 108/150 (72%), Gaps = 4/150 (3%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            A L YQT  L  LP  Q  S  S+ Q SQ +  P +SE   SL+LHH+D +S +++ +TP
Sbjct  22   APLQYQTFVLTSLPQPQTISWVSQ-QESQVIETPSESETDFSLNLHHVDSLSPSSI-STP  79

Query  250  KALFVKRLQRDaarakalsllaaaa--PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVG  423
            ++LF  RL+RD  R +ALS LAA+A  P + + +   FSSSVISGLA GSGEYFTRLGVG
Sbjct  80   ESLFQLRLRRDGVRVEALSTLAASAAAPTNVSGKPHGFSSSVISGLAHGSGEYFTRLGVG  139

Query  424  TPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            TP KY +MVLDTGSDVVW+QCSPCRKCY Q
Sbjct  140  TPAKYVYMVLDTGSDVVWIQCSPCRKCYTQ  169



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 104/158 (66%), Gaps = 13/158 (8%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYS---LSSKPQYSQTLVQPD-DSENTLSLDLHHIDLISSAAV  237
            ASL YQT  L  LPT    S     S  +   +L  P  D+E++LSL LHH+D +S    
Sbjct  21   ASLQYQTFVLNSLPTPSTLSWPESVSVSESESSLPLPAPDAESSLSLRLHHVDSLS---F  77

Query  238  NATPKALFVKRLQRDa---arakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGE  399
            N TP+ LF  R+QRD        A +  A   PP N +RGR    FSSSVISGLAQGSGE
Sbjct  78   NRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSRGRANGGFSSSVISGLAQGSGE  137

Query  400  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YFTRLGVGTPP+Y +MVLDTGSDVVW+QC+PC+KCY+Q
Sbjct  138  YFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQ  175



>ref|XP_007217966.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
 gb|EMJ19165.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
Length=468

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 19/153 (12%)
 Frame = +1

Query  73   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPK  252
            +L++QTL L PLP     S      + +++  P    NTLS+ LHH+D +S   +N TP 
Sbjct  24   ALEHQTLVLNPLPNPPTLS------WPESVTDP----NTLSVQLHHLDALS---LNKTPS  70

Query  253  ALFVKRLQRDaaraka-lsllaaaaPPHNATRG-----RDFSSSVISGLAQGSGEYFTRL  414
             LF  RLQRDA R K   S+ AAAA P+   RG     R FSSSV+SGLAQGSGEYFTRL
Sbjct  71   QLFNLRLQRDAVRVKTLSSIAAAAASPNRTARGGRVPIRGFSSSVVSGLAQGSGEYFTRL  130

Query  415  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GVGTPPKY +MVLDTGSDVVWLQC+PC++CY+Q
Sbjct  131  GVGTPPKYVYMVLDTGSDVVWLQCAPCKRCYSQ  163



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 101/152 (66%), Gaps = 11/152 (7%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE------NTLSLDLHHIDLISSAAVNA  243
            +QTL+L PLP     S +     +QT   P  SE       +LS+ LHHID +SS     
Sbjct  51   FQTLTLNPLPNKPTISWADTEPGTQTFTDPTISEPSSSATTSLSVQLHHIDALSSGK---  107

Query  244  TPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSVISGLAQGSGEYFTRLG  417
            + + LF  RL RDAAR K+L  LAA     N TR R   FSSSVISGLAQGSGEYFTRLG
Sbjct  108  SSQDLFNSRLARDAARVKSLISLAATVGGTNLTRARGPGFSSSVISGLAQGSGEYFTRLG  167

Query  418  VGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            VGTP +Y +MVLDTGSD+VW+QC+PC+KCY+Q
Sbjct  168  VGTPARYVYMVLDTGSDIVWIQCAPCKKCYSQ  199



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 115/164 (70%), Gaps = 17/164 (10%)
 Frame = +1

Query  61   PIFASL-DYQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPD-----DSENTLSLDLHH  210
            P F+SL  +QTL  +   LP+A   S    S+P  S++L+  +     DSE++++L+L H
Sbjct  20   PCFSSLPSFQTLIPNSHSLPSASPISFQPESEPD-SESLLGSEFESGSDSESSITLNLDH  78

Query  211  IDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSVISGL  381
            ID +SS   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R   FSSSV+SGL
Sbjct  79   IDALSS---NKTPQELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPRTGGFSSSVVSGL  135

Query  382  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  136  SQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  179



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 102/147 (69%), Gaps = 8/147 (5%)
 Frame = +1

Query  73   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPK  252
            SL+YQTL   PL +    S +     S++     +S  T S+ LHH+D +S    N+TP+
Sbjct  25   SLNYQTLVANPLRSQPTLSWTD----SESPTDTAESSATFSVQLHHVDALS---FNSTPE  77

Query  253  ALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  432
             LF  RLQRDAAR +A+S LA  A       G  FSSSVISGLAQGSGEYFTR+GVGTPP
Sbjct  78   TLFTTRLQRDAARVEAISYLAETAGTGKRV-GTGFSSSVISGLAQGSGEYFTRIGVGTPP  136

Query  433  KYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +Y +MVLDTGSD+VW+QC+PC++CYAQ
Sbjct  137  RYVYMVLDTGSDIVWIQCAPCKRCYAQ  163



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 112/164 (68%), Gaps = 16/164 (10%)
 Frame = +1

Query  61   PIFASL-DYQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPD-----DSENTLSLDLHH  210
            P F+SL  +QTL  S   LP+A   S    S+P     L   +     DSE++++L+L H
Sbjct  20   PTFSSLPTFQTLIPSSHSLPSASPTSFQPESEPDSESLLGGSESEYGSDSESSITLNLDH  79

Query  211  IDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSVISGL  381
            ID +S+   N TP+ LF  RLQRD+ R ++++ LAA  P  NAT   R   FSSSV+SGL
Sbjct  80   IDALST---NRTPQELFSFRLQRDSRRVESIATLAARIPRRNATHAPRTVGFSSSVVSGL  136

Query  382  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCRKCY+Q
Sbjct  137  SQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRKCYSQ  180



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 105/151 (70%), Gaps = 10/151 (7%)
 Frame = +1

Query  82   YQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            YQTL  +   LP+A   S    S+P     +    DSE++++L+L HID +S+   N TP
Sbjct  28   YQTLVPTSHSLPSASPISFQPESEPVSESLIGSGSDSESSITLNLDHIDALST---NRTP  84

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGV  420
            + LF  RLQRD+ R K+++ LAA  P  N T   R   FSSSV+SGL+QGSGEYFTRLGV
Sbjct  85   EELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSSSVVSGLSQGSGEYFTRLGV  144

Query  421  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  145  GTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  175



>emb|CBI40559.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 16/157 (10%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQ-----PDDSENTLSLDLHHIDLISSAAVN  240
            L+YQ+L +RPL   ++ +  S+  +++T  Q       +++ T+++ L H D++   A N
Sbjct  60   LEYQSLVVRPL--GENPTTKSQLSWTETETQISTLPVSETDPTMTMHLEHRDVL---AFN  114

Query  241  ATPKALFVKRLQRDaarakalsllaaaaPPH----NAT--RGRDFSSSVISGLAQGSGEY  402
            ATP+ALF  RLQRDA R +ALS +AAAA       N T  +G  FSSSV SGLAQGSGEY
Sbjct  115  ATPEALFNLRLQRDAFRVEALSKMAAAAGGRRAGRNGTHAQGGGFSSSVTSGLAQGSGEY  174

Query  403  FTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            FTRLGVGTPPKY +MVLDTGSDVVW+QC+PCRKCY+Q
Sbjct  175  FTRLGVGTPPKYVYMVLDTGSDVVWIQCAPCRKCYSQ  211



>ref|XP_008351846.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 90/116 (78%), Gaps = 10/116 (9%)
 Frame = +1

Query  184  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----  348
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGXVP  125

Query  349  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCR+CY Q
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQ  181



>ref|XP_008343434.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 90/116 (78%), Gaps = 10/116 (9%)
 Frame = +1

Query  184  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----  348
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGRVP  125

Query  349  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCR+CY Q
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQ  181



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 16/157 (10%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQ-----PDDSENTLSLDLHHIDLISSAAVN  240
            L+YQ+L +RPL   ++ +  S+  +++T  Q       +++ T+++ L H D++   A N
Sbjct  33   LEYQSLVVRPL--GENPTTKSQLSWTETETQISTLPVSETDPTMTMHLEHRDVL---AFN  87

Query  241  ATPKALFVKRLQRDaarakalsllaaaaPPH----NAT--RGRDFSSSVISGLAQGSGEY  402
            ATP+ALF  RLQRDA R +ALS +AAAA       N T  +G  FSSSV SGLAQGSGEY
Sbjct  88   ATPEALFNLRLQRDAFRVEALSKMAAAAGGRRAGRNGTHAQGGGFSSSVTSGLAQGSGEY  147

Query  403  FTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            FTRLGVGTPPKY +MVLDTGSDVVW+QC+PCRKCY+Q
Sbjct  148  FTRLGVGTPPKYVYMVLDTGSDVVWIQCAPCRKCYSQ  184



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 106/156 (68%), Gaps = 15/156 (10%)
 Frame = +1

Query  82   YQTLSLRPLPT------AQHYSLSSKPQYSQTLVQPDDSE----NTLSLDLHHIDLISSA  231
            +QTL++ PLP       A   + +     +QTL     SE     +LS+ LHH+D +SS 
Sbjct  34   FQTLTVNPLPNKPTLSWADTETETESEPEAQTLTDSTFSEASTTTSLSVQLHHLDALSS-  92

Query  232  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSVISGLAQGSGEYF  405
              + TP+ LF  RL RDA+R K+L+ LAAA    N TR R   FSSSVISGLAQGSGEYF
Sbjct  93   --DKTPQDLFNSRLARDASRVKSLTSLAAATGRTNRTRARGPGFSSSVISGLAQGSGEYF  150

Query  406  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            TRLGVGTP +Y FMVLDTGSD+VW+QC+PC+KCY+Q
Sbjct  151  TRLGVGTPARYVFMVLDTGSDIVWIQCAPCKKCYSQ  186



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 96/141 (68%), Gaps = 7/141 (5%)
 Frame = +1

Query  97   LRPLPTAQHYSLSSKPQYSQTLVQPDD--SENTLSLDLHHIDLISSAAVNATPKALFVKR  270
            +R LP     +     Q S ++ +  D   + +LSL LHHID +SS   + TP+ LF  R
Sbjct  44   IRSLPNPSTLTWPESEQESLSIPESVDPIEQESLSLQLHHIDTLSS---DKTPQQLFHLR  100

Query  271  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  450
            LQRDAAR ++ +       PH +  G  FSSS++SGL+QGSGEYFTR+GVGTP +Y FMV
Sbjct  101  LQRDAARVESFATALNKTRPHRSATG--FSSSIVSGLSQGSGEYFTRIGVGTPARYVFMV  158

Query  451  LDTGSDVVWLQCSPCRKCYAQ  513
            LDTGSDVVWLQC+PCRKCY+Q
Sbjct  159  LDTGSDVVWLQCAPCRKCYSQ  179



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 98/148 (66%), Gaps = 19/148 (13%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            A+ ++QTL+LR LPT     L    Q  Q+   PD     L+LDLHH+D   S ++N TP
Sbjct  19   AASEFQTLTLRSLPTPSPLPLFPDSQSLQS--SPD---APLTLDLHHLD---SLSLNKTP  70

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTP  429
              LF  RL RD  R  AL+           +R   FSSSV+SGL+QGSGEYFTRLGVGTP
Sbjct  71   TDLFNLRLHRDTLRVHALN-----------SRAAGFSSSVVSGLSQGSGEYFTRLGVGTP  119

Query  430  PKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P+Y +MVLDTGSDVVWLQCSPCRKCY+Q
Sbjct  120  PRYLYMVLDTGSDVVWLQCSPCRKCYSQ  147



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 8/141 (6%)
 Frame = +1

Query  91   LSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKR  270
            LS+  LP A   +L S P+  + L  P+     LSL LHH+D +S+   N TP+ LF  R
Sbjct  35   LSINSLPNAP--TLPS-PESEELLSIPESDPQPLSLQLHHVDALSN---NKTPQQLFHLR  88

Query  271  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  450
            LQRDAAR ++ +L AA    H +  G  FSSS++SGL+QGSGEYFTR+GVGTP KY FMV
Sbjct  89   LQRDAARVESFTLAAALNQSHRS--GSGFSSSIVSGLSQGSGEYFTRIGVGTPAKYVFMV  146

Query  451  LDTGSDVVWLQCSPCRKCYAQ  513
            LDTGSDVVWLQC+PCRKCY+Q
Sbjct  147  LDTGSDVVWLQCAPCRKCYSQ  167



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 98/148 (66%), Gaps = 18/148 (12%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            A+ ++QTL+LR LPT    SL    +  Q+          L+LDLHH+D   S ++N TP
Sbjct  82   AASEFQTLTLRSLPTPSPLSLFPDSESLQS-----SPAAALTLDLHHLD---SLSLNKTP  133

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTP  429
              LF  RL RDA R  AL+          A  G  FSSSVISGLAQGSGEYFTRLGVGTP
Sbjct  134  TDLFNLRLHRDALRVHALTS--------RAAPG--FSSSVISGLAQGSGEYFTRLGVGTP  183

Query  430  PKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P+Y +MVLDTGSDVVWLQCSPCRKCY+Q
Sbjct  184  PRYLYMVLDTGSDVVWLQCSPCRKCYSQ  211



>ref|XP_002320868.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE99183.1| aspartyl protease family protein [Populus trichocarpa]
Length=488

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 101/152 (66%), Gaps = 11/152 (7%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLV-----QPDDSENT-LSLDLHHIDLISSAAVNA  243
            +QTL+L PLP     S +     +QT       +P  S  T LS+ LHHID +SS   + 
Sbjct  34   FQTLTLNPLPNKPTISWADTEPGTQTFTDQTTSEPSSSATTFLSVQLHHIDALSS---DK  90

Query  244  TPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSVISGLAQGSGEYFTRLG  417
            + + LF  RL RDAAR K+L  LAA     N TR R   FSSSVISGLAQGSGEYFTRLG
Sbjct  91   SSQDLFNSRLVRDAARVKSLISLAATVGGTNLTRARGPGFSSSVISGLAQGSGEYFTRLG  150

Query  418  VGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            VGTP +Y +MVLDTGSD+VW+QC+PC KCY+Q
Sbjct  151  VGTPARYVYMVLDTGSDIVWIQCAPCIKCYSQ  182



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 103/170 (61%), Gaps = 38/170 (22%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPD-DSENT-------------------LS  195
            L+Y+TL L  LP  Q           QTL  PD +SE T                   +S
Sbjct  31   LEYETLLLTSLPIPQ-----------QTLSWPDSESELTGSDLESETAAAEETETSLSIS  79

Query  196  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD----FSS  363
              LHHID +S+   + +P+ LF  RLQRDA R K L  + AAA   N +R R     FSS
Sbjct  80   AQLHHIDALSA---DKSPEQLFDLRLQRDALRVKNLVEVTAAAASRNVSRTRGAAPGFSS  136

Query  364  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            SVISGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCRKCY Q
Sbjct  137  SVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRKCYTQ  186



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 104/153 (68%), Gaps = 8/153 (5%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQH---YSLSSKPQY---SQTLVQPDDSENTLSLDLHHIDLISSAAV  237
            LD QT     LP       ++   +PQ     +T    +   N  SL+LHH+D +S  + 
Sbjct  31   LDCQTFIPNSLPKPTQSPSWTSDGEPQTILSQETAAGTEFQSNNFSLELHHVDALS-LSP  89

Query  238  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRL  414
            +A+P++LF  RLQRDA RAK++S +A+         GR +FSSSVISGL+QGSGEYFTRL
Sbjct  90   HASPESLFNLRLQRDAFRAKSISDMASGRGRQGVGLGRMNFSSSVISGLSQGSGEYFTRL  149

Query  415  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            G+GTPPKY++MVLDTGSDVVW+QCSPC+KCY Q
Sbjct  150  GIGTPPKYSYMVLDTGSDVVWIQCSPCKKCYTQ  182



>ref|XP_010053832.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW78191.1| hypothetical protein EUGRSUZ_D02381 [Eucalyptus grandis]
Length=485

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 110/153 (72%), Gaps = 13/153 (8%)
 Frame = +1

Query  85   QTLSLRPLPT-----AQHYSLSSKPQYSQTLVQPDDSENT-LSLDLHHIDLISSAAVNAT  246
            Q L LRPLP+     +   S ++    S+T  + D +  T LS++L H+D +S    N T
Sbjct  31   QPLVLRPLPSRPAPASWPESEAAASLSSETEAESDSAATTSLSVELQHVDALS---FNLT  87

Query  247  PKALFVKRLQRDaarakals---llaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRL  414
            P+ALF  RLQRDA+R +++S   + AAAAP  N +R R  FSSSV+SGLAQGSGEYFTRL
Sbjct  88   PQALFHLRLQRDASRVQSISDLAVAAAAAPAGNVSRPRLGFSSSVVSGLAQGSGEYFTRL  147

Query  415  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GVGTPP+Y +MVLDTGSDVVW+QC+PCRKCY+Q
Sbjct  148  GVGTPPRYVYMVLDTGSDVVWIQCAPCRKCYSQ  180



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  369
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T    FSSSV
Sbjct  74   ITLNLDHIDALSS---NKTPQELFSSRLQRDSKRVQSIATLAARVPRRNVTHAPGFSSSV  130

Query  370  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  131  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  178



>ref|XP_009336767.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=485

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 87/114 (76%), Gaps = 11/114 (10%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG------R  351
            LS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAA+  P+  TRG      R
Sbjct  72   LSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAS--PNRTTRGGGRVPVR  126

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCR+CY Q
Sbjct  127  GFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQ  180



>gb|KJB49569.1| hypothetical protein B456_008G125700 [Gossypium raimondii]
Length=488

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 102/154 (66%), Gaps = 14/154 (9%)
 Frame = +1

Query  85   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPDD----SENT---LSLDLHHIDLISSAAVNA  243
             +L LRPLP+A   S         +LV+  D    + NT   L L+LHH+D +SS     
Sbjct  33   HSLLLRPLPSAPVLSWQDSDLPFNSLVETSDLDTVNSNTSLGLQLELHHLDALSS---EE  89

Query  244  TPKALFVKRLQRDaarakalsllaaaaP----PHNATRGRDFSSSVISGLAQGSGEYFTR  411
            TP+ LF  RLQRDA RA+ ++ L + A     P    R   FSSSVISGLAQGSGEYFTR
Sbjct  90   TPERLFDLRLQRDALRAETINSLVSKAVARKHPRAPGRRPGFSSSVISGLAQGSGEYFTR  149

Query  412  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            LGVGTPP+Y +MVLDTGSDV+W+QCSPC+KCY+Q
Sbjct  150  LGVGTPPRYLYMVLDTGSDVIWVQCSPCKKCYSQ  183



>ref|XP_010266550.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=484

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 89/116 (77%), Gaps = 8/116 (7%)
 Frame = +1

Query  181  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP---HNATR--  345
            +  L+  L H D +   A N TP+ALF  RL+RDAAR ++LS +AA APP    NATR  
Sbjct  65   QTILTARLEHRDAL---AFNVTPEALFHLRLERDAARVESLSTMAAGAPPVTSRNATRSR  121

Query  346  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            G  FSSSVISGL+QGSGEYFTR+GVGTPP+Y +MVLDTGSD+VW+QC+PCRKCY Q
Sbjct  122  GNGFSSSVISGLSQGSGEYFTRIGVGTPPRYVYMVLDTGSDIVWIQCAPCRKCYTQ  177



>ref|XP_008376086.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=487

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 86/117 (74%), Gaps = 10/117 (9%)
 Frame = +1

Query  184  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa-arakalsllaaaaPPHNATRG----  348
            NTLS+ LHHID +   A+N TP  LF  RLQRDA       +L AAAA P+  TRG    
Sbjct  69   NTLSVQLHHIDAM---ALNKTPTQLFHLRLQRDAFRVKALTTLAAAAASPNRTTRGGGHV  125

Query  349  --RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
                FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PC++CY Q
Sbjct  126  PVTGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCKRCYTQ  182



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 99/149 (66%), Gaps = 9/149 (6%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            A+L +QT S   LP    +     P+ S+  +Q D S    SL L H+D +  +  +A+P
Sbjct  17   AALPFQTFSPTSLPRPLAF-----PE-SEEALQEDYSP--ASLGLFHVDDVYYSGADASP  68

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNAT-RGRDFSSSVISGLAQGSGEYFTRLGVGT  426
            + LF  RL+RDA R + LS     A   N + R RDFSSSV SGL+QGSGEYFTR+G+GT
Sbjct  69   ELLFQFRLRRDAIRVRDLSAAVVEAAARNVSGRARDFSSSVTSGLSQGSGEYFTRIGIGT  128

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PP+Y +MVLDTGSDVVW+QCSPC KCY+Q
Sbjct  129  PPRYVYMVLDTGSDVVWIQCSPCTKCYSQ  157



>ref|XP_004306664.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=467

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 102/148 (69%), Gaps = 13/148 (9%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  258
            D+QTL L PLP+A   SLS    +S+T  +PD   ++LSL LHH+D +SS   + TP  L
Sbjct  24   DHQTLLLSPLPSAP--SLSQPESFSETTSEPDSDPSSLSLPLHHLDALSS---DQTPSQL  78

Query  259  FVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS---GLAQGSGEYFTRLGVGTP  429
            F  RL+RD+ R  +L+ LA     +N TR    S    S   GL+QGSGEYFTR+GVG+P
Sbjct  79   FHLRLRRDSLRFNSLTSLA-----YNRTRPGPSSGFSSSIVSGLSQGSGEYFTRIGVGSP  133

Query  430  PKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PKY +MVLDTGSDVVWLQC+PC++CY+Q
Sbjct  134  PKYLYMVLDTGSDVVWLQCAPCKRCYSQ  161



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  360
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRPGGFS  128

Query  361  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  179



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 6/111 (5%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  360
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVRSIATLAAQIPGRNVTHAPRPGGFS  128

Query  361  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  179



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 101/162 (62%), Gaps = 29/162 (18%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSL----------------DLHHI  213
            +QTL++ PLP        +KP  S     P+    T +L                 LHH+
Sbjct  34   FQTLTVNPLP--------NKPTLSWADTGPESEPETQTLTDSTSTEASTTTSLSVQLHHL  85

Query  214  DLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSVISGLAQ  387
            D +SS   + TP+ LF  RL RDA+R K+L+ LAAA    N TR R   FSSSV SGLAQ
Sbjct  86   DALSS---DETPQDLFNSRLARDASRVKSLTSLAAAVGSTNRTRARGPGFSSSVTSGLAQ  142

Query  388  GSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GSGEYFTRLGVGTP +Y FMVLDTGSDVVW+QC+PC+KCY+Q
Sbjct  143  GSGEYFTRLGVGTPARYVFMVLDTGSDVVWIQCAPCKKCYSQ  184



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  360
            ++L+L HID +SS   N TP  LF  RLQRD+ R K+++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPDELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPRPGGFS  128

Query  361  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  179



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 105/151 (70%), Gaps = 10/151 (7%)
 Frame = +1

Query  82   YQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            YQTL  +   LP+A   S    S+P     +    DS+++++L+L HID +S+   N TP
Sbjct  28   YQTLVPTSHSLPSASPTSFQPESEPVSESLIGSGSDSDSSITLNLDHIDALST---NRTP  84

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGV  420
            + LF  RLQRD+ R K+++ LAA  P  N T   R   FSSSV+SGL+QGSGEYFTRLGV
Sbjct  85   EELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSSSVVSGLSQGSGEYFTRLGV  144

Query  421  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  145  GTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  175



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 105/151 (70%), Gaps = 10/151 (7%)
 Frame = +1

Query  82   YQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            YQTL  +   LP+A   S    S+P     +    DS+++++L+L HID +S+   N TP
Sbjct  28   YQTLVPTSHSLPSASPTSFQPESEPVSESLIGSGSDSDSSITLNLDHIDALST---NRTP  84

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGV  420
            + LF  RLQRD+ R K+++ LAA  P  N T   R   FSSSV+SGL+QGSGEYFTRLGV
Sbjct  85   EELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSSSVVSGLSQGSGEYFTRLGV  144

Query  421  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  145  GTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  175



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  369
            ++L+L HID +++   N TP+ LF  RLQRD+ R K+++ LA+     +A R   FSSSV
Sbjct  67   ITLNLDHIDALTT---NRTPQELFTSRLQRDSKRVKSIATLASQRNTTHAPRTGTFSSSV  123

Query  370  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PC++CY+Q
Sbjct  124  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCKRCYSQ  171



>ref|XP_007147317.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
 gb|ESW19311.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
Length=534

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 99/142 (70%), Gaps = 8/142 (6%)
 Frame = +1

Query  88   TLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVK  267
            TLSL  LP   H    S PQ ++ L +PD  E  LSL+LHHID +SS   N TP+ LF  
Sbjct  96   TLSLHSLP---HSPTLSWPQ-AEALAEPD-PEEALSLNLHHIDALSS---NKTPEQLFHL  147

Query  268  RLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  447
            RLQRD  R ++L  LAA    H    G  FSSS+ISGLAQGSGEYFTR+GVGTP KY +M
Sbjct  148  RLQRDGKRVQSLLTLAALNSSHARRSGSGFSSSIISGLAQGSGEYFTRIGVGTPAKYVYM  207

Query  448  VLDTGSDVVWLQCSPCRKCYAQ  513
            VLDTGSDVVWLQC+PCRKCY Q
Sbjct  208  VLDTGSDVVWLQCAPCRKCYTQ  229



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 97/149 (65%), Gaps = 7/149 (5%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            YQTL +  LP+A   S       +    QP+ + ++LS+ L H+D + S + +A+P ALF
Sbjct  29   YQTLVVNTLPSASTLSWPDSESLTGE-SQPESTTSSLSVHLSHVDALYSFS-DASPTALF  86

Query  262  VKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  426
              RLQRD+ R +++S LAA +   N TR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  87   NLRLQRDSLRVESISSLAAVSTGRNVTRRTPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  146

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  147  PATNVYMVLDTGSDVVWLQCSPCKACYNQ  175



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 99/155 (64%), Gaps = 18/155 (12%)
 Frame = +1

Query  88   TLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE------NTLSLDLHHIDLISSAAVNATP  249
            TL+L  LP     SL    Q+ QT    ++ E      +T +L L H+D +SS   + TP
Sbjct  29   TLTLNSLPKPS--SLHPDQQWVQTTQTLEELELSTSIDSTFTLHLEHLDALSS---HLTP  83

Query  250  KALFVKRLQRDaaraka--lsllaaaaPPHNATRG-----RDFSSSVISGLAQGSGEYFT  408
            + LF  RL+RD ARAK       +++   H   R      RDFSSS++SGL+QGSGEYFT
Sbjct  84   EELFSFRLKRDDARAKTIFARAHSSSRSAHKHGRNASHSTRDFSSSIVSGLSQGSGEYFT  143

Query  409  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            RLGVGTPPKY +MVLDTGSD+VW+QC+PC+KCY Q
Sbjct  144  RLGVGTPPKYMYMVLDTGSDIVWIQCTPCKKCYDQ  178



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 99/151 (66%), Gaps = 11/151 (7%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            YQTL +  LP++   S    P  S++  + + +  +LS+ L HID +SS + ++TP  LF
Sbjct  28   YQTLIVNTLPSSPTLSW---PDQSESEFKSESTTTSLSVHLSHIDALSSFS-DSTPSELF  83

Query  262  VKRLQRDaarakalsllaaaaPPHNATRGR-------DFSSSVISGLAQGSGEYFTRLGV  420
              RL+RD+ R  +++ LAA +   N TR +        FS +VISGL+QGSGEYF RLGV
Sbjct  84   NLRLRRDSLRVNSITKLAAVSTGRNITRKKRTPKSSGGFSGAVISGLSQGSGEYFMRLGV  143

Query  421  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GTP   A+MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  144  GTPATNAYMVLDTGSDVVWLQCSPCKVCYNQ  174



>ref|XP_002878415.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54674.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 97/149 (65%), Gaps = 8/149 (5%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            YQTL +  LP++   S      +S   V   +S  +LS+ L H+D +SS + +A+P  LF
Sbjct  30   YQTLVVNTLPSSATLSWPESKSFSDESVS--ESTTSLSVHLSHVDALSSFS-DASPVDLF  86

Query  262  VKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  426
              RLQRD+ R K+++ LAA +   NAT+        FS +VISGL+QGSGEYF RLGVGT
Sbjct  87   KLRLQRDSLRVKSITSLAAVSTGRNATKRTPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  146

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  147  PATNVYMVLDTGSDVVWLQCSPCKACYNQ  175



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 97/149 (65%), Gaps = 7/149 (5%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            YQTL +  LP+A   S       +    QP+ + ++LS+ L H+D + S + +A+P  LF
Sbjct  31   YQTLVVNTLPSAATLSWPDSESLAGE-SQPESTTSSLSVHLSHVDALFSFS-DASPTDLF  88

Query  262  VKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  426
              RLQRD+ R +++S LAA +   NATR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  89   NLRLQRDSLRVESISSLAAVSTGRNATRRTPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  148

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  149  PATNVYMVLDTGSDVVWLQCSPCKACYNQ  177



>emb|CDY43952.1| BnaC04g21580D [Brassica napus]
Length=483

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 98/149 (66%), Gaps = 10/149 (7%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            Y TL +   P++    + S P+ S++L  P  S  +LSL L HID ISS + +A+P  LF
Sbjct  29   YNTLVVNTFPSSP---ILSSPE-SESLTTPSQSTTSLSLHLSHIDAISSFS-DASPAELF  83

Query  262  VKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  426
              RL+RD+ R ++L+ LAA +   N TR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  84   DLRLKRDSIRVESLTSLAAVSSRRNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  143

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P    +MVLDTGSDVVWLQC+PC+ CY Q
Sbjct  144  PATNMYMVLDTGSDVVWLQCAPCKVCYNQ  172



>emb|CDX89133.1| BnaA04g00530D [Brassica napus]
Length=483

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 99/149 (66%), Gaps = 10/149 (7%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            Y TL +  LP++    + S P+ S++L     S  +LSL L H+D ISS + +A+P  LF
Sbjct  29   YNTLVVNTLPSSP---ILSSPE-SESLTTVSQSTTSLSLHLSHVDAISSFS-DASPAELF  83

Query  262  VKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  426
              RL+RD+ R ++L+ LAA +   N TR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  84   NLRLKRDSLRVESLTTLAAVSSRRNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  143

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P K  +MVLDTGSDVVWLQC+PC+ CY Q
Sbjct  144  PAKNMYMVLDTGSDVVWLQCAPCKVCYNQ  172



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +1

Query  199  DLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSV  369
            +L HID +SS   N TP  LF  RL RD+ R K++  LAA  P  N T   R   FSSSV
Sbjct  71   NLDHIDALSS---NKTPDELFSSRLLRDSRRVKSIVTLAARVPRRNVTHAPRPGGFSSSV  127

Query  370  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  128  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  175



>ref|XP_009138753.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=483

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 98/149 (66%), Gaps = 10/149 (7%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            Y TL +  LP++    + S P+ S++L     S  +LSL L H+D ISS A +A+P  LF
Sbjct  29   YNTLVVNTLPSSP---ILSSPE-SESLTTVSQSTTSLSLHLSHVDAISSFA-DASPAELF  83

Query  262  VKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  426
              RL+RD+ R ++L+ LAA +   N TR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  84   NLRLKRDSLRVESLTTLAAVSSRRNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  143

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P    +MVLDTGSDVVWLQC+PC+ CY Q
Sbjct  144  PATNMYMVLDTGSDVVWLQCAPCKVCYNQ  172



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  258
            D+QTL LR LP++  +     P  S + +  + +E T      H+  + + + N TP+ L
Sbjct  29   DFQTLILRSLPSSPSF----LPSDSNSFLSSEATE-TELGLELHLHHLDALSFNRTPEEL  83

Query  259  FVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPK  435
            F  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+GVGTPPK
Sbjct  84   FHLRLQRDAIRVKKLSSLGATSRNLSRPSGTTGFSSSVISGLAQGSGEYFTRIGVGTPPK  143

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            Y +MVLDTGSD+VWLQC+PC+ CY+Q
Sbjct  144  YVYMVLDTGSDIVWLQCAPCKNCYSQ  169



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 98/153 (64%), Gaps = 7/153 (5%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            +S  YQTL +  LP+    S       +    QP+ + ++LS+ L H+D +SS + +A+P
Sbjct  22   SSSQYQTLVVNTLPSPATLSWPDSESLTGE-SQPESTTSSLSVHLSHVDALSSLS-DASP  79

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRL  414
              LF  RLQRD+ R ++++ LAA +   N TR        FS +VISGL+QGSGEYF RL
Sbjct  80   TDLFNLRLQRDSLRVESIASLAAVSTGRNVTRKTPRSAGGFSGAVISGLSQGSGEYFMRL  139

Query  415  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GVGTP    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  140  GVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQ  172



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +1

Query  202  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGL  381
            LHHID +S+   N TP+ LF  RL RD+ R ++++ L       +A     FSSSVISGL
Sbjct  61   LHHIDALSA---NKTPEQLFHLRLHRDSRRVESIAALTRRGNASHAPSAAGFSSSVISGL  117

Query  382  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +QGSGEYFTR+GVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  118  SQGSGEYFTRIGVGTPARYLYMVLDTGSDIVWLQCAPCRRCYSQ  161



>gb|AGV54495.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=476

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE---NTLSLDLHHIDLISSAAVNAT  246
            L  QTL LR LP     S      + ++     DSE   +T+S+++HHID +S   +N T
Sbjct  32   LKSQTLILRNLPNPPTLS------WPESTTLGSDSEPDPDTISVNVHHIDALS---LNKT  82

Query  247  PKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  426
            P  LF  RLQRDAAR K+LS LAA       T G  FSSSVISGLAQGSGEYFTRLGVGT
Sbjct  83   PSQLFHFRLQRDAARVKSLSSLAALNQTRPTTSGSGFSSSVISGLAQGSGEYFTRLGVGT  142

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PPKY +MVLDTGSDVVWLQC PC KCY+Q
Sbjct  143  PPKYVYMVLDTGSDVVWLQCKPCAKCYSQ  171



>ref|XP_007135265.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
 gb|ESW07259.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
Length=477

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE---NTLSLDLHHIDLISSAAVNAT  246
            L  QTL LR LP     S      + ++     DSE   +T+S+++HHID +S   +N T
Sbjct  32   LKSQTLILRNLPNPPTLS------WPESTTLGSDSEPDPDTISVNVHHIDALS---LNKT  82

Query  247  PKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  426
            P  LF  RLQRDAAR K+LS LAA       T G  FSSSVISGLAQGSGEYFTRLGVGT
Sbjct  83   PSQLFHFRLQRDAARVKSLSSLAALNQTRPTTSGSGFSSSVISGLAQGSGEYFTRLGVGT  142

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PPKY +MVLDTGSDVVWLQC PC KCY+Q
Sbjct  143  PPKYVYMVLDTGSDVVWLQCKPCAKCYSQ  171



>gb|AGV54447.1| aspartic proteinase nepenthesin-1 precursor [Phaseolus vulgaris]
Length=477

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE---NTLSLDLHHIDLISSAAVNAT  246
            L  QTL LR LP     S      + ++     DSE   +T+S+++HHID +S   +N T
Sbjct  32   LKSQTLILRNLPNPPTLS------WPESTTLGSDSEPDPDTISVNVHHIDALS---LNKT  82

Query  247  PKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  426
            P  LF  RLQRDAAR K+LS LAA       T G  FSSSVISGLAQGSGEYFTRLGVGT
Sbjct  83   PSQLFHFRLQRDAARVKSLSSLAALNQTRPTTSGSGFSSSVISGLAQGSGEYFTRLGVGT  142

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PPKY +MVLDTGSDVVWLQC PC KCY+Q
Sbjct  143  PPKYVYMVLDTGSDVVWLQCKPCAKCYSQ  171



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 97/149 (65%), Gaps = 9/149 (6%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            Y TL +  LP++Q +S       + T+    DS  +L++ L H+D +SS + +A+P  LF
Sbjct  29   YNTLIVNTLPSSQIFSSPEPGSLTSTVF---DSITSLTVHLSHVDALSSFS-DASPLELF  84

Query  262  VKRLQRDaarakalsllaaaaPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGT  426
              RL+RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGT
Sbjct  85   NLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGT  144

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  145  PATNVYMVLDTGSDVVWLQCSPCKVCYNQ  173



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 97/154 (63%), Gaps = 14/154 (9%)
 Frame = +1

Query  85   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPDD-----SENTLS--LDLHHIDLISSAAVNA  243
            QTL  R LP+    S       S +LV+  D     S  TL   L+LHH+D  SS  +  
Sbjct  33   QTLVPRTLPSPSTLSGQDSELESDSLVETSDLDTVNSNTTLEVQLELHHVDAFSSEEI--  90

Query  244  TPKALFVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  411
             P+ LF  RLQRD  RA+     ++   A  PP    R   FSSS+ISGLAQGSGEYFTR
Sbjct  91   -PERLFDLRLQRDELRAETINSLVAKAVARNPPRAPGRRSGFSSSIISGLAQGSGEYFTR  149

Query  412  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            LGVGTPP+Y +MVLDTGSDVVW+QCSPC+KCY+Q
Sbjct  150  LGVGTPPRYLYMVLDTGSDVVWVQCSPCKKCYSQ  183



>gb|AAK64003.1| AT3g61820/F15G16_210 [Arabidopsis thaliana]
Length=362

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 100/153 (65%), Gaps = 8/153 (5%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            AS  YQTL +  LP++   +LS     S T     +S  +LS+ L H+D +SS + +A+P
Sbjct  23   ASSQYQTLVVNTLPSSA--TLSWPESESLTDESLSESTTSLSVHLSHVDALSSFS-DASP  79

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRL  414
              LF  RLQRD+ R K+++ LAA +   NAT+        FS +VISGL+QGSGEYF RL
Sbjct  80   ADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFSGAVISGLSQGSGEYFMRL  139

Query  415  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GVGTP    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  140  GVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQ  172



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  258
            D+QTL L  LP++  +     P  S + +  + +++ L L+LH    + + + N TP+ L
Sbjct  26   DFQTLPLTSLPSSPSF----LPSDSNSFLSSEATQSELGLELHLHH-LDALSFNRTPEEL  80

Query  259  FVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPK  435
            F  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+GVGTPPK
Sbjct  81   FHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFTRIGVGTPPK  140

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            Y +MVLDTGSD+VWLQC+PC+ CY+Q
Sbjct  141  YVYMVLDTGSDIVWLQCAPCKNCYSQ  166



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  258
            D+QTL L  LP++  +     P  S + +  + +++ L L+LH    + + + N TP+ L
Sbjct  67   DFQTLPLTSLPSSPSF----LPSDSNSFLSSEATQSELGLELHLHH-LDALSFNRTPEEL  121

Query  259  FVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPK  435
            F  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+GVGTPPK
Sbjct  122  FHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFTRIGVGTPPK  181

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            Y +MVLDTGSD+VWLQC+PC+ CY+Q
Sbjct  182  YVYMVLDTGSDIVWLQCAPCKNCYSQ  207



>ref|XP_007051536.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95693.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=557

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 97/154 (63%), Gaps = 14/154 (9%)
 Frame = +1

Query  85   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPDD-----SENTLS--LDLHHIDLISSAAVNA  243
            QTL  R LP+    S       S +LV+  D     S  TL   L+LHH+D  SS  +  
Sbjct  33   QTLVPRTLPSPSTLSGQDSELESDSLVETSDLDTVNSNTTLEVQLELHHVDAFSSEEI--  90

Query  244  TPKALFVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  411
             P+ LF  RLQRD  RA+     ++   A  PP    R   FSSS+ISGLAQGSGEYFTR
Sbjct  91   -PERLFDLRLQRDELRAETINSLVAKAVARNPPRAPGRRSGFSSSIISGLAQGSGEYFTR  149

Query  412  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            LGVGTPP+Y +MVLDTGSDVVW+QCSPC+KCY+Q
Sbjct  150  LGVGTPPRYLYMVLDTGSDVVWVQCSPCKKCYSQ  183



>ref|NP_191741.1| aspartyl protease [Arabidopsis thaliana]
 emb|CAB71112.1| putative protein [Arabidopsis thaliana]
 gb|AEE80260.1| aspartyl protease [Arabidopsis thaliana]
Length=483

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 100/153 (65%), Gaps = 8/153 (5%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            AS  YQTL +  LP++   +LS     S T     +S  +LS+ L H+D +SS + +A+P
Sbjct  23   ASSQYQTLVVNTLPSSA--TLSWPESESLTDESLSESTTSLSVHLSHVDALSSFS-DASP  79

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRL  414
              LF  RLQRD+ R K+++ LAA +   NAT+        FS +VISGL+QGSGEYF RL
Sbjct  80   ADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFSGAVISGLSQGSGEYFMRL  139

Query  415  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GVGTP    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  140  GVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQ  172



>ref|XP_010544842.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=510

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 91/151 (60%), Gaps = 5/151 (3%)
 Frame = +1

Query  70   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP  249
            ++L +QTL + PLPT+   S       +       ++  +LS  L H+D +S +  + +P
Sbjct  58   STLRHQTLVVNPLPTSPTLSWPDSEFVTDGSDSLSETATSLSAQLLHVDALSPS--DTSP  115

Query  250  KALFVKRLQRDa---arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGV  420
            + LF  RL+RD+       + +  +     H       FS +V+SGL+QGSGEYFTRLGV
Sbjct  116  EHLFDLRLRRDSLRVETLTSFAAASVRNVTHAPRAAGGFSGAVVSGLSQGSGEYFTRLGV  175

Query  421  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GTP  YA+MVLDTGSD+VWLQCSPC+ CY Q
Sbjct  176  GTPATYAYMVLDTGSDIVWLQCSPCKVCYNQ  206



>ref|XP_003554768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=472

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 81/108 (75%), Gaps = 3/108 (3%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  369
            LSL LHHID +SS   N TP+ LF  RLQRDA R + +  LAA    H    G  FSSS+
Sbjct  62   LSLHLHHIDALSS---NKTPEQLFQLRLQRDAKRVEGVVALAALNQSHARRSGSSFSSSI  118

Query  370  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            ISGLAQGSGEYFTR+GVGTP +Y +MVLDTGSDVVWLQC+PCRKCY Q
Sbjct  119  ISGLAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCYTQ  166



>ref|XP_010918360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=507

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 8/114 (7%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakal----sllaaaaPPHNATRGR--  351
            L + L H+D  S  A N+TP+ L   RL RD AR   L    +   AA     A RGR  
Sbjct  78   LRVRLAHLD--SLLAANSTPEHLLSLRLGRDVARVSNLHEILAAAMAAGNATRAIRGRRR  135

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             FSSSV+SGLAQGSGEYFTR+G+GTP +YA+MVLDTGSDVVWLQC+PCR+CY+Q
Sbjct  136  GFSSSVVSGLAQGSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQ  189



>ref|XP_009394177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 96/167 (57%), Gaps = 33/167 (20%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLS------------------LD  201
            L YQTL + PL        SSKP  S+     DD +  L+                  + 
Sbjct  30   LAYQTLVVTPLA-------SSKPLLSE---DADDGDENLASAVESETTLSSSPSSSLHVH  79

Query  202  LHHIDLISSAAVNATPKALFVKRLQRDaarakals---llaaaaPPHNATRGRDFSSSVI  372
            L H D  S  A     + +F+ RL RDAAR + LS    +A A P  N T  R FSS V+
Sbjct  80   LSHRD--SLLADTTAAEQIFLLRLDRDAARVETLSQILAVATAPPAANVTSRRGFSSKVV  137

Query  373  SGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            SGLAQGSGEYF R+G+GTP +YA+MVLDTGSDVVWLQC+PCR+CY+Q
Sbjct  138  SGLAQGSGEYFARIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQ  184



>ref|XP_010480432.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=488

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  360
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  75   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRSGGFS  131

Query  361  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q
Sbjct  132  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQ  182



>gb|KJB09628.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=446

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 97/154 (63%), Gaps = 14/154 (9%)
 Frame = +1

Query  85   QTLSLRPLPTAQHYSLSSKPQYSQTL-----VQPDDSENTLS--LDLHHIDLISSAAVNA  243
            QTL  RPLP+A   S       S +L     + P  S  TL   L+LHH+D +SS     
Sbjct  33   QTLLPRPLPSAPTLSWHDSEPESNSLEETSQLDPLSSNTTLEVQLELHHVDALSS---ED  89

Query  244  TPKALFVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  411
            TP+ LF  RLQRDA R+      +S   A  PP  A R   FSSS+ISGLAQGSGEYFTR
Sbjct  90   TPELLFDLRLQRDALRSGTIYSLVSKAVARNPPRAAGRRSGFSSSIISGLAQGSGEYFTR  149

Query  412  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            LGVGTP +  +MVLDTGSDVVW+QCSPC+ CY+Q
Sbjct  150  LGVGTPARNLYMVLDTGSDVVWVQCSPCKSCYSQ  183



>gb|KJB09626.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=488

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 97/154 (63%), Gaps = 14/154 (9%)
 Frame = +1

Query  85   QTLSLRPLPTAQHYSLSSKPQYSQTL-----VQPDDSENTLS--LDLHHIDLISSAAVNA  243
            QTL  RPLP+A   S       S +L     + P  S  TL   L+LHH+D +SS     
Sbjct  33   QTLLPRPLPSAPTLSWHDSEPESNSLEETSQLDPLSSNTTLEVQLELHHVDALSS---ED  89

Query  244  TPKALFVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  411
            TP+ LF  RLQRDA R+      +S   A  PP  A R   FSSS+ISGLAQGSGEYFTR
Sbjct  90   TPELLFDLRLQRDALRSGTIYSLVSKAVARNPPRAAGRRSGFSSSIISGLAQGSGEYFTR  149

Query  412  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            LGVGTP +  +MVLDTGSDVVW+QCSPC+ CY+Q
Sbjct  150  LGVGTPARNLYMVLDTGSDVVWVQCSPCKSCYSQ  183



>gb|KJB41527.1| hypothetical protein B456_007G108800, partial [Gossypium raimondii]
Length=460

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 96/156 (62%), Gaps = 14/156 (9%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDD----SENT---LSLDLHHIDLISSAA  234
            L  QTL LRP P+A   S +     S +LV+  +    S NT   + L+LHH+D  SS  
Sbjct  23   LQLQTLVLRPFPSAPTLSWTDAEPESDSLVEIFELNAVSFNTTLEMHLELHHLDAFSS--  80

Query  235  VNATPKALFVKRLQRDaarakalsllaaaaPPHN---ATRGRDFSSSVISGLAQGSGEYF  405
               T + LF   LQRD  RA+ +  L + A   N   AT    FSSS+I GLAQGSGEYF
Sbjct  81   -EETLERLFDLCLQRDMLRAETIYSLVSKAIACNRPRATGYLGFSSSIIFGLAQGSGEYF  139

Query  406  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            TRLGV T P+Y +MVLDTG DVVW+QCSPC+ CY+Q
Sbjct  140  TRLGVSTLPRYLYMVLDTG-DVVWVQCSPCKNCYSQ  174



>ref|XP_008799615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=504

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka--lsllaaaaPPHNATRGR-DFS  360
            L + + H D  S  A N+TP+ L   RL RDA R       L A     H    GR  FS
Sbjct  78   LRVRIAHRD--SLFAANSTPEHLLGLRLGRDATRVSHLHEILGAEGNATHAVRAGRRGFS  135

Query  361  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            SSV+SGLAQGSGEYFTR+G+GTP +YA+MVLDTGSDVVWLQC+PCR+CY+Q
Sbjct  136  SSVVSGLAQGSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQ  186



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 96/149 (64%), Gaps = 9/149 (6%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            Y TL +  LP++Q +S    P+         DS  +L++ L H+D +SS + +A+P  LF
Sbjct  29   YNTLVVNTLPSSQIFS---SPEPESLTSTVSDSTTSLTVHLSHVDALSSFS-DASPSELF  84

Query  262  VKRLQRDaarakalsllaaaaPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGT  426
              RL+RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGT
Sbjct  85   NLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGT  144

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  145  PATNVYMVLDTGSDVVWLQCSPCKVCYNQ  173



>ref|XP_011461997.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=261

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 88/136 (65%), Gaps = 12/136 (9%)
 Frame = +1

Query  118  QHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarak  297
            Q  SL       +   +PD   ++LSL LHH+D +SS   N TP  LF  RL+RD+ R  
Sbjct  18   QRVSLGDHESTLEKTSEPDSDPSSLSLPLHHLDALSS---NQTPSQLFHLRLRRDSLRFN  74

Query  298  alsllaaaaPPHNATRGRDFSSSVIS----GLAQGSGEYFTRLGVGTPPKYAFMVLDTGS  465
            +L+ LA     +N TR    SS   S    GL+QGSGEYFTR+GVG+ PKY +MVLDTGS
Sbjct  75   SLTSLA-----YNRTRPGPPSSGFSSSIVSGLSQGSGEYFTRIGVGSSPKYLYMVLDTGS  129

Query  466  DVVWLQCSPCRKCYAQ  513
            +VVWLQC+PC++CY+Q
Sbjct  130  EVVWLQCAPCKRCYSQ  145



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 93/141 (66%), Gaps = 17/141 (12%)
 Frame = +1

Query  136  SKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaara-------  294
            S  ++S+T VQ ++ +N++ L + H D +SS++  +  K +  +RL+RDAAR        
Sbjct  52   SAQEWSET-VQGEE-KNSIVLQVVHRDSLSSSSNTSLVKEILQERLKRDAARVDSINARV  109

Query  295  --kalsllaaaaPPHNATR------GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  450
               A+ +  A   P N +        +DFSSS+ISGLAQGSGEYFTRLGVGTPP+Y +MV
Sbjct  110  QLAAMGVSKAEMKPLNGSSIDARFDAKDFSSSIISGLAQGSGEYFTRLGVGTPPRYTYMV  169

Query  451  LDTGSDVVWLQCSPCRKCYAQ  513
            LDTGSD++W+QC PC KCY Q
Sbjct  170  LDTGSDIMWIQCLPCAKCYGQ  190



>ref|XP_003529886.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 89/121 (74%), Gaps = 11/121 (9%)
 Frame = +1

Query  163  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  342
            V+PD  E T SL LHHID +S    N TP  LF  RL+RDAAR K L+ LAAA    N T
Sbjct  54   VEPD-PEPTTSLSLHHIDALS---FNKTPSQLFHLRLERDAARVKTLTHLAAAT---NKT  106

Query  343  RGRD----FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  510
            R  +    FSSSV+SGL+QGSGEYFTRLGVGTPPKY +MVLDTGSDVVWLQC PC KCY+
Sbjct  107  RPANPGSGFSSSVVSGLSQGSGEYFTRLGVGTPPKYLYMVLDTGSDVVWLQCKPCTKCYS  166

Query  511  Q  513
            Q
Sbjct  167  Q  167



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 96/149 (64%), Gaps = 9/149 (6%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            Y TL +  LP++Q +S    P+         DS  +L++ L H+D +SS + +A+P  LF
Sbjct  29   YNTLVVNTLPSSQIFS---SPEPESLTSTVSDSTTSLTVHLSHVDALSSFS-DASPLELF  84

Query  262  VKRLQRDaarakalsllaaaaPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGT  426
              RL+RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGT
Sbjct  85   NLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGT  144

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  145  PATNVYMVLDTGSDVVWLQCSPCKVCYNQ  173



>ref|XP_010924503.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=508

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 95/164 (58%), Gaps = 20/164 (12%)
 Frame = +1

Query  76   LDYQTLSLRPL-------PTAQHYSLSSKPQ--YSQTLVQPDDS---ENTLSLDLHHIDL  219
            L+YQTL + PL       P     + +S  Q    +T + P       ++  + L H D 
Sbjct  29   LEYQTLVVTPLRPTPALLPDDDFLTWTSDSQTPADETDLSPAGGGAFSSSFHVSLAHRD-  87

Query  220  ISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHN------ATRGRDFSSSVISGL  381
             S  A N TP+ L   RL RDAAR   L  + AAA            R R FS+SV+SGL
Sbjct  88   -SLLAANTTPEHLLRLRLGRDAARVANLHKILAAATAAGNATHAVGARPRGFSASVVSGL  146

Query  382  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +QGSGEYFTR+G+GTP +Y  MVLDTGSDVVWLQC+PCR+CY+Q
Sbjct  147  SQGSGEYFTRIGIGTPARYLNMVLDTGSDVVWLQCAPCRRCYSQ  190



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  355  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            FSSSVISGLAQGSGEYFTR+GVGTPPKY +MVLDTGSD+VWLQC+PC+ CY+Q
Sbjct  27   FSSSVISGLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQ  79



>ref|NP_001043485.1| Os01g0598600 [Oryza sativa Japonica Group]
 dbj|BAB63755.1| nucleoid DNA-binding protein cnd41-like [Oryza sativa Japonica 
Group]
 dbj|BAF05399.1| Os01g0598600 [Oryza sativa Japonica Group]
 gb|EAY74816.1| hypothetical protein OsI_02707 [Oryza sativa Indica Group]
Length=500

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 88/157 (56%), Gaps = 13/157 (8%)
 Frame = +1

Query  73   SLDYQTLSLRPLP----TAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVN  240
            ++ YQTL   PL     TA         Q S    +   + +T+ L + H D     AVN
Sbjct  31   AVRYQTLVATPLSPHPYTATAVEDDGLFQGSLAADEGGAAASTVGLRVVHRDDF---AVN  87

Query  241  ATPKALFVKRLQRDaarakalsllaaaaPPHNATR------GRDFSSSVISGLAQGSGEY  402
            AT   L   RL+RD  RA  +S  A  A   N TR      G  F + V+SGLAQGSGEY
Sbjct  88   ATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGGGGGSGFVAPVVSGLAQGSGEY  147

Query  403  FTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            FT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q
Sbjct  148  FTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCYDQ  184



>gb|EAZ12575.1| hypothetical protein OsJ_02481 [Oryza sativa Japonica Group]
Length=501

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 89/160 (56%), Gaps = 13/160 (8%)
 Frame = +1

Query  64   IFASLDYQTLSLRPLP----TAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSA  231
            +  ++ YQTL   PL     TA         Q S    +   + +T+ L + H D     
Sbjct  28   VAEAVRYQTLVATPLSPHPYTATAVEDDGLFQGSLAADEGGAAASTVGLRVVHRDDF---  84

Query  232  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR------GRDFSSSVISGLAQGS  393
            AVNAT   L   RL+RD  RA  +S  A  A   N TR      G  F + V+SGLAQGS
Sbjct  85   AVNATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGGGGGSGFVAPVVSGLAQGS  144

Query  394  GEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            GEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q
Sbjct  145  GEYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCYDQ  184



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 97/149 (65%), Gaps = 10/149 (7%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            Y TL +  LP++   S    P+ S++L+   DS  +LS+ L H+D   S++ +A+P  LF
Sbjct  30   YNTLVVNTLPSSPILSF---PE-SESLISDSDSTTSLSVHLSHVD-ALSSSSDASPAELF  84

Query  262  VKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  426
              RLQRD+ R ++L+ LAA +   N T+        FS  VISGL+QGSGEYF RLGVGT
Sbjct  85   NLRLQRDSLRVESLTSLAAVSAGRNVTKRPPRSAGGFSGVVISGLSQGSGEYFMRLGVGT  144

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P    +MVLDTGSDVVWLQCSPC+ CY Q
Sbjct  145  PATNMYMVLDTGSDVVWLQCSPCKVCYNQ  173



>ref|XP_004969076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=493

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +1

Query  232  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT-RGRDFSSSVISGLAQGSGEYFT  408
            AVNAT   L   RL+RD  RA  +S  AA     N T RG   ++ V+SGLA+GSGEYFT
Sbjct  77   AVNATAAELLKHRLRRDKRRAARISKEAAGGAAANGTSRGGGVAAPVVSGLAEGSGEYFT  136

Query  409  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            ++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q
Sbjct  137  KIGVGTPATPALMVLDTGSDVVWLQCAPCRRCYDQ  171



>ref|XP_003569303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=494

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 84/145 (58%), Gaps = 12/145 (8%)
 Frame = +1

Query  97   LRPLPTAQHYSLS---SKPQYSQTLVQPDDSE-NTLSLDLHHIDLISSAAVNATPKALFV  264
            L P P +    L+    K  ++  L   +D+  +T+   + H D      VNAT   L  
Sbjct  41   LSPTPFSASSELARGDDKDVFAGNLAAAEDATPSTVQFSVVHRDDF---VVNATAAELLG  97

Query  265  KRLQRDaarakalsllaaaaPPHNATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  438
             RLQRD  RA  +S  A A    N TR  G    + V+SGLAQGSGEYFT++GVGTP   
Sbjct  98   HRLQRDGKRAARISAAAGA---ANGTRRTGSGVVAPVVSGLAQGSGEYFTKIGVGTPATP  154

Query  439  AFMVLDTGSDVVWLQCSPCRKCYAQ  513
            A MVLDTGSDVVWLQC+PCR+CY Q
Sbjct  155  ALMVLDTGSDVVWLQCAPCRRCYDQ  179



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 96/175 (55%), Gaps = 41/175 (23%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLS------LDLHHIDLISSAAV  237
            L+ QTL LRPL         SKP      ++ +++E  LS      L LHH D +S   +
Sbjct  23   LESQTLLLRPL---------SKPPLLDEDLKQEETEGDLSDQTSLFLTLHHRDSLS---L  70

Query  238  NATPKALFVKRLQRDaarakalsl----------------laaaaPPHNAT-------RG  348
            N T + LF  RL+RD AR K+L+                   AA P  +A        RG
Sbjct  71   NLTAEELFKLRLERDDARVKSLTNWVNLAAALGSSHRGHHHGAANPAAHANGSVQTRGRG  130

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            + F++ V+SGL QGSGEYF R+ VGTPP+  +MVLDTGSD+ WLQC+PCR CY Q
Sbjct  131  QAFTAPVVSGLPQGSGEYFARVKVGTPPQPMYMVLDTGSDLAWLQCTPCRHCYRQ  185



>ref|XP_003520873.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=461

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 83/122 (68%), Gaps = 8/122 (7%)
 Frame = +1

Query  151  SQTLVQPDDSENTLSLDLHH-IDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaP  327
            S+TL +P ++ +       H ID +SS   N TP+ LF  RLQRDA R +AL     A  
Sbjct  41   SETLSEPQETLSLSLHLHLHHIDALSS---NKTPEQLFHLRLQRDAKRVEALLNQIHARR  97

Query  328  PHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  507
               ++     SSS+ISGLAQGSGEYFTR+GVGTP +Y +MVLDTGSDVVWLQC+PCRKCY
Sbjct  98   SAGSSF----SSSIISGLAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCY  153

Query  508  AQ  513
             Q
Sbjct  154  TQ  155



>ref|XP_002440367.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
 gb|EES18797.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
Length=462

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 6/87 (7%)
 Frame = +1

Query  256  LFVKRLQRDaarakalsllaaaaPPHNATR-GRDFSSSVISGLAQGSGEYFTRLGVGTPP  432
            L   RL RDAARA+A+S+ A      N TR G  FS+ V+SGLAQGSGEYF  +GVGTPP
Sbjct  98   LLAHRLARDAARAEAISVSA-----RNVTRAGGGFSAPVVSGLAQGSGEYFASVGVGTPP  152

Query  433  KYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
              A +VLDTGSDVVWLQC+PCR+CYAQ
Sbjct  153  TPALLVLDTGSDVVWLQCAPCRQCYAQ  179



>tpg|DAA58835.1| TPA: hypothetical protein ZEAMMB73_701358 [Zea mays]
Length=485

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +1

Query  232  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  411
            AVNAT   L   RLQRD  RA  +S  A A   +     +  ++ V+SGLAQGSGEYFT+
Sbjct  76   AVNATAGELLKHRLQRDKRRAARISEAAGAGGGNGR---KGVAAPVVSGLAQGSGEYFTK  132

Query  412  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +GVGTP   A MVLDTGSDVVW+QC+PCR+CY Q
Sbjct  133  IGVGTPATQALMVLDTGSDVVWVQCAPCRRCYEQ  166



>gb|KEH44446.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=486

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 78/141 (55%), Gaps = 3/141 (2%)
 Frame = +1

Query  91   LSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKR  270
            L+L+P  T +    + K        + D       L L H D IS+  ++    + F  R
Sbjct  47   LNLKPFHTTKQPQENKKSNAESMSEKSDAVSGKHKLKLLHRDKISAFNISGDHLSRFNAR  106

Query  271  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  450
            ++RD+ R  A+    A    +      +F S V+SG+ QGSGEYF R+GVG+PPK  ++V
Sbjct  107  MERDSKRVTAVVRQIAGGVGYET---EEFGSGVVSGMEQGSGEYFVRIGVGSPPKNQYVV  163

Query  451  LDTGSDVVWLQCSPCRKCYAQ  513
            +D+GSD++W+QC PC +CY Q
Sbjct  164  VDSGSDIIWVQCQPCTQCYHQ  184



>ref|XP_010248951.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=475

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 79/148 (53%), Gaps = 4/148 (3%)
 Frame = +1

Query  76   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSENTLSLDLHHIDLISSAAVNATP  249
            +DYQ L++R          S    Y + L   D  ++E    L L H D I     + T 
Sbjct  28   VDYQHLNVRETIATTKVQRSEMKSYQEFLESNDRGEAEGRWKLKLVHRDTIFMGNYS-TH  86

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTP  429
            +    +R+ RD  R  +L+   +           DF S VISG+ QGSGEYF R+GVG+P
Sbjct  87   RQRLDERITRDVKRVASLTRRLSGGDGAGYEV-EDFGSEVISGMEQGSGEYFVRIGVGSP  145

Query  430  PKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P+  +MVLD+GSD+VW+QC PC +CY Q
Sbjct  146  PRNQYMVLDSGSDIVWVQCQPCSQCYRQ  173



>gb|ABK24480.1| unknown [Picea sitchensis]
Length=496

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 82/164 (50%), Gaps = 22/164 (13%)
 Frame = +1

Query  58   HPIFASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAV  237
            HP + +LD         P    Y    KP+ +   VQ           +H   L+   A 
Sbjct  38   HPAYLALDVAASIRDTAPGGVEYKRVQKPKRTAWSVQL----------VHRDSLLFKGAA  87

Query  238  NATP------------KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGL  381
            NAT             +A  V+ L++   R   L    A +  + A    +F S V+SG+
Sbjct  88   NATASYERRLEEKLRREAARVRALEQRIERKLKLKKDPAGSYENVAGVTAEFGSEVVSGM  147

Query  382  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             QGSGEYFTR+G+GTP +  +MVLDTGSDVVW+QC PCR+CY+Q
Sbjct  148  EQGSGEYFTRIGIGTPTREQYMVLDTGSDVVWIQCEPCRECYSQ  191



>gb|ABK25248.1| unknown [Picea sitchensis]
Length=366

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 85/166 (51%), Gaps = 26/166 (16%)
 Frame = +1

Query  61   PIFASLDYQTLSLRPLPTAQ---HYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSA  231
            P + +LD  + SLR   TA     Y   +KP+ S   V+           +H   L+   
Sbjct  40   PAYHALDVAS-SLRETDTAAGGAEYKRETKPRRSPWSVEV----------VHRDALLLKN  88

Query  232  AVNATP------------KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS  375
            A NAT             +A+ V+ L+R   R   L+        + A    DF   V+S
Sbjct  89   AANATASYERRLKEKLRREAVRVRGLERQIERTLTLNKDPVNRYENVAEVDADFGGEVVS  148

Query  376  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            G+ QGSGEYFTR+GVGTP +  +MVLDTGSDV W+QC PCR+CY+Q
Sbjct  149  GMEQGSGEYFTRIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYSQ  194



>ref|XP_011031192.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 13/142 (9%)
 Frame = +1

Query  97   LRPLPTAQHYSLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPKALFVKR  270
            +RPL ++Q+  LS        +  P+DS  E    L L H D +S           F  R
Sbjct  68   IRPLKSSQYQELS--------MNIPNDSGSEGKQKLKLVHRDKVSFNKKFHNHSHDFHAR  119

Query  271  LQRDaarakalsllaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  447
            +QRD  R  +L    ++     A+ G  DF S V+SG+ QGSGEYF R+GVG+PP+  +M
Sbjct  120  MQRDVKRVVSLIRRVSSGSA--ASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYM  177

Query  448  VLDTGSDVVWLQCSPCRKCYAQ  513
            V+D+GSD+VW+QC PC +CY Q
Sbjct  178  VIDSGSDIVWVQCKPCTQCYHQ  199



>ref|XP_011007544.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 13/142 (9%)
 Frame = +1

Query  97   LRPLPTAQHYSLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPKALFVKR  270
            +RPL ++Q+  LS        +  P+DS  E    L L H D +S           F  R
Sbjct  68   IRPLKSSQYQELS--------MNIPNDSGSEGKQKLKLVHRDKVSFNKKFHNHSHDFHAR  119

Query  271  LQRDaarakalsllaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  447
            +QRD  R  +L    ++     A+ G  DF S V+SG+ QGSGEYF R+GVG+PP+  +M
Sbjct  120  MQRDVKRVVSLIRRVSSGSA--ASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYM  177

Query  448  VLDTGSDVVWLQCSPCRKCYAQ  513
            V+D+GSD+VW+QC PC +CY Q
Sbjct  178  VIDSGSDIVWVQCKPCTQCYHQ  199



>ref|XP_010279486.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (57%), Gaps = 6/151 (4%)
 Frame = +1

Query  73   SLDYQTLSLRPLPTAQHY---SLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNA  243
             +D+Q L++     A       + S  ++S++    D++E    L L H D+IS    + 
Sbjct  28   GVDFQYLNVHETMVATRIRPSEIKSFQEFSES-NNGDEAEGRWKLKLVHRDMISLGNFSN  86

Query  244  TPKALFVKRLQRDaarakalsllaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGV  420
                L  +R++RD  R  +L+   +         G  DF+S V+SG+ QGSGEYF R+GV
Sbjct  87   HRHHL-SERIKRDVRRVASLTRRLSGGGGGGVNYGVEDFASEVVSGVDQGSGEYFVRIGV  145

Query  421  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            G+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  146  GSPPRNQYMVIDSGSDIVWVQCQPCNQCYRQ  176



>gb|ABR17085.1| unknown [Picea sitchensis]
Length=498

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 85/166 (51%), Gaps = 26/166 (16%)
 Frame = +1

Query  61   PIFASLDYQTLSLRPLPTAQ---HYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSA  231
            P + +LD  + SLR   TA     Y   +KP+ S   V+           +H   L+   
Sbjct  40   PAYHALDVAS-SLRETDTAAGGAEYKRETKPRRSPWSVEV----------VHRDALLLKN  88

Query  232  AVNATP------------KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS  375
            A NAT             +A+ V+ L+R   R   L+        + A    DF   V+S
Sbjct  89   AANATASYERRLKEKLRREAVRVRGLERQIERTLTLNKDPVNRYENVAEVDADFGGEVVS  148

Query  376  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            G+ QGSGEYFTR+GVGTP +  +MVLDTGSDV W+QC PCR+CY+Q
Sbjct  149  GMEQGSGEYFTRIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYSQ  194



>gb|KHN16429.1| Aspartic proteinase nepenthesin-1, partial [Glycine soja]
Length=104

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  379  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            LAQGSGEYFTR+GVGTP +Y +MVLDTGSDVVWLQC+PCRKCY Q
Sbjct  1    LAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCYTQ  45



>gb|KJB49971.1| hypothetical protein B456_008G147500 [Gossypium raimondii]
Length=480

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 80/143 (56%), Gaps = 15/143 (10%)
 Frame = +1

Query  100  RPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISS--AAVNATPKALFVKRL  273
            RPL T++H+ +S             +++    L L H D +SS  +A        F  R+
Sbjct  46   RPLQTSEHHQVS----------DVSETQGKWKLKLVHRDKLSSNTSATFRDHSRRFHARM  95

Query  274  QRDaarakalsllaaaaPPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  444
            QRD  R  +L    +    H+   A    DF S V+SG+ QGSGEYF R+GVG+PPK  +
Sbjct  96   QRDVKRVASLLRRLSGGGGHDGGAAYEVNDFGSDVVSGMDQGSGEYFVRIGVGSPPKSQY  155

Query  445  MVLDTGSDVVWLQCSPCRKCYAQ  513
            MV+D+GSD+VW+QC PC +CY Q
Sbjct  156  MVIDSGSDIVWVQCQPCNQCYRQ  178



>ref|XP_010533981.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=502

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 89/157 (57%), Gaps = 20/157 (13%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  261
            +Q LSL P  T    +L+S+P      V  + S  + SL+LH  + +  +  +   ++L 
Sbjct  53   HQILSLDPSGT----TLTSRPDLKSKPVFLNSS--SFSLELHSRETLVESQ-HKDYRSLL  105

Query  262  VKRLQRDaarakalsllaaaa----------PPHN---ATRGRDFSSSVISGLAQGSGEY  402
            + RL+RD+AR   ++     A          P H+     R  D S+ V+SG +QGSGEY
Sbjct  106  LGRLERDSARVSGITAKVRLAIEGVERSKLHPVHDDDSLIRPEDMSTPVVSGASQGSGEY  165

Query  403  FTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            F+R+GVGTPPK  FMVLDTGSDV W+QC PC  CY Q
Sbjct  166  FSRVGVGTPPKEMFMVLDTGSDVNWIQCQPCSDCYQQ  202



>gb|AAT38006.1| unknow protein [Oryza sativa Japonica Group]
Length=475

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 76/142 (54%), Gaps = 19/142 (13%)
 Frame = +1

Query  97   LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  276
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  34   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  79

Query  277  RDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  447
                   A    A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  80   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  137

Query  448  VLDTGSDVVWLQCSPCRKCYAQ  513
            VLDTGSDVVWLQC+PCR CYAQ
Sbjct  138  VLDTGSDVVWLQCAPCRHCYAQ  159



>gb|EAY99240.1| hypothetical protein OsI_21202 [Oryza sativa Indica Group]
Length=475

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 76/142 (54%), Gaps = 19/142 (13%)
 Frame = +1

Query  97   LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  276
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  34   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  79

Query  277  RDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  447
                   A    A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  80   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  137

Query  448  VLDTGSDVVWLQCSPCRKCYAQ  513
            VLDTGSDVVWLQC+PCR CYAQ
Sbjct  138  VLDTGSDVVWLQCAPCRHCYAQ  159



>ref|NP_001056485.1| Os05g0590000 [Oryza sativa Japonica Group]
 gb|AAT58814.1| putative nucleoid DNA-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF18399.1| Os05g0590000 [Oryza sativa Japonica Group]
Length=481

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 76/142 (54%), Gaps = 19/142 (13%)
 Frame = +1

Query  97   LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  276
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  40   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  85

Query  277  RDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  447
                   A    A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  86   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  143

Query  448  VLDTGSDVVWLQCSPCRKCYAQ  513
            VLDTGSDVVWLQC+PCR CYAQ
Sbjct  144  VLDTGSDVVWLQCAPCRHCYAQ  165



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  504
            P H   R  D S+ V+SG++QGSGEYFTR+GVGTP K  +MVLDTGSD+ WLQC PC  C
Sbjct  133  PMHTEIRPEDLSTPVVSGVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDC  192

Query  505  YAQ  513
            Y Q
Sbjct  193  YQQ  195



>gb|KJB77420.1| hypothetical protein B456_012G135900 [Gossypium raimondii]
Length=484

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 86/155 (55%), Gaps = 10/155 (6%)
 Frame = +1

Query  79   DYQTLSLRPLPT---AQHYSLSSKPQYSQTLVQPDDSEN--TLSLDLHHIDLISS--AAV  237
            D+Q L++  +     AQ   L +       L+   +SE+     L L H D +S+  A V
Sbjct  28   DFQLLNVEQVLVGVLAQPSPLQTSEYNHHELLNVTESEDQWKWKLKLIHRDWLSTENATV  87

Query  238  NATPKALFVKRLQRDaarakalsllaaaaPPHN--ATRG-RDFSSSVISGLAQGSGEYFT  408
            +      F  R+QRD  R  +L L       H+  A  G  DF S V+SG+ QGSGEYF 
Sbjct  88   SRNHSRRFHARIQRDVKRVASLLLRIPGGVIHDGEAAHGVNDFGSDVVSGMDQGSGEYFV  147

Query  409  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  148  RIGVGSPPRSQYMVIDSGSDIVWVQCKPCNQCYKQ  182



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  504
            P H   R  D S+ V+SG++QGSGEYFTR+GVGTP K  +MVLDTGSD+ WLQC PC  C
Sbjct  133  PMHTEIRPEDLSTPVVSGVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDC  192

Query  505  YAQ  513
            Y Q
Sbjct  193  YQQ  195



>ref|XP_002306246.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
 gb|EEE93242.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
Length=502

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 83/150 (55%), Gaps = 8/150 (5%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQ--PDDS--ENTLSLDLHHIDLISSAAVNAT  246
            D+Q L+++   T        KP   Q L    P+DS  E    L L H D +S       
Sbjct  54   DFQLLNVKQAITETKIR-PLKPSLYQELSMNIPNDSGSEGKQKLKLVHRDKVSFNNKFHN  112

Query  247  PKALFVKRLQRDaarakalsllaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVG  423
               +F  R+QRD  R  +L    ++     A+ G  DF S V+SG+ QGSGEYF R+GVG
Sbjct  113  HSHVFHARMQRDVKRVVSLIRRVSSGS--TASYGVEDFGSEVVSGMDQGSGEYFVRIGVG  170

Query  424  TPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  171  SPPRSQYMVIDSGSDIVWVQCKPCTQCYHQ  200



>ref|XP_004497254.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=486

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 85/158 (54%), Gaps = 9/158 (6%)
 Frame = +1

Query  58   HPIFASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLS------LDLHHIDL  219
            +P F  L+ +          + +  + +PQ +Q      +SE T S      L L H D 
Sbjct  30   YPHFQHLNVKQTIAETKRKLKPFHTTKQPQENQKSNTDAESEKTESGSGKRKLKLLHRDE  89

Query  220  ISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGE  399
            I    ++   ++ F  R++RDA R  A+    A    +      +F S V+SG+ QGSGE
Sbjct  90   IHIFNISRDHRSRFNARMKRDAKRVAAVVRRIAGGVGYKT---EEFGSDVVSGMEQGSGE  146

Query  400  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YF R+GVG+PPK  ++V+D+GSD++W+QC PC +CY Q
Sbjct  147  YFVRIGVGSPPKNQYVVIDSGSDIIWVQCQPCTQCYRQ  184



>ref|XP_009629151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=491

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 83/155 (54%), Gaps = 17/155 (11%)
 Frame = +1

Query  94   SLRPLPTAQHYS-------LSSKPQYSQTLVQPD---DSEN-----TLSLDLHHIDLISS  228
            +L P PT ++++       L++K Q      + D   D EN      L L L H D +  
Sbjct  37   ALFPYPTHENFNVQETISQLATKIQTPHEKQEEDFHFDDENGEEKRNLKLKLIHRDKLYF  96

Query  229  AAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFT  408
            +   +    +F  R++RD  R  +L          N  R  +F S V+SG+ QGSGEYF 
Sbjct  97   SNYFSNHSKMFEARMKRDVKRVSSLIHRITGGG--NGYRVEEFGSDVVSGMDQGSGEYFV  154

Query  409  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            R+GVG+P +  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  155  RIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQ  189



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 74/117 (63%), Gaps = 5/117 (4%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-  351
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++      A     +  R 
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVASIIAKVNLAVEGADSETRY  133

Query  352  ---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY Q
Sbjct  134  NPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQ  190



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 74/117 (63%), Gaps = 5/117 (4%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-  351
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  A+      A     +  R 
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAAIIAKVNLAVEGADSETRY  133

Query  352  ---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY Q
Sbjct  134  QPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQ  190



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 16/138 (12%)
 Frame = +1

Query  130  LSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsl  309
            L S+ Q SQ L     + +  SL LH  D + ++  +   K+L + RL RD+AR  +L  
Sbjct  57   LESQSQESQPL-----NSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLGRDSARVNSLHT  110

Query  310  laaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDT  459
                A          P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDT
Sbjct  111  KLQLALQGIKRVDLEPMHTEVQSQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDT  170

Query  460  GSDVVWLQCSPCRKCYAQ  513
            GSDV WLQC PC  CY Q
Sbjct  171  GSDVNWLQCGPCSDCYQQ  188



>gb|ABR16474.1| unknown [Picea sitchensis]
Length=538

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +F   V+SG+AQGSGEYFTR+GVGTP +  +MVLDTGSDVVW+QC PC KCY+Q
Sbjct  181  EFGGEVVSGMAQGSGEYFTRIGVGTPMREQYMVLDTGSDVVWIQCEPCSKCYSQ  234



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 16/138 (12%)
 Frame = +1

Query  130  LSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsl  309
            L S+ Q SQ L     + +  SL LH  D + ++  +   K+L + RL RD+AR  +L  
Sbjct  57   LESQSQESQPL-----NSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLGRDSARVNSLHT  110

Query  310  laaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDT  459
                A          P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDT
Sbjct  111  KLQLALQGIKRVDLEPMHTEIQSQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDT  170

Query  460  GSDVVWLQCSPCRKCYAQ  513
            GSDV WLQC PC  CY Q
Sbjct  171  GSDVNWLQCGPCSDCYQQ  188



>gb|KDP40474.1| hypothetical protein JCGZ_24473 [Jatropha curcas]
Length=469

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 75/126 (60%), Gaps = 5/126 (4%)
 Frame = +1

Query  145  QYSQTLVQPDDSE--NTLSLDLHHID-LISSAAVNATPKALFVKRLQRDaarakalslla  315
            QY Q  +  +DS+      L L H D +I+S+        LF  R+ RD  R  +L    
Sbjct  44   QYQQLFINQNDSQSQGIWKLKLVHRDRIITSSNSLHNHTHLFHARINRDIKRVASLIRRL  103

Query  316  aaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            ++  P    +  DF + V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC
Sbjct  104  SS--PAATYQVNDFGAEVVSGMNQGSGEYFVRIGVGSPPRDQYVVIDSGSDIVWVQCQPC  161

Query  496  RKCYAQ  513
             +CY Q
Sbjct  162  TQCYHQ  167



>ref|XP_004961034.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 91/157 (58%), Gaps = 10/157 (6%)
 Frame = +1

Query  70   ASLDYQTLSLRPL---PTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVN  240
            A   Y TL   PL   PTA+  + +     +      D   N  +++L      + AA N
Sbjct  38   ARYQYHTLRATPLSPEPTARVDAAAILGTSTDLTAVFDGIGNASAVELVLAHREAFAAPN  97

Query  241  ATPKALFVKRLQRDaarakalsllaaaaPPHNATR------GRDFSSSVISGLAQGSGEY  402
            AT   L   RL RDAARA A+S  AAA    N TR      G  F++ V+SGL+QGSGEY
Sbjct  98   ATAPQLLAHRLARDAARADAISSAAAAGA-TNGTRAPRRRGGSGFAAPVLSGLSQGSGEY  156

Query  403  FTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            F ++GVGTPP  A +VLDTGSDVVWLQC+PCR CYAQ
Sbjct  157  FAQVGVGTPPTPALLVLDTGSDVVWLQCAPCRHCYAQ  193



>ref|XP_006345303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=477

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 82/163 (50%), Gaps = 16/163 (10%)
 Frame = +1

Query  64   IFASLDYQTLSLR----PLPTAQHYSLSSKPQYSQTLVQP---------DDSENTLSLDL  204
            I AS  Y++ S      P PT +H  ++   + S TL+QP         DD  +   L L
Sbjct  15   ISASASYESKSTSGHAIPFPTHEHLDVNQAIKES-TLIQPPETHDINIVDDDNSRWKLKL  73

Query  205  HHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLA  384
             H D +  +     P   F  R++RD  R   L+             G  F S VISG+ 
Sbjct  74   LHRDKLPFSHFTDHPHR-FQARMKRDIKRVHTLTATTNYDEVKEEEFG-GFGSEVISGME  131

Query  385  QGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            QGSGEYF R+GVG+P +  +MV+D GSD+VW+QC PC  CY Q
Sbjct  132  QGSGEYFVRIGVGSPVRQQYMVIDAGSDIVWVQCQPCTHCYHQ  174



>ref|XP_011022942.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=502

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 82/156 (53%), Gaps = 19/156 (12%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTL-VQPDDSENT---LSLDLHHIDLISSAAVNAT  246
            D+Q L+++   T          QY +     P+DSE+T     L L H D +S +     
Sbjct  53   DFQLLNVKQALTETKTRPIKPSQYQELFKTNPNDSESTGGKQKLKLVHRDKVSFSNQLHN  112

Query  247  PKALFVKRLQRDaarakalsllaaaaPPHNATRG-------RDFSSSVISGLAQGSGEYF  405
               +F  R+ RD  R  +L         H  + G        +F S V+SG+ QGSGEYF
Sbjct  113  HSHVFNARMHRDVKRVASLI--------HRLSSGSAAKYEVENFGSDVVSGMNQGSGEYF  164

Query  406  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             R+G+G+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  165  VRIGLGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQ  200



>ref|XP_002455897.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
 gb|EES01017.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
Length=493

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  340  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +RG   ++ V+SGLAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q
Sbjct  120  SRGGAVAAPVVSGLAQGSGEYFTKIGVGTPSTPALMVLDTGSDVVWLQCAPCRRCYDQ  177



>ref|XP_002309912.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
 gb|EEE90362.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
Length=501

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 80/155 (52%), Gaps = 18/155 (12%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTL-VQPDDSE--NTLSLDLHHIDLISSAAVNATP  249
            D+Q L+++   T          QY +     P+DSE      L L H D +S +      
Sbjct  53   DFQLLNVKQALTETKTRPIKPSQYQELFKTNPNDSESGGKQKLKLVHRDKVSFSNKLHNH  112

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRG-------RDFSSSVISGLAQGSGEYFT  408
              +F  R+ RD  R  +L         H  + G        DF S V+SG+ QGSGEYF 
Sbjct  113  SHVFHARMHRDVKRVASLI--------HRLSSGSAAKYEVEDFGSDVVSGMNQGSGEYFV  164

Query  409  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            R+G+G+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  165  RIGLGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQ  199



>ref|XP_006406427.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
 gb|ESQ47880.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
Length=468

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 81/146 (55%), Gaps = 6/146 (4%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  258
            D+Q + +   P +   +L   P ++ T   PD+S+ TL L LH     S +  N   +  
Sbjct  26   DFQIIDVSQPPLSVTGTL---PDFNNTTF-PDESKYTLRL-LHRDKFPSVSYRNHHHRLH  80

Query  259  FVKRLQRDaarakalsllaaaaPPHNAT-RGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  435
               R   D   A    +   + PP N+     DF S V+SG+ QGSGEYF R+GVG+PP+
Sbjct  81   ARMRRDSDRVAAILRRISGKSVPPSNSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPR  140

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
              +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  141  DQYMVIDSGSDMVWVQCQPCKLCYKQ  166



>ref|XP_007142740.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
 gb|ESW14734.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
Length=475

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 84/156 (54%), Gaps = 8/156 (5%)
 Frame = +1

Query  58   HPIFASLDY-QTLS---LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLIS  225
            +P F  L+  QTL+   L P PT+     S + Q    +   D S     L L H D +S
Sbjct  22   YPHFQQLNVKQTLAQTKLIPKPTSTPKQPSHQHQTPNAVT--DSSSTKWKLKLLHRDKVS  79

Query  226  SAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYF  405
            +       +  F  R++RDA R   L    AA  P        F S V+SG+ QGSGEYF
Sbjct  80   TFNTTLDHQTRFNARIERDARRVAVLLRRLAAGKP--TLDSEAFGSDVVSGMEQGSGEYF  137

Query  406  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             R+GVG+PP+  ++V+D+GSD++W+QC PC +CY Q
Sbjct  138  VRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCYRQ  173



>ref|XP_010541885.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Tarenaya hassleriana]
Length=188

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  109  DFGSDVVSGMDQGSGEYFVRIGVGSPPRNQYMVIDSGSDMVWVQCQPCKLCYKQ  162



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 73/122 (60%), Gaps = 15/122 (12%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD  354
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++           A  G D
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKNYKSLVLSRLERDSSRVASIIAKVKL-----AVEGAD  128

Query  355  ---------FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  507
                      ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY
Sbjct  129  SETHYQPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCY  188

Query  508  AQ  513
             Q
Sbjct  189  QQ  190



>gb|KJB79793.1| hypothetical protein B456_013G067200 [Gossypium raimondii]
Length=475

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 72/127 (57%), Gaps = 11/127 (9%)
 Frame = +1

Query  160  LVQPDDSENTLSLDLHHIDLISSAAVNATPKAL------FVKRLQRDaarakalsllaaa  321
            L + DD     +L L H D + S   N +   L      F  R+QRD  R  +L      
Sbjct  48   LSETDDHRGKWNLKLVHRDKLLSP--NDSLSTLHNHGRRFHARMQRDVKRVASLLRRLPG  105

Query  322  aPPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSP  492
               H+   A +  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC P
Sbjct  106  KGTHDGDAAYQVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQP  165

Query  493  CRKCYAQ  513
            C +CY Q
Sbjct  166  CNQCYRQ  172



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 94/158 (59%), Gaps = 17/158 (11%)
 Frame = +1

Query  85   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSENTLSLDLHHIDLISSAAVNATPKAL  258
            QT S+  L  ++    S++P+ S++L  P   +S + LSL+LH  D+   A+ +   K+L
Sbjct  45   QTQSILSLDPSRSSLTSTRPE-SESLFDPVFLNSSSPLSLELHSRDIFV-ASQHKDYKSL  102

Query  259  FVKRLQRDaarakalsll----------aaaaPPHNA-TRGR--DFSSSVISGLAQGSGE  399
             + RL+RD++R   ++            +   P  N  TR +  D ++ V+SG +QGSGE
Sbjct  103  VLSRLERDSSRVNGIAAKVRFAVEGIDRSDLKPVSNEDTRYQPEDLTTPVVSGASQGSGE  162

Query  400  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q
Sbjct  163  YFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQ  200



>ref|XP_008802841.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=470

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SGL +GSGEYF R+GVG+PPK  FMV+D+GSD+VW+QC PC +CYAQ
Sbjct  110  DFGSDVVSGLDEGSGEYFVRIGVGSPPKEQFMVIDSGSDIVWVQCRPCTQCYAQ  163



>ref|XP_006440937.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
 gb|ESR54177.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
Length=495

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 11/125 (9%)
 Frame = +1

Query  169  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla----------a  318
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L               
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  319  aaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  498
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  499  KCYAQ  513
            +CY Q
Sbjct  192  ECYQQ  196



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 11/125 (9%)
 Frame = +1

Query  169  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla----------a  318
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L               
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  319  aaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  498
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  499  KCYAQ  513
            +CY Q
Sbjct  192  ECYQQ  196



>ref|XP_003637421.1| Aspartic proteinase nepenthesin-1, partial [Medicago truncatula]
Length=280

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 71/113 (63%), Gaps = 10/113 (9%)
 Frame = +1

Query  178  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  354
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYITTKL------NQNFNTDK  116

Query  355  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             S  +ISG +QGSGEYF+R+G+G PP  A+MVLDTGSD+ W+QC+PC  CY Q
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCYRQ  169



>gb|KDO64536.1| hypothetical protein CISIN_1g011045mg [Citrus sinensis]
Length=495

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 11/125 (9%)
 Frame = +1

Query  169  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla----------a  318
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L               
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  319  aaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  498
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  499  KCYAQ  513
            +CY Q
Sbjct  192  ECYQQ  196



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 77/126 (61%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  324
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  74   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLK  132

Query  325  PPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P +N   + +  D ++ V+SG +QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  133  PVYNDETSYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  192

Query  496  RKCYAQ  513
              CY Q
Sbjct  193  SDCYQQ  198



>ref|XP_003555824.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 84/156 (54%), Gaps = 6/156 (4%)
 Frame = +1

Query  58   HPIFASLDYQTLSLRPLPTAQHYSLSSKPQYSQ----TLVQPDDSENTLSLDLHHIDLIS  225
            H I +   +Q L+++ + T    + ++  ++ Q     +     S     L L H D + 
Sbjct  18   HNIISYPHFQQLNVKQILTETKLNPTNTYKHLQHQKLNIATEASSPAKYKLKLVHRDKVP  77

Query  226  SAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYF  405
            +   +   +  F  R+QRD  R  AL    AA  P  A     F S V+SG+ QGSGEYF
Sbjct  78   TFNTSHDHRTRFNARMQRDTKRVAALRRHLAAGKPTYAEEA--FGSDVVSGMEQGSGEYF  135

Query  406  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             R+GVG+PP+  ++V+D+GSD++W+QC PC +CY Q
Sbjct  136  VRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCYHQ  171



>ref|XP_011459743.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=227

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 12/96 (13%)
 Frame = +1

Query  238  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS----GLAQGSGEYF  405
            N TP  LF  RL+RD+    +L+        +N TR    SS   S    GL+QGSGEYF
Sbjct  30   NQTPSQLFHLRLRRDSLHFNSLA--------YNRTRPGPPSSGFSSSIVSGLSQGSGEYF  81

Query  406  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            TR+  G+PPKY +MVLDTGSDVVWLQC+PC+ CY+Q
Sbjct  82   TRIDDGSPPKYLYMVLDTGSDVVWLQCAPCKHCYSQ  117



>ref|XP_006847790.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
 gb|ERN09371.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
Length=524

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = +1

Query  166  QPDDSE--NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA  339
            QP  S+  N L L L H D       +++ K  F  R++RD  R  AL+        +  
Sbjct  108  QPSASKPGNLLRLKLLHRDSFKPTN-SSSHKHRFESRMRRDLLRVAALAKKLGLESGYKL  166

Query  340  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            T   DF + V+SG+ QGSGEYF R+GVG+P +  FMV+DTGSD+VW+QC PC +CY Q
Sbjct  167  T---DFGAEVVSGMEQGSGEYFVRIGVGSPARDQFMVIDTGSDIVWVQCRPCLQCYQQ  221



>dbj|BAJ86414.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 73/125 (58%), Gaps = 9/125 (7%)
 Frame = +1

Query  148  YSQTLVQPDDS-ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa  324
            ++  L   +D+  +T+   L H D  S   VNAT   L   RL+RDA RA  LS  A   
Sbjct  59   FAGNLASAEDAPASTVRFRLVHRDDFS---VNATAAELLAYRLERDAKRAARLSAAAG--  113

Query  325  PPHNATRGRDFSSSVISG--LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  498
             P N TR             LAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR
Sbjct  114  -PANGTRRGGGGVVAPVVSGLAQGSGEYFTKIGVGTPATPALMVLDTGSDVVWLQCAPCR  172

Query  499  KCYAQ  513
            +CY Q
Sbjct  173  RCYEQ  177



>ref|XP_010935575.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=467

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             DF S V+SGL +GSGEYF R+G+G+PPK  FMV+D+GSD+VW+QC PC +CYAQ
Sbjct  105  EDFGSDVVSGLDEGSGEYFVRIGLGSPPKEQFMVIDSGSDIVWVQCQPCTQCYAQ  159



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 77/144 (53%), Gaps = 17/144 (12%)
 Frame = +1

Query  130  LSSKPQ--YSQTLVQPDD----SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaar  291
            LS KPQ  + QTL Q       S +  SL LH  + + +A  +   K L + RL RD+AR
Sbjct  45   LSFKPQQAFQQTLTQKQTPTSRSSSFFSLQLHTRETLFNAQ-HPDYKTLVLSRLARDSAR  103

Query  292  akalsllaaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  441
              +L      A          P     R  D S+ V SG +QGSGEYF+R+GVG P K  
Sbjct  104  VNSLETKLQLALNSVKRSELYPTQTEIRPEDLSTPVSSGTSQGSGEYFSRVGVGQPAKPF  163

Query  442  FMVLDTGSDVVWLQCSPCRKCYAQ  513
            FMVLDTGSDV WLQC PC  CY Q
Sbjct  164  FMVLDTGSDVNWLQCKPCSDCYQQ  187



>ref|XP_004147103.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004166359.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 gb|KGN51568.1| hypothetical protein Csa_5G579060 [Cucumis sativus]
Length=482

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = +1

Query  181  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR---  351
             NT  L+L H D +S   V+   +  F  R++RDA R   L    +   P      R   
Sbjct  69   NNTFKLNLLHRDKLSH--VHGHRRG-FNDRMKRDAIRVATLVRRLSHGAPAAVKDSRYKV  125

Query  352  -DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             +F++ VISG+  GSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  126  ANFATDVISGMEAGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCKPCSRCYQQ  180



>ref|XP_010551158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=495

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  343  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            R  D S+ V+SG +QGSGEYF+R+GVGTPPK  FMVLDTGSDV W+QC PC  CY Q
Sbjct  139  RPEDLSTPVVSGASQGSGEYFSRIGVGTPPKDMFMVLDTGSDVNWIQCQPCSDCYQQ  195



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 75/126 (60%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  324
            +S + LSL LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  74   NSSSPLSLTLHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLK  132

Query  325  PPHN-ATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P +N  TR    D ++ V+SG  QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  133  PVYNDETRYQTEDLTTPVVSGAGQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  192

Query  496  RKCYAQ  513
              CY Q
Sbjct  193  SDCYQQ  198



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  504
            P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC  C
Sbjct  126  PMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDC  185

Query  505  YAQ  513
            Y Q
Sbjct  186  YQQ  188



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 94/158 (59%), Gaps = 17/158 (11%)
 Frame = +1

Query  85   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSENTLSLDLHHIDLISSAAVNATPKAL  258
            QT ++  L  A+    S++P+ S +L  P   +S + LSL+LH  D+   A+ +   K+L
Sbjct  45   QTQTILSLDPARSSFTSTRPE-SVSLSDPVFLNSSSPLSLELHSRDIFV-ASQHKDYKSL  102

Query  259  FVKRLQRDaarakalsll----------aaaaPPHNA-TR--GRDFSSSVISGLAQGSGE  399
             + RL+RD++R   ++            +   P +N  TR   ++ ++ V+SG +QGSGE
Sbjct  103  VLSRLERDSSRVAGIAAKIRFAVEGIDRSDLKPVYNEDTRYQTQELTTPVVSGASQGSGE  162

Query  400  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q
Sbjct  163  YFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQ  200



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = +1

Query  139  KPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka------  300
            KP  SQ+      + +  SL LH  D + ++  +   K+L + RL RD+AR  +      
Sbjct  55   KPLESQSQESRPLNSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLDRDSARVNSLHTKLQ  113

Query  301  ----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSD  468
                    +   P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDTGSD
Sbjct  114  LALQGIKKSDLEPMHAEILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSD  173

Query  469  VVWLQCSPCRKCYAQ  513
            V WLQC+PC  CY Q
Sbjct  174  VNWLQCNPCSDCYQQ  188



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  504
            P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC  C
Sbjct  126  PMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDC  185

Query  505  YAQ  513
            Y Q
Sbjct  186  YQQ  188



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 76/126 (60%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  324
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITTKIRFAVEGIDRSDLK  134

Query  325  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  135  PVYNDETLYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  194

Query  496  RKCYAQ  513
              CY Q
Sbjct  195  SDCYQQ  200



>ref|XP_003536757.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=475

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +1

Query  196  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS  375
            L L H D + +       +  F  R+QRD  RA +L    AA  P  A     F S V+S
Sbjct  70   LKLVHRDKVPTFNTYHDHRTRFNARMQRDTKRAASLLRRLAAGKPTYAAEA--FGSDVVS  127

Query  376  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            G+ QGSGEYF R+GVG+PP+  ++V+D+GSD++W+QC PC +CY Q
Sbjct  128  GMEQGSGEYFVRIGVGSPPRNQYVVMDSGSDIIWVQCEPCTQCYHQ  173



>gb|KJB37242.1| hypothetical protein B456_006G195400 [Gossypium raimondii]
Length=482

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 83/154 (54%), Gaps = 19/154 (12%)
 Frame = +1

Query  106  LPTAQHYSLSSKPQ----YSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  261
            L  AQH  LS  PQ    ++QT  QP    ++ S  +  + L S  +V+ T     KAL 
Sbjct  43   LSQAQHI-LSFDPQSLKAFAQTQTQPLFFNSSTSAAVFSVPLHSRGSVHKTHHTDYKALV  101

Query  262  VKRLQRDaar----------akalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  411
            + RL+RD+AR          A      +   P     +    S+ +ISG +QGSGEYF+R
Sbjct  102  LSRLERDSARVDSLSTKLLLALNGVKKSQLRPLPTQIQAEALSTPIISGTSQGSGEYFSR  161

Query  412  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +GVG P K  +MVLDTGSD+ W+QC PC +CY Q
Sbjct  162  VGVGKPAKQFYMVLDTGSDINWIQCEPCNECYQQ  195



>ref|XP_004236867.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=479

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = +1

Query  163  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  342
            ++ +     L L+L H D +           +F  R+ RD  R  ++         +   
Sbjct  63   IEQESGNLKLKLNLIHRDKLQIPHFPYNNDKVFEGRISRDLKRVSSIIHRIENGGVN--Y  120

Query  343  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            R ++F S +ISG+ QGSGEYF R+GVG+PPK  +MVLD+GSD+VW+QC PC +CY Q
Sbjct  121  RVKEFGSDLISGMDQGSGEYFVRVGVGSPPKNQYMVLDSGSDIVWVQCQPCTQCYHQ  177



>gb|KDO69941.1| hypothetical protein CISIN_1g011042mg [Citrus sinensis]
Length=495

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = +1

Query  181  ENTLSLDLHHIDLISSAAVNATPKA-------LFVKRLQRDaarakalsllaaaaPPHNA  339
            E   +L+L H D +SS++ N T           F  R+QRD  R   L    +      A
Sbjct  76   EARWNLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  340  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQ  193



>gb|KEH44258.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=467

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 71/113 (63%), Gaps = 10/113 (9%)
 Frame = +1

Query  178  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  354
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYITTKL------NQNFNTDK  116

Query  355  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             S  +ISG +QGSGEYF+R+G+G PP  A+MVLDTGSD+ W+QC+PC  CY Q
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCYRQ  169



>ref|XP_006415880.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
 gb|ESQ34233.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
Length=487

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 83/153 (54%), Gaps = 13/153 (8%)
 Frame = +1

Query  88   TLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVK  267
            T S+R    A  + L    Q  Q+L     S +  +L LH    +  A  ++  K+L + 
Sbjct  39   TDSIRKTKDASSFQL--NKQEDQSLTHSPSSSSAFTLQLHSRASVRGAEHHSDYKSLTLA  96

Query  268  RLQRDaarakalsllaaaaPPHNA-----------TRGRDFSSSVISGLAQGSGEYFTRL  414
            RL+RD+AR K+L      A  + +           T  +D  + +ISG  QGSGEYFTR+
Sbjct  97   RLERDSARVKSLMARLDLAINNISKSDLKPISTTYTTQQDIEAPLISGTTQGSGEYFTRV  156

Query  415  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            G+G P +  +MVLDTGSDV WLQC+PC +CY Q
Sbjct  157  GIGNPAREVYMVLDTGSDVNWLQCAPCAECYHQ  189



>ref|XP_010551288.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Tarenaya 
hassleriana]
Length=511

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (60%), Gaps = 18/142 (13%)
 Frame = +1

Query  127  SLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDaa  288
            SLSSK    ++  Q +D    ++LSL LH     S A++        + L + RL+RD+A
Sbjct  77   SLSSKTTAFRSNKQEEDQFPPSSLSLKLH-----SRASIRGNEHRDYRTLTLARLERDSA  131

Query  289  rakals-----llaaaaPPHNATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  447
            R ++L+      ++  +P    TR  G   +  V+SG +QGSGEYF+R+G+G PP+  +M
Sbjct  132  RVRSLTTRLDLAVSRVSPAALETRDGGAKINGPVVSGTSQGSGEYFSRVGIGNPPRQVYM  191

Query  448  VLDTGSDVVWLQCSPCRKCYAQ  513
            VLDTGSDV WLQCSPC  CY Q
Sbjct  192  VLDTGSDVNWLQCSPCADCYQQ  213



>ref|XP_006437655.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
 gb|ESR50895.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
Length=495

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 69/119 (58%), Gaps = 9/119 (8%)
 Frame = +1

Query  181  ENTLSLDLHHIDLISSAAVNATPKA-------LFVKRLQRDaarakalsllaaaaPPHNA  339
            E    L+L H D +SS++ N T           F  R+QRD  R   L    +      A
Sbjct  76   EARWKLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  340  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQ  193



>ref|XP_006484478.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=495

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 69/119 (58%), Gaps = 9/119 (8%)
 Frame = +1

Query  181  ENTLSLDLHHIDLISSAAVNATPKA-------LFVKRLQRDaarakalsllaaaaPPHNA  339
            E    L+L H D +SS++ N T           F  R+QRD  R   L    +      A
Sbjct  76   EARWKLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  340  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQ  193



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 95/158 (60%), Gaps = 17/158 (11%)
 Frame = +1

Query  85   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSENTLSLDLHHIDLISSAAVNATPKAL  258
            QT ++  L  A+    S++P+ S +L  P   +S + LSL+LH  D++  A+ +   K+L
Sbjct  46   QTQTILSLDPARSSFTSTRPE-SVSLSDPVFLNSSSPLSLELHSRDILV-ASQHKDYKSL  103

Query  259  FVKRLQRDaarakalsll----------aaaaPPHNA-TR--GRDFSSSVISGLAQGSGE  399
             + RL+R+++R   ++            +   P +N  TR   ++ ++ V+SG +QGSGE
Sbjct  104  VLSRLERESSRVAGIAAKIQFAVEGIDRSDLKPVYNEDTRYQTQELTTPVVSGASQGSGE  163

Query  400  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q
Sbjct  164  YFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQ  201



>ref|XP_010466176.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Camelina 
sativa]
Length=470

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 81/149 (54%), Gaps = 11/149 (7%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  258
            D+Q + +   P +   +L +   +S      DDS +  +L L H D   S         L
Sbjct  27   DFQIIDVLQPPLSVTGTLLNDTHFS------DDSTSKYTLRLLHRDRFPSVTYRNHHHRL  80

Query  259  FVKRLQRDaarakalsllaaaaPPHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGT  426
               R++RD  R  AL    +     +++  R    DF S V+SG+ QGSGEYF R+GVG+
Sbjct  81   HA-RMRRDTDRVAALLRRISGKAVSSSSDARYEVDDFGSDVVSGMDQGSGEYFVRIGVGS  139

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PP+  +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  140  PPRDQYMVIDSGSDMVWVQCQPCKLCYKQ  168



>gb|EYU40681.1| hypothetical protein MIMGU_mgv1a005122mg [Erythranthe guttata]
Length=496

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 79/141 (56%), Gaps = 3/141 (2%)
 Frame = +1

Query  97   LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLH--HIDLISSAAVNATPKALFVKR  270
            LRP  ++ H +       S+   +P  + N+ +  LH  H D ++  + +   +  F  R
Sbjct  55   LRPPQSSSHDTNHYAAVDSELTQKPTTNHNSTAAKLHLVHRDKLA-FSWHHDHRRRFESR  113

Query  271  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  450
            ++RDA R   L    +      A    DF S V+SG+ QGSGEYF R+GVG+P +  +MV
Sbjct  114  MKRDARRVGGLIRRLSGGGGAAAYEVADFGSEVVSGMDQGSGEYFVRIGVGSPARSQYMV  173

Query  451  LDTGSDVVWLQCSPCRKCYAQ  513
            +D+GSD+VW+QC PC +CY Q
Sbjct  174  IDSGSDIVWVQCQPCSQCYHQ  194



>ref|XP_010487964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=470

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 82/149 (55%), Gaps = 11/149 (7%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  258
            D+Q + +   P +   +L +   +S      DDS +  +L L H D   S +       L
Sbjct  27   DFQIIDVLQPPLSVTGTLLNDTHFS------DDSNSKHTLRLLHRDRFPSVSYRNHHHRL  80

Query  259  FVKRLQRDaarakalsllaaaaPPHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGT  426
               R++RD  R  AL    +     +++  R    DF S V+SG+ QGSGEYF R+GVG+
Sbjct  81   HA-RMRRDTDRVAALLRRISGKTVSSSSDARYEVDDFGSDVVSGMDQGSGEYFVRIGVGS  139

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PP+  +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  140  PPRDQYMVIDSGSDMVWVQCQPCKLCYKQ  168



>ref|XP_010908909.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=448

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 85/147 (58%), Gaps = 9/147 (6%)
 Frame = +1

Query  73   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPK  252
            ++D+Q L++  L        S+  Q S+T V      N  +L+L H D ISS    ++  
Sbjct  7    TIDFQYLNVHELLI----QTSNLHQLSKTHVH---KANKWALNLVHRDTISSRNY-SSHH  58

Query  253  ALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  432
              F + + RDA R   L+   AA+    A    DF S V+SGL +GSGEYF R+GVG+PP
Sbjct  59   HRFQELMNRDARRVAGLTRRLAASTGL-AYSSEDFGSEVVSGLEEGSGEYFVRVGVGSPP  117

Query  433  KYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +  +MV+D+GSD+ W+QC PC +CY Q
Sbjct  118  REQYMVIDSGSDITWVQCQPCSQCYHQ  144



>ref|XP_010549135.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=496

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             D S+ V+SG +QGSGEYF+R+G+G PPK  FMVLDTGSDV W+QC PC +CY Q
Sbjct  142  EDLSTPVVSGASQGSGEYFSRIGIGNPPKEMFMVLDTGSDVNWIQCQPCSECYQQ  196



>ref|XP_004498098.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Cicer arietinum]
Length=465

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 70/141 (50%), Gaps = 19/141 (13%)
 Frame = +1

Query  109  PTAQHYSLSSK---PQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQR  279
            P+ QH  L  +   PQ+   L   D          H I+ I++A      K  F+ R++R
Sbjct  48   PSKQHSQLEKEQQQPQWKTKLFHRD----------HIINHINTAT---NHKTRFISRIKR  94

Query  280  Daarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  450
            D  R                   T    F S ++SG  +GSGEYF R+G+G+P  Y +MV
Sbjct  95   DIKRVSFLHNRLNKHTQVTEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQYMV  154

Query  451  LDTGSDVVWLQCSPCRKCYAQ  513
            +D+GSD+VW+QC PC +CY Q
Sbjct  155  IDSGSDIVWIQCQPCHQCYNQ  175



>ref|XP_004498097.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Cicer arietinum]
Length=478

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 70/141 (50%), Gaps = 19/141 (13%)
 Frame = +1

Query  109  PTAQHYSLSSK---PQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQR  279
            P+ QH  L  +   PQ+   L   D          H I+ I++A      K  F+ R++R
Sbjct  48   PSKQHSQLEKEQQQPQWKTKLFHRD----------HIINHINTAT---NHKTRFISRIKR  94

Query  280  Daarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  450
            D  R                   T    F S ++SG  +GSGEYF R+G+G+P  Y +MV
Sbjct  95   DIKRVSFLHNRLNKHTQVTEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQYMV  154

Query  451  LDTGSDVVWLQCSPCRKCYAQ  513
            +D+GSD+VW+QC PC +CY Q
Sbjct  155  IDSGSDIVWIQCQPCHQCYNQ  175



>emb|CDY25371.1| BnaA05g19130D [Brassica napus]
Length=397

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 78/146 (53%), Gaps = 9/146 (6%)
 Frame = +1

Query  79   DYQTLS-LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKA  255
            D+Q +  L+PL      +L   P ++ T    D+S+ TL L LH     S +  N   + 
Sbjct  27   DFQIIDVLQPLTVTGTGTL---PDFNNT----DESKYTLRL-LHRDRFPSVSYRNHHHRL  78

Query  256  LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  435
                R   D   A    +     P  +     DF S V+SG+ QGSGEYF R+GVG+PP+
Sbjct  79   HARLRRDTDRVAAILRRISGKTVPSGSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPR  138

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
              +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  139  DQYMVIDSGSDMVWVQCQPCKLCYKQ  164



>ref|XP_009351765.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Pyrus x 
bretschneideri]
Length=548

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 67/114 (59%), Gaps = 9/114 (8%)
 Frame = +1

Query  196  LDLHHIDLISSAAVNATPKA--------LFVKRLQRDaarakalsllaaaaPPHNATRGR  351
            L + H D +SS   N             LF  R++RDA R  +L+        ++     
Sbjct  121  LKVVHRDKMSSQYSNRNGNGGSHTSHSHLFRARMKRDAKRVASLTRRLLN-DSNSELESL  179

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  180  DFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECYHQ  233



>ref|XP_007043208.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
 gb|EOX99039.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
Length=481

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  126  DFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCNQCYRQ  179



>ref|XP_008340423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Malus domestica]
Length=547

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  179  DFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECYHQ  232



>ref|XP_010103590.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXB96367.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=521

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 89/170 (52%), Gaps = 26/170 (15%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDD--SEN---TLSLDLHHIDLISSAAVNAT  246
            +Q L ++   +  +  L++  + +  + + DD  SEN      L L H D +SS   +  
Sbjct  50   FQDLDVKQTISGLNTKLTTPSEDATNVFEYDDLGSENGTRKWKLKLVHRDKLSSFTSSMN  109

Query  247  PK---------------ALFVKRLQRDaarakalsllaaaaPPHNATRG------RDFSS  363
             K                +F +R++RDA R  +L    A +  ++   G       DF S
Sbjct  110  KKLDHNHNHNHDNDRHRRIFNERMKRDAHRVASLVRRLANSSNNSRISGSDKYEVEDFGS  169

Query  364  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             V+SG+ QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  170  EVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCSQCYHQ  219



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 92/158 (58%), Gaps = 17/158 (11%)
 Frame = +1

Query  85   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSENTLSLDLHHIDLISSAAVNATPKAL  258
            QT ++  L  A+    S++P  S +L  P   +S + LSL+LH  D+   A+ +   K+L
Sbjct  45   QTQTILSLDPARSSFTSTRP-VSVSLSDPVFLNSSSPLSLELHSRDIFV-ASQHKDYKSL  102

Query  259  FVKRLQRDaarakalsll----------aaaaPPHNA-TR--GRDFSSSVISGLAQGSGE  399
             + RL+RD++R   ++            +   P  N  TR   ++ ++ V+SG +QGSGE
Sbjct  103  VLSRLERDSSRVSGIAAKIRFAVEGIDRSDLKPVDNEDTRYQTQELTTPVVSGASQGSGE  162

Query  400  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q
Sbjct  163  YFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQ  200



>ref|XP_002513132.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF49635.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=481

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 81/147 (55%), Gaps = 8/147 (5%)
 Frame = +1

Query  82   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPKA  255
            +Q L+++   T    S     QY +     +D+  E    L L H D I++   ++   +
Sbjct  38   FQLLNVKEAITETKAS-----QYQELFDNQNDTLTEGKWKLKLVHRDKITAFNKSSYDHS  92

Query  256  -LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  432
              F  R+QRD  R   L    +     ++    +F + V+SG+ QGSGEYF R+GVG+PP
Sbjct  93   HNFHARIQRDKKRVATLIRRLSPRDATSSYSVEEFGAEVVSGMNQGSGEYFIRIGVGSPP  152

Query  433  KYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +  ++V+D+GSD+VW+QC PC +CY Q
Sbjct  153  REQYVVIDSGSDIVWVQCQPCTQCYHQ  179



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 75/126 (60%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  324
            +S + LSL+LH  D    A+ +   K+L + RL+RD++R   +             +   
Sbjct  75   NSSSPLSLELHSRDTFV-ASQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLK  133

Query  325  PPHNA-TR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P +N  TR    D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVYNEDTRYQTEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  193

Query  496  RKCYAQ  513
              CY Q
Sbjct  194  ADCYQQ  199



>ref|XP_008359997.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2-like [Malus domestica]
Length=539

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC  CY Q
Sbjct  171  DFGSGVVSGMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTHCYHQ  224



>gb|KDP20100.1| hypothetical protein JCGZ_05869 [Jatropha curcas]
Length=493

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 61/98 (62%), Gaps = 10/98 (10%)
 Frame = +1

Query  250  KALFVKRLQRDaarakalsllaaaa----------PPHNATRGRDFSSSVISGLAQGSGE  399
            K+L + RLQRD++R KA++     A          P     +  DFS+ V SG +QGSGE
Sbjct  97   KSLVLSRLQRDSSRVKAITTQVELAVNGISKNDLKPLVTEIQPEDFSTPVTSGTSQGSGE  156

Query  400  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            YF+R+GVG P K  +MVLDTGSD+ WLQC PC  CY Q
Sbjct  157  YFSRVGVGNPEKSFYMVLDTGSDITWLQCEPCSDCYQQ  194



>emb|CDY24567.1| BnaC05g32510D [Brassica napus]
Length=395

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW QC PC+ CY Q
Sbjct  109  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWFQCQPCKLCYKQ  162



>ref|XP_010508355.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=471

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 80/149 (54%), Gaps = 11/149 (7%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  258
            D+Q + +   P +   +L +   +S      DDS +  +L L H D   S         L
Sbjct  28   DFQIIDVLQPPLSVTGTLLNDTHFS------DDSTSKHTLRLLHRDRFPSVTYRNHHHRL  81

Query  259  FVKRLQRDaarakalsllaaaaPPHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGT  426
               R++RD  R  AL          +++  R    DF S V+SG+ QGSGEYF R+GVG+
Sbjct  82   HA-RMRRDTDRVAALLRRICGKAVSSSSDARYEVDDFGSDVVSGMDQGSGEYFVRIGVGS  140

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PP+  +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  141  PPRDQYMVIDSGSDMVWVQCQPCKLCYKQ  169



>ref|XP_002267930.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=479

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF + VISG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  124  DFGTDVISGMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTQCYHQ  177



>ref|XP_002885351.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61610.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
Length=471

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 81/149 (54%), Gaps = 9/149 (6%)
 Frame = +1

Query  79   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  258
            D+Q++ +   P     +L   P ++ T    DDS +  +L L H D   S         L
Sbjct  26   DFQSIDVLQPPLTVTETL---PDFNNTHFS-DDSNSKYTLRLLHRDRFPSVTYRNHHHRL  81

Query  259  FVKRLQRDaarakalsllaaaaPPHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGT  426
               R++RD  R  A+    +      ++  R    DF S V+SG+ QGSGEYF R+GVG+
Sbjct  82   HA-RMRRDTDRVSAILRRISGKVVVASSDSRYEVNDFGSDVVSGMDQGSGEYFVRIGVGS  140

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            PP+  +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  141  PPRDQYMVIDSGSDMVWVQCQPCKLCYKQ  169



>ref|XP_002990366.1| hypothetical protein SELMODRAFT_43971, partial [Selaginella moellendorffii]
 gb|EFJ08635.1| hypothetical protein SELMODRAFT_43971, partial [Selaginella moellendorffii]
Length=420

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  355  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            F+S +ISG+A GSG+YF R+GVGTP +  +MV DTGSDV WLQCSPCRKCY Q
Sbjct  66   FASPLISGIAGGSGDYFARIGVGTPARSVYMVADTGSDVSWLQCSPCRKCYRQ  118



>ref|XP_009760593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=494

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 65/111 (59%), Gaps = 3/111 (3%)
 Frame = +1

Query  181  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFS  360
            +    L L H D +  +   +    +F  R++RD  R  +L         +   R  +F 
Sbjct  85   QKNWKLKLIHRDKLHFSNYFSNHSKMFEARMKRDIKRVSSLIHRITGGGVY---RVEEFG  141

Query  361  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            S+VISG+ QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  142  SNVISGMDQGSGEYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQ  192



>ref|XP_011089579.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2 [Sesamum indicum]
Length=479

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 73/121 (60%), Gaps = 8/121 (7%)
 Frame = +1

Query  151  SQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP  330
            ++ + +P  S +T+ L L H D ++ +  N   +  F  R++RDA R   L   A     
Sbjct  65   NEVIQKPLTSNSTVKLHLVHRDKLAFSWHN-DHRRRFEARMKRDARRVAGLLRXA-----  118

Query  331  HNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  510
              A    DF + V+SG+ QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY 
Sbjct  119  --AYEVADFGAEVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCSQCYH  176

Query  511  Q  513
            Q
Sbjct  177  Q  177



>ref|XP_008351877.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  325  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  504
            P H   + +D S+ V+SG++QGSGEYF+R+GV TP K  +MVLDTGSDV WLQC PC  C
Sbjct  126  PMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVXTPAKSFYMVLDTGSDVNWLQCGPCSDC  185

Query  505  YAQ  513
            Y Q
Sbjct  186  YQQ  188



>ref|XP_006360843.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=479

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +1

Query  163  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  342
            ++ ++    L L L H D +           +F  R+ RD  R  ++         +   
Sbjct  63   IEQENGNWKLKLKLIHRDKLQIPHFPYNNNKVFEGRINRDLKRVSSIIHRIENGGVN--Y  120

Query  343  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            R  +F S +ISG+ QGSGEYF R+GVG+P K  +MVLD+GSD+VW+QC PC +CY Q
Sbjct  121  RVEEFGSDLISGMDQGSGEYFVRIGVGSPAKNQYMVLDSGSDIVWVQCQPCTQCYHQ  177



>emb|CBI35367.3| unnamed protein product [Vitis vinifera]
Length=521

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF + VISG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  185  DFGTDVISGMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTQCYHQ  238



>ref|XP_009385987.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SGL +GSGEYF R+GVG PP+  ++V+D+GSD+VW+QC PC +CYAQ
Sbjct  102  DFGSEVVSGLEEGSGEYFVRVGVGVPPRDQYLVVDSGSDIVWIQCRPCSQCYAQ  155



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 75/126 (60%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  324
            +S + LSL+LH  D    A+ +   K+L + RL+RD++R   +             +   
Sbjct  75   NSSSPLSLELHSRDTFV-ASQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLK  133

Query  325  PPHNA-TR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P +N  TR    D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVYNEDTRYQTEDLTTPVVSGASQGSGEYFSRIGVGTPAKDMYLVLDTGSDVNWIQCEPC  193

Query  496  RKCYAQ  513
              CY Q
Sbjct  194  ADCYQQ  199



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 62/99 (63%), Gaps = 12/99 (12%)
 Frame = +1

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSG  396
            KAL + RL RD+AR  AL+     A  +N TR             D S+ V+SG +QGSG
Sbjct  99   KALVLARLGRDSARVDALASKLNLAL-NNVTRTDLTPLRTEIQPEDLSTPVVSGTSQGSG  157

Query  397  EYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            EYF+R+GVGTP K  +MVLDTGSDV WLQC PC  CY Q
Sbjct  158  EYFSRIGVGTPAKQFYMVLDTGSDVNWLQCQPCTDCYQQ  196



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 75/126 (60%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa---------P  327
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++     A          
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  133

Query  328  PHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P N    R      ++ V+SG++QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVNNEDTRYQPEALTTPVVSGVSQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  193

Query  496  RKCYAQ  513
              CY Q
Sbjct  194  SDCYQQ  199



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 76/126 (60%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa---------P  327
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++     A          
Sbjct  77   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  135

Query  328  PHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P +    R    D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  136  PVDIDETRFQPEDLTTPVVSGTSQGSGEYFSRIGVGTPAKEMYVVLDTGSDVNWIQCLPC  195

Query  496  RKCYAQ  513
             +CY Q
Sbjct  196  SECYQQ  201



>gb|KFK39328.1| hypothetical protein AALP_AA3G230300 [Arabis alpina]
Length=460

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  105  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQ  158



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 72/130 (55%), Gaps = 11/130 (8%)
 Frame = +1

Query  154  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------l  303
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+           
Sbjct  64   QVHLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  122

Query  304  sllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  483
               +   P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  123  LKRSDLEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  182

Query  484  CSPCRKCYAQ  513
            C PC  CY Q
Sbjct  183  CQPCTDCYQQ  192



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 72/130 (55%), Gaps = 11/130 (8%)
 Frame = +1

Query  154  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------l  303
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+           
Sbjct  64   QVHLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  122

Query  304  sllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  483
               +   P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  123  LKRSDLEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  182

Query  484  CSPCRKCYAQ  513
            C PC  CY Q
Sbjct  183  CQPCTDCYQQ  192



>ref|XP_009398943.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 95/178 (53%), Gaps = 26/178 (15%)
 Frame = +1

Query  58   HPIFASLDYQTLSLRPLPTA---QHYSLSSKPQYSQTL---VQPDDSENTLSLDLHHIDL  219
            HP   S  Y T +   + T+    H +LS +P  S  L   + P D  + +S+ LH  D 
Sbjct  30   HPEVQSTGYPTTATLDVSTSLAQAHLALSYRPPSSTELPSHLLPYDPSSAISVALHSRDF  89

Query  220  I-----SSAAVNATPKALFVKRLQRDaarakalsllaaaa---------PPHNATRGRDF  357
            +     SSA  +   KAL + RL RD AR +++++ A  A          P+   +    
Sbjct  90   LPSFVGSSAHGHPDYKALTLARLFRDVARVRSIAVRATLAFGAVADSVLNPNTDVKALQI  149

Query  358  SS------SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            ++      SVISG + GSGEYF+R+GVG+PPK  +M+LDTGSDV W+QC PC  CY Q
Sbjct  150  AAVNSIMGSVISGASMGSGEYFSRVGVGSPPKPLYMILDTGSDVSWVQCLPCADCYEQ  207



>ref|XP_008465249.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=477

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 4/114 (4%)
 Frame = +1

Query  172  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  351
            + S++   L L H D +        P+  F +R+ RD+ R  +L  L + A     T   
Sbjct  66   NSSQSQWKLKLFHRDKLPLNFDTNHPRR-FKERISRDSKRVSSLLRLLSNASDEQVT---  121

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG  QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY Q
Sbjct  122  DFGSDVVSGTEQGSGEYFVRIGVGSPPRSQYVVIDSGSDIVWVQCQPCSECYQQ  175



>ref|XP_009145693.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=467

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 78/146 (53%), Gaps = 9/146 (6%)
 Frame = +1

Query  79   DYQTLS-LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKA  255
            D+Q +  L+PL      +L   P ++ T    D+S+ TL L LH     S +  N   + 
Sbjct  28   DFQIIDVLQPLTVTGTGTL---PDFNNT----DESKYTLRL-LHRDRFPSVSYRNHHHRL  79

Query  256  LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  435
                R   D   A    +     P  +     DF S V+SG+ QGSGEYF R+GVG+PP+
Sbjct  80   HARLRRDTDRVAAILRRISGKTVPYGSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPR  139

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
              +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  140  DQYMVIDSGSDMVWVQCQPCKLCYKQ  165



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 11/130 (8%)
 Frame = +1

Query  154  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------l  303
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+           
Sbjct  62   QVRLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  120

Query  304  sllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  483
               +   P        D S+ ++SG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  121  LKRSDLEPLKTEILPEDLSTPIVSGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  180

Query  484  CSPCRKCYAQ  513
            C PC  CY Q
Sbjct  181  CQPCTDCYQQ  190



>ref|XP_006297584.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
 gb|EOA30482.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
Length=475

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  120  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQ  173



>ref|XP_007153018.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
 gb|ESW25012.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
Length=464

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 7/120 (6%)
 Frame = +1

Query  166  QPDDSE---NTLSLDLHHIDLISSAA-VNATPKALFVKRLQRDaarakalsllaaaaPPH  333
            +P+D E       + L H D IS A  +N + +  F +R++RDA R  ++    + A   
Sbjct  46   EPEDLEEKQGNWKVQLLHRDKISKAPPMNHSTR--FNQRMKRDAKRVSSIVNKNSDARTE  103

Query  334  NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             A     F S V+SG+ +GSGEYF R+G+G+P  Y +MV+D+GSD+VW+QC PC  CY Q
Sbjct  104  AAEEA-SFGSDVVSGMEEGSGEYFVRIGIGSPATYQYMVIDSGSDIVWVQCQPCDLCYNQ  162



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             DF S ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY Q
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQ  188



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             DF S ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY Q
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQ  188



>ref|XP_008445900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=481

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +F++ VISG+ +GSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  126  NFATDVISGMEEGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCSRCYQQ  179



>emb|CDY24395.1| BnaCnng04620D [Brassica napus]
Length=482

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 85/155 (55%), Gaps = 26/155 (17%)
 Frame = +1

Query  94   SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  261
            S+R    A  + L+ + ++SQ    P  S  + SL LH     S A+V  T      +L 
Sbjct  41   SIRKTKDASSFRLNQQEEHSQ---YPTSS--SFSLQLH-----SRASVRGTEHPDYNSLT  90

Query  262  VKRLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSGEYFT  408
            + RL RD+AR K+L+        +N TR             +  + +ISG  QGSGEYFT
Sbjct  91   LARLHRDSARVKSLTARLNL-AINNITRADLKHTMYTTEQEEIEAPLISGTTQGSGEYFT  149

Query  409  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            R+G+G+P +  +MVLDTGSDV WLQC+PC +CY Q
Sbjct  150  RVGIGSPAREVYMVLDTGSDVNWLQCAPCAQCYHQ  184



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             DF S ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY Q
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQ  188



>ref|NP_188636.2| protein ASPARTIC PROTEASE IN GUARD CELL 2 [Arabidopsis thaliana]
 sp|Q9LHE3.1|ASPG2_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 2; Short=AtASPG2; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03167.1| nucleoid chloroplast DNA-binding protein-like [Arabidopsis thaliana]
 gb|AAO41867.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76319.1| protein aspartic protease in guard cell 2 [Arabidopsis thaliana]
Length=470

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S ++SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q
Sbjct  115  DFGSDIVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQ  168



>ref|XP_008791252.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=469

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +DF S V+SGL +GSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY Q
Sbjct  111  QDFGSEVVSGLEEGSGEYFVRVGVGSPPREQYMVIDSGSDITWVQCQPCSQCYHQ  165



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 75/135 (56%), Gaps = 11/135 (8%)
 Frame = +1

Query  139  KPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaar---------  291
            KP  SQ+      + + LSL LH  D + ++  +   K+L   RL RD+AR         
Sbjct  55   KPLESQSQESRPLNSSALSLQLHPRDALFNSQ-HKDYKSLTRTRLYRDSARVHSLHSKLQ  113

Query  292  -akalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSD  468
             A      +   P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MV DTGSD
Sbjct  114  LALQGIKKSDLEPMHAKILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVPDTGSD  173

Query  469  VVWLQCSPCRKCYAQ  513
            V WLQC PC  CY Q
Sbjct  174  VNWLQCDPCSDCYQQ  188



>emb|CDX75968.1| BnaC03g40510D [Brassica napus]
Length=503

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 75/126 (60%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  324
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R  A++            +   
Sbjct  78   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAAIAAKVRFSVEGVNRSDLK  136

Query  325  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC
Sbjct  137  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPC  196

Query  496  RKCYAQ  513
              CY Q
Sbjct  197  SDCYEQ  202



>ref|XP_004297710.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=477

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +1

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGT  426
            K++F  R+ RD  R  +L               + DF S V+SG+AQGSGEYF R+GVG+
Sbjct  84   KSIFHARIHRDVKRVDSLMRRLGGNSNDQVMNKKLDFGSEVVSGMAQGSGEYFVRIGVGS  143

Query  427  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P +  ++V+D+GSD+VW+QC PC +CY Q
Sbjct  144  PARSQYVVIDSGSDIVWVQCQPCSQCYHQ  172



>ref|XP_011008360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=484

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  343  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +  D  S +ISG +QGSGEYF+R+G+G PP  A+++LDTGSDV W+QC+PC +CY Q
Sbjct  130  KSEDLQSPIISGTSQGSGEYFSRVGIGKPPSQAYLILDTGSDVNWVQCAPCAECYQQ  186



>ref|XP_002970504.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
 gb|EFJ28634.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
Length=483

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 70/127 (55%), Gaps = 4/127 (3%)
 Frame = +1

Query  142  PQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNA--TPKALFVKRLQRDaarak-alsll  312
            P  ++  + P D   TLSL+L H + +   A     T + L ++ LQRD  R +   S  
Sbjct  41   PVKNKLQLSPRDG-GTLSLELIHRNSLLREAKEKLHTHEQLLLETLQRDEQRVRWIESKA  99

Query  313  aaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSP  492
              A    +     D +  V SGL  GSGEYF RLGVGTP +  FMV+DTGSD+ WLQC P
Sbjct  100  QLAGKKKDEASSTDLNGPVTSGLLYGSGEYFVRLGVGTPARSLFMVVDTGSDLPWLQCQP  159

Query  493  CRKCYAQ  513
            C+ CY Q
Sbjct  160  CKSCYKQ  166



>ref|XP_009135580.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=499

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (59%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  324
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R   ++            +   
Sbjct  73   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLK  131

Query  325  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC
Sbjct  132  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPC  191

Query  496  RKCYAQ  513
              CY Q
Sbjct  192  SDCYEQ  197



>emb|CDX82342.1| BnaA03g34790D [Brassica napus]
Length=499

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (59%), Gaps = 14/126 (11%)
 Frame = +1

Query  175  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  324
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R   ++            +   
Sbjct  73   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLK  131

Query  325  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC
Sbjct  132  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPC  191

Query  496  RKCYAQ  513
              CY Q
Sbjct  192  SDCYEQ  197



>ref|XP_004150193.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004170426.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
Length=476

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 8/116 (7%)
 Frame = +1

Query  172  DDSENTLSLDLHHIDLISSAAVNATPK--ALFVKRLQRDaarakalsllaaaaPPHNATR  345
            + S++   L L H D +    +N  P     F +R+ RD+ R  +L  L ++      T 
Sbjct  65   NSSQSQWKLKLFHRDKL---PLNFDPDHPRRFKERISRDSKRVSSLLRLLSSGSDEQVT-  120

Query  346  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
              DF S V+SG  QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY Q
Sbjct  121  --DFGSDVVSGTEQGSGEYFVRIGVGSPPRSQYVVIDSGSDIVWVQCQPCSECYQQ  174



>ref|XP_010031370.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
Length=496

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             DF S V+SG+ QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY Q
Sbjct  142  EDFGSDVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCNQCYRQ  196



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 70/129 (54%), Gaps = 13/129 (10%)
 Frame = +1

Query  166  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA--  339
            Q + S++  SL LH    +     ++  K+L + RL RD AR K+L      A  + +  
Sbjct  57   QEEQSQSPFSLKLHSRASVRGGVEHSDYKSLTLARLDRDTARVKSLVTRLDLALNNISKA  116

Query  340  -----------TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQC  486
                       T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQC
Sbjct  117  DLKPVITTMYTTDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQC  176

Query  487  SPCRKCYAQ  513
            +PC  CY Q
Sbjct  177  APCADCYHQ  185



>ref|XP_002979394.1| hypothetical protein SELMODRAFT_53966, partial [Selaginella moellendorffii]
 gb|EFJ19802.1| hypothetical protein SELMODRAFT_53966, partial [Selaginella moellendorffii]
Length=353

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  361  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            S +ISG+A GSG+YF R+GVGTP +  +MV DTGSDV WLQCSPCRKCY Q
Sbjct  1    SPLISGIAGGSGDYFARIGVGTPARSVYMVADTGSDVSWLQCSPCRKCYRQ  51



>ref|XP_009607692.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=489

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +1

Query  268  RLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  447
            R++RD  R   L         +N     +F S VISG+ QGSGEYF R+GVG+P +  +M
Sbjct  106  RVKRDVKRVDTLIHKITGGNNNNVYEVEEFGSEVISGMEQGSGEYFVRIGVGSPVREQYM  165

Query  448  VLDTGSDVVWLQCSPCRKCYAQ  513
            V+D GSD+VW+QC PC  CY Q
Sbjct  166  VIDAGSDIVWVQCQPCTHCYHQ  187



>emb|CDY51131.1| BnaA07g37140D [Brassica napus]
Length=436

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 79/144 (55%), Gaps = 20/144 (14%)
 Frame = +1

Query  94   SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  261
            S+R    A  + L+ + + S T   P  S ++ SL LH     S A+V        K+L 
Sbjct  41   SIRRTKGAPSFQLNQQEEQSHT---PSFSSSSFSLQLH-----SRASVQGNEHSDYKSLT  92

Query  262  VKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  441
            + RL RD+AR    ++          T  ++  + +ISG  QGSGEYFTR+G+G P +  
Sbjct  93   LARLDRDSARPVITTMY--------TTEQQEIEAPLISGTTQGSGEYFTRVGIGNPAREV  144

Query  442  FMVLDTGSDVVWLQCSPCRKCYAQ  513
            +MVLDTGSDV WLQC+PC  CY Q
Sbjct  145  YMVLDTGSDVNWLQCAPCADCYHQ  168



>ref|XP_004497116.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=469

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 5/88 (6%)
 Frame = +1

Query  250  KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTP  429
            K+L + RL RD+AR  ++       P  N  +    S  +ISG +QGSGEYF+R+G+G P
Sbjct  89   KSLTLARLARDSARVNSIVTQLD--PNFNVEK---LSGPIISGTSQGSGEYFSRIGIGEP  143

Query  430  PKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            P  A+MVLDTGSD+ W+QC+PC  CY Q
Sbjct  144  PSQAYMVLDTGSDISWVQCAPCADCYHQ  171



>ref|XP_010460347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  340  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQCSPC  CY Q
Sbjct  127  TDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCSPCADCYHQ  184



>emb|CDP04865.1| unnamed protein product [Coffea canephora]
Length=523

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             +F + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC  CY Q
Sbjct  167  EEFGTEVVSGMEQGSGEYFVRIGVGSPPRNQYMVVDSGSDIVWVQCQPCNLCYHQ  221



>ref|NP_173922.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50814.1|AC079281_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAM20575.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15613.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30636.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=483

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  340  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            T  +D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQC+PC  CY Q
Sbjct  128  TEEQDIEAPLISGTTQGSGEYFTRVGIGKPAREVYMVLDTGSDVNWLQCTPCADCYHQ  185



>emb|CDM83204.1| unnamed protein product [Triticum aestivum]
Length=492

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  379  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            LAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q
Sbjct  133  LAQGSGEYFTKIGVGTPATPALMVLDTGSDVVWLQCAPCRRCYEQ  177



>ref|XP_010688619.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Beta vulgaris 
subsp. vulgaris]
Length=544

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  355  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            F S V+SG+ QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC++CY Q
Sbjct  189  FGSDVVSGMDQGSGEYFIRIGVGSPQRKQYMVIDSGSDIVWVQCQPCKQCYKQ  241



>gb|ABK24255.1| unknown [Picea sitchensis]
 gb|ABR16185.1| unknown [Picea sitchensis]
Length=485

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            DF S V+SG+ QGSGEYF+R+GVG P +   MVLDTGSDV W+QC PC  CY Q
Sbjct  129  DFQSPVVSGMDQGSGEYFSRIGVGAPRRDQLMVLDTGSDVTWIQCEPCSDCYQQ  182



>ref|XP_006362549.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=482

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 69/128 (54%), Gaps = 17/128 (13%)
 Frame = +1

Query  181  ENTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDaarakalsl----------laa  318
            EN +S  L    L S  AV  T      +L + RL+RD+ARAK+L             + 
Sbjct  56   ENQISSSLLSFQLHSRVAVRGTSHKDYNSLMLARLERDSARAKSLQTRVDLVVQGIGKSD  115

Query  319  aaPPHNATR---GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCS  489
              P     R     +    +ISG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QCS
Sbjct  116  LKPMETEFREIQAEEIEGPIISGTSQGSGEYFSRIGIGHPPSQVYMVLDTGSDVNWVQCS  175

Query  490  PCRKCYAQ  513
            PC  CY Q
Sbjct  176  PCADCYQQ  183



>ref|XP_004960076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=468

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  352  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            D  S V+SGL +GSGEYF R+GVG+PP   ++V+D+GSDV+W+QC PC +CYAQ
Sbjct  109  DLGSEVVSGLDEGSGEYFVRVGVGSPPTEQYLVVDSGSDVIWVQCKPCSQCYAQ  162



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 79/126 (63%), Gaps = 20/126 (16%)
 Frame = +1

Query  190  LSLDLHHIDLISSAAVNATP---KALFVKRLQRDaarakalsllaaaaPPHNATRG----  348
            L+L+LH  D + ++A +  P   K L + RL+RD+AR K+++   A A  H+  R     
Sbjct  82   LTLELHSRDFLPTSA-HPRPNDYKTLTLDRLRRDSARVKSIAAQLALAA-HSVKRTDLKP  139

Query  349  ----RDFSSS-------VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  495
                ++F++S       ++SG +QGSGEYF+R+G+G PPK  +MVLDTGSDV W+QC PC
Sbjct  140  VAEEKEFAASAESIRGPIVSGTSQGSGEYFSRVGIGNPPKPLYMVLDTGSDVTWVQCQPC  199

Query  496  RKCYAQ  513
              CY Q
Sbjct  200  ADCYEQ  205



>emb|CBI27051.3| unnamed protein product [Vitis vinifera]
Length=256

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            ++SG +QGSGEYF+R+G+G+PPK+ +MV+DTGSDV W+QC+PC  CY Q
Sbjct  42   LVSGASQGSGEYFSRVGIGSPPKHVYMVVDTGSDVNWVQCAPCADCYQQ  90



>ref|XP_003589787.1| Aspartic proteinase nepenthesin-2 [Medicago truncatula]
Length=456

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 71/146 (49%), Gaps = 13/146 (9%)
 Frame = +1

Query  103  PLPTAQHYSLSSKPQYSQTLVQPDDSEN------TLSLDLHHIDLISSAAVNATPKALFV  264
            PL   QH  L+ +   S+T ++P   +N           L H D I+      T K  F+
Sbjct  25   PLSYFQH--LNVENAISETKLKPLKQQNHNTQQPQWKTKLFHRDNINLK--KTTHKTRFI  80

Query  265  KRLQRDaarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  435
             R+ RD  R                        F S V+SG  +GSGEYF R+G+G+P  
Sbjct  81   SRINRDIKRVTFLLNRLNKNTQEQQTTTATEASFGSDVVSGTEEGSGEYFVRIGIGSPAI  140

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            Y +MV+D+GSD+VW+QC PC +CY Q
Sbjct  141  YQYMVIDSGSDIVWIQCEPCDQCYNQ  166



>dbj|BAK07248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 86/154 (56%), Gaps = 21/154 (14%)
 Frame = +1

Query  100  RPLPTAQHYSLSSKPQYSQTLVQPDD-SENTLSLDLHHIDLI-SSAAVNATPKALFVKRL  273
            RPL    H SL+S    +  LV+ +  S   L+L LH  D +      + +  +L + RL
Sbjct  52   RPL---LHQSLASTD--TDALVKEEQRSGGKLALRLHSRDFLPEEQGRHESYSSLVLARL  106

Query  274  QRDaarakalsllaaaaP---------PHNAT-----RGRDFSSSVISGLAQGSGEYFTR  411
            +RD+ARA ALS  A+ A          P NAT        +    V+SG+ QGSGEYF+R
Sbjct  107  RRDSARAAALSARASLAADGISRADLRPANATPVFEASAAEIQGPVVSGVGQGSGEYFSR  166

Query  412  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +GVG P +  +MVLDTGSDV WLQC PC  CYAQ
Sbjct  167  VGVGRPARQLYMVLDTGSDVTWLQCQPCADCYAQ  200



>ref|XP_003565317.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brachypodium 
distachyon]
Length=529

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            V+SG+ QGSGEYF+R+G+G+P +  +MVLDTGSDV WLQC+PC  CYAQ
Sbjct  174  VVSGVGQGSGEYFSRIGIGSPARQLYMVLDTGSDVTWLQCAPCADCYAQ  222



>ref|XP_006653026.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=477

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             D  S V+SGL +GSGEYF R+GVG+PP   ++V+D+GSDV+W+QC PC +CYAQ
Sbjct  117  EDLGSDVVSGLGEGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCDQCYAQ  171



>ref|XP_010265215.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nelumbo 
nucifera]
Length=494

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +D    VISG++QGSGEYF+RLG+G P K  +MV+DTGSDV W+QC+PC  CY Q
Sbjct  141  KDLEGPVISGMSQGSGEYFSRLGIGVPAKQLYMVIDTGSDVNWVQCAPCTDCYDQ  195



>gb|AES60038.2| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=469

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 71/146 (49%), Gaps = 13/146 (9%)
 Frame = +1

Query  103  PLPTAQHYSLSSKPQYSQTLVQPDDSEN------TLSLDLHHIDLISSAAVNATPKALFV  264
            PL   QH  L+ +   S+T ++P   +N           L H D I+      T K  F+
Sbjct  25   PLSYFQH--LNVENAISETKLKPLKQQNHNTQQPQWKTKLFHRDNINLK--KTTHKTRFI  80

Query  265  KRLQRDaarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  435
             R+ RD  R                        F S V+SG  +GSGEYF R+G+G+P  
Sbjct  81   SRINRDIKRVTFLLNRLNKNTQEQQTTTATEASFGSDVVSGTEEGSGEYFVRIGIGSPAI  140

Query  436  YAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            Y +MV+D+GSD+VW+QC PC +CY Q
Sbjct  141  YQYMVIDSGSDIVWIQCEPCDQCYNQ  166



>gb|ABR17396.1| unknown [Picea sitchensis]
Length=350

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  379  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            + QGSGEYFTR+G+GTP +  +MVLDTGSDVVW+QC PCR+CY+Q
Sbjct  1    MEQGSGEYFTRIGIGTPTREQYMVLDTGSDVVWIQCEPCRECYSQ  45



>ref|XP_006306517.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
 gb|EOA39415.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
Length=482

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  340  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQC+PC  CY Q
Sbjct  127  TEQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCYHQ  184



>gb|KCW86348.1| hypothetical protein EUGRSUZ_B03036 [Eucalyptus grandis]
Length=492

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  355  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            F S V+SG +QGSGEYF+RLGVG PP   +MV+DTGSDV W+QC+PC  CY Q
Sbjct  145  FESPVVSGTSQGSGEYFSRLGVGDPPSQVYMVVDTGSDVNWVQCAPCADCYQQ  197



>ref|XP_008221090.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Prunus 
mume]
Length=542

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  355  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            F S V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY Q
Sbjct  169  FGSEVVSGMEQGSGEYFVRIGVGSPPRSQYIVIDSGSDIVWVQCQPCSQCYHQ  221



>gb|KDO70057.1| hypothetical protein CISIN_1g0117491mg, partial [Citrus sinensis]
Length=235

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  367  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV WLQC+PC  CY Q
Sbjct  139  IVSGSSQGSGEYFSRVGIGKPPSQVYMVLDTGSDVNWLQCAPCADCYQQ  187



>ref|XP_001757102.1| predicted protein [Physcomitrella patens]
 gb|EDQ77961.1| predicted protein [Physcomitrella patens]
Length=406

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            +DF + V+SGL+ GSGEYF R+ VGTPP+  ++V+DTGSD++WLQC+PC  CY Q
Sbjct  41   QDFQAPVVSGLSLGSGEYFIRISVGTPPRRMYLVMDTGSDILWLQCAPCVNCYHQ  95



>ref|XP_002315953.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEF02124.1| aspartyl protease family protein [Populus trichocarpa]
Length=484

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  349  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
             D  S +ISG +QGSGEYF+R+G+G PP  A+++LDTGSDV W+QC+PC  CY Q
Sbjct  132  EDLQSPIISGTSQGSGEYFSRVGIGKPPSQAYLILDTGSDVNWVQCAPCADCYQQ  186



>ref|XP_007227097.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
 gb|EMJ28296.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
Length=524

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  355  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  513
            F S V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY Q
Sbjct  170  FGSEVVSGMEQGSGEYFVRIGVGSPPRSQYIVIDSGSDIVWVQCQPCSQCYHQ  222



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720