BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005M21

Length=519
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234196.1|  FtsH-like protein precursor                        201   3e-57   
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    191   2e-53   Solanum tuberosum [potatoes]
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    173   4e-47   Capsicum annuum
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    171   2e-46   Nicotiana sylvestris
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    169   1e-45   Nicotiana tomentosiformis
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    169   1e-45   Sesamum indicum [beniseed]
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    169   1e-45   Nicotiana tabacum [American tobacco]
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    167   5e-45   Nicotiana tomentosiformis
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         165   2e-44   Jatropha curcas
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    164   5e-44   Nicotiana sylvestris
ref|XP_002510649.1|  Cell division protease ftsH, putative              160   1e-42   
emb|CDP07308.1|  unnamed protein product                                159   3e-42   Coffea canephora [robusta coffee]
gb|KJB14314.1|  hypothetical protein B456_002G118800                    158   7e-42   Gossypium raimondii
gb|KJB14315.1|  hypothetical protein B456_002G118800                    158   1e-41   Gossypium raimondii
gb|KJB14313.1|  hypothetical protein B456_002G118800                    157   1e-41   Gossypium raimondii
gb|KJB14312.1|  hypothetical protein B456_002G118800                    157   1e-41   Gossypium raimondii
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    157   1e-41   Gossypium arboreum [tree cotton]
ref|XP_007017988.1|  FTSH protease 1 isoform 2                          155   5e-41   
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       155   6e-41   
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    155   8e-41   Nelumbo nucifera [Indian lotus]
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    154   1e-40   Genlisea aurea
emb|CDP03477.1|  unnamed protein product                                148   2e-40   Coffea canephora [robusta coffee]
gb|EYU17514.1|  hypothetical protein MIMGU_mgv1a004291mg                150   4e-39   Erythranthe guttata [common monkey flower]
emb|CDP18582.1|  unnamed protein product                                144   4e-39   Coffea canephora [robusta coffee]
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    149   9e-39   Gossypium arboreum [tree cotton]
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    150   1e-38   
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    149   2e-38   
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    149   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    148   3e-38   Sesamum indicum [beniseed]
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    147   9e-38   Fragaria vesca subsp. vesca
gb|KDO85047.1|  hypothetical protein CISIN_1g004921mg                   146   1e-37   Citrus sinensis [apfelsine]
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    147   1e-37   Citrus sinensis [apfelsine]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             147   1e-37   Citrus clementina [clementine]
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    146   2e-37   Cucumis sativus [cucumbers]
gb|KJB57986.1|  hypothetical protein B456_009G188700                    145   2e-37   Gossypium raimondii
gb|KJB57987.1|  hypothetical protein B456_009G188700                    145   4e-37   Gossypium raimondii
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    144   8e-37   Tarenaya hassleriana [spider flower]
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    144   9e-37   Cucumis melo [Oriental melon]
emb|CAN74077.1|  hypothetical protein VITISV_000978                     143   1e-36   Vitis vinifera
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    143   2e-36   Vitis vinifera
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             140   2e-35   Prunus persica
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...    140   3e-35   Prunus mume [ume]
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...    140   4e-35   Eucalyptus grandis [rose gum]
ref|XP_002301927.1|  Cell division protein ftsH                         137   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...    137   4e-34   Populus euphratica
ref|XP_002306970.2|  Cell division protein ftsH                         136   8e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    135   1e-33   Populus euphratica
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg                133   1e-32   Erythranthe guttata [common monkey flower]
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg                132   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH            131   5e-32   Morus notabilis
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803             130   8e-32   
dbj|BAH56755.1|  AT5G42270                                              128   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5             129   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...    125   7e-30   Camelina sativa [gold-of-pleasure]
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein         123   9e-30   Medicago truncatula
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg             124   2e-29   Capsella rubella
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein         123   4e-29   Medicago truncatula
emb|CDY01840.1|  BnaC06g28800D                                          122   8e-29   
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...    122   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...    121   2e-28   Glycine max [soybeans]
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg             120   4e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...    119   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    119   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...    119   2e-27   
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...    118   2e-27   Medicago sativa [alfalfa]
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950             117   4e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...    117   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...    116   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...    115   2e-26   Brassica rapa
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g             114   4e-26   Phaseolus vulgaris [French bean]
emb|CDX96068.1|  BnaA07g26630D                                          110   2e-24   
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                    109   3e-24   Arabis alpina [alpine rockcress]
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg             109   3e-24   Capsella rubella
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...    106   3e-23   Cicer arietinum [garbanzo]
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg             106   5e-23   Eutrema salsugineum [saltwater cress]
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...    102   8e-22   Camelina sativa [gold-of-pleasure]
gb|AFW75732.1|  hypothetical protein ZEAMMB73_601488                  99.4    2e-21   
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    101   2e-21   Phoenix dactylifera
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1             100   3e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CAA68141.1|  chloroplast FtsH protease                              100   3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|EEC81336.1|  hypothetical protein OsI_24516                          100   4e-21   Oryza sativa Indica Group [Indian rice]
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                    100   5e-21   
ref|NP_001058625.1|  Os06g0725900                                       100   6e-21   
gb|EAZ38336.1|  hypothetical protein OsJ_22711                          100   6e-21   Oryza sativa Japonica Group [Japonica rice]
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                   99.0    1e-20   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...  98.6    2e-20   Elaeis guineensis
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...  97.8    3e-20   Setaria italica
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...  96.3    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760        92.8    2e-18   Amborella trichopoda
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...  92.8    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA73318.1|  ATPase                                               92.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...  91.3    7e-18   Brachypodium distachyon [annual false brome]
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726           87.8    9e-17   
gb|KIZ07525.1|  cell division protease FtsH                           79.0    2e-15   Monoraphidium neglectum
ref|XP_003057154.1|  predicted protein                                80.1    4e-14   Micromonas pusilla CCMP1545
ref|XP_001753657.1|  predicted protein                                78.6    1e-13   
ref|XP_001760664.1|  predicted protein                                78.6    1e-13   
gb|KIZ03250.1|  cell division protease FtsH                           78.2    2e-13   Monoraphidium neglectum
emb|CEF99105.1|  P-loop containing nucleoside triphosphate hydrolase  77.4    3e-13   Ostreococcus tauri
ref|XP_005843263.1|  hypothetical protein CHLNCDRAFT_141387           74.3    5e-13   Chlorella variabilis
ref|XP_001690889.1|  membrane AAA-metalloprotease                     76.6    6e-13   Chlamydomonas reinhardtii
ref|XP_003081278.1|  FTSH_MEDSA Cell division protein ftsH homolo...  76.3    8e-13   
ref|XP_007510744.1|  cell division protein FtsH2                      76.3    9e-13   Bathycoccus prasinos
ref|XP_002948337.1|  hypothetical protein VOLCADRAFT_80122            75.9    1e-12   Volvox carteri f. nagariensis
ref|XP_001419590.1|  predicted protein                                73.6    6e-12   Ostreococcus lucimarinus CCE9901
ref|XP_011396167.1|  ATP-dependent zinc metalloprotease FTSH 5, c...  72.8    1e-11   Auxenochlorella protothecoides
ref|XP_005650371.1|  membrane AAA-metalloprotease                     72.8    1e-11   Coccomyxa subellipsoidea C-169
ref|XP_002505995.1|  hypothetical protein MICPUN_106506               70.9    5e-11   Micromonas commoda
gb|AFW63099.1|  hypothetical protein ZEAMMB73_047704                  62.0    2e-08   



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            SRR+++ PQS L+K SN D+FK + SKA +AALLFSSI PQA ALDN TPAAPP  I+AE
Sbjct  32   SRRKYIVPQSILSKKSNSDNFKNVPSKAAIAALLFSSITPQAFALDNTTPAAPPQVIEAE  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
            AP+P+ASN+ PF+QN++LNAPK QAQPASDLPEG+QWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   APKPSASNSLPFAQNIILNAPKTQAQPASDLPEGTQWRYSEFLNAVKKGKVERVRFSKDG  151

Query  494  SALQLTAV  517
            S LQLTAV
Sbjct  152  STLQLTAV  159



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            S+R+ + PQS L K  N D+FK + SKA LAALLFSSI P A ALDN TPAAPP  I+AE
Sbjct  32   SKRKCIVPQSILNKKPNSDNFKNVPSKAALAALLFSSITPHAFALDNTTPAAPPQVIEAE  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
            A +P+ASN+ PF+QN++LNAPK QAQPASDLPEG+QWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   ALKPSASNSLPFAQNIILNAPKTQAQPASDLPEGTQWRYSEFLNAVKKGKVERVRFSKDG  151

Query  494  SALQLTAV  517
            S LQLTAV
Sbjct  152  STLQLTAV  159



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATP-AAPPTEIQA  310
            S+R+ +  QS L K  N D+FK   SKA LAALLFSSI P AIALD+A P A+PP  ++ 
Sbjct  7    SKRKCIITQSTLNKKPNSDNFKNAQSKAALAALLFSSITPHAIALDDAAPIASPPQVMEV  66

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
            EAP P  SN  PFSQN+VLNAPK QA P SDLPE +QWRYSEFLNAVKKGKVERVRFSKD
Sbjct  67   EAPNPNTSNPLPFSQNLVLNAPKTQASPVSDLPESTQWRYSEFLNAVKKGKVERVRFSKD  126

Query  491  GSALQLTAV  517
            GSALQLTAV
Sbjct  127  GSALQLTAV  135



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 99/128 (77%), Gaps = 2/128 (2%)
 Frame = +2

Query  140  RRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPP-TEIQAE  313
            R+ F  PQS L K  N D  K   S+A LAALLFSSI PQA ALDN TP APP + +QAE
Sbjct  34   RKFFPVPQSILNKKPNSDKVKNFPSEAALAALLFSSITPQAFALDNTTPTAPPPSVVQAE  93

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
             P+P   N S FSQN++LNAPKPQAQ  SD+P+GSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  94   TPKPNPLNPSSFSQNLILNAPKPQAQSTSDIPDGSQWRYSEFLNAVKKGKVERVRFSKDG  153

Query  494  SALQLTAV  517
            S LQLTAV
Sbjct  154  SVLQLTAV  161



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  310
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNLKNIPSKAALAALLFSSITPHAFALDNTTPTVPTPQVIQA  91

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
            EA  P+ SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  92   EAANPSTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSKD  149

Query  491  GSALQLTAV  517
            GSALQLTAV
Sbjct  150  GSALQLTAV  158



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 101/126 (80%), Gaps = 3/126 (2%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQAEAP  319
            R+F+ PQS+  N N +  K +SS   LAALLFSSIAPQA+ALDN  P AP P  I+ EA 
Sbjct  31   RKFIVPQSILNNKNSNKSKVVSSHGALAALLFSSIAPQALALDNTPPPAPAPQVIEIEAQ  90

Query  320  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  499
            +   S +SPF+QN++LNAPKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVERVRFSK+GSA
Sbjct  91   K--TSQSSPFAQNLILNAPKPQAQSTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKEGSA  148

Query  500  LQLTAV  517
            LQLTAV
Sbjct  149  LQLTAV  154



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  310
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNSKNIPSKAALAALLFSSITPHAYALDNTTPTVPTPRVIQA  91

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
            EA  PT SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  92   EAANPTTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSKD  149

Query  491  GSALQLTAV  517
            GSALQLTAV
Sbjct  150  GSALQLTAV  158



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 100/129 (78%), Gaps = 3/129 (2%)
 Frame = +2

Query  140  RRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPP-TEIQAE  313
            R+ F  PQS L K  N D  K   S+A LAAL FSSI PQA ALDN TP APP + +QAE
Sbjct  38   RKFFPVPQSILNKKPNSDKVKNFPSEAALAALFFSSITPQAFALDNTTPTAPPPSVVQAE  97

Query  314  APQPTASNASPFSQNVVLNAPKPQA-QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
             P+P   N SPFSQN++LNAPKPQA Q +SD+P+GSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  98   TPKPNPLNPSPFSQNLILNAPKPQAAQSSSDIPDGSQWRYSEFLNAVKKGKVERVRFSKD  157

Query  491  GSALQLTAV  517
            G+ LQLTAV
Sbjct  158  GTVLQLTAV  166



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  188  DSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVL  367
            DS K + S+ATLAALLFSS+ PQA+ALDN+T   PP  I+A+  +P+ASN+SPFSQN++L
Sbjct  57   DSLKSIPSQATLAALLFSSLTPQALALDNSTVPTPPPVIEAQPTKPSASNSSPFSQNLLL  116

Query  368  NAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
             APKPQ+Q  +DLPEG+QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV
Sbjct  117  TAPKPQSQSTTDLPEGTQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  166



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 98/129 (76%), Gaps = 4/129 (3%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  310
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNSKNIPSKAALAALLFSSITPHAYALDNTTPTVPTPQVIQA  91

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
            EA  PT SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  92   EAANPTTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSKD  149

Query  491  GSALQLTAV  517
            G+ LQL AV
Sbjct  150  GTTLQLNAV  158



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +2

Query  188  DSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVL  367
            DS K + ++ATLA LLFSS++PQA ALDN TP+ PP  ++A+  +P  SN+SPFSQN++L
Sbjct  62   DSLKSIQTQATLATLLFSSLSPQAFALDNPTPSPPPV-LEAQPTKPNPSNSSPFSQNLLL  120

Query  368  NAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
             APKPQ+Q  SDLPEG+QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV
Sbjct  121  TAPKPQSQSTSDLPEGTQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  170



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = +2

Query  143  RRFLAPQSLT----KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  310
            R+FL PQS+      NS   S K + SKATLAALLFSSI P+A+A+DN  P   P  IQA
Sbjct  29   RKFLVPQSILGGKKSNSISQSLKDIPSKATLAALLFSSINPRALAVDNTAPPTLPPVIQA  88

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
            EAPQP+ SN SPFSQN++LNAPKPQAQP++DLPEGSQWRYSEFLNAVKKGKVERVRF KD
Sbjct  89   EAPQPSPSNPSPFSQNLILNAPKPQAQPSTDLPEGSQWRYSEFLNAVKKGKVERVRFGKD  148

Query  491  GSALQLTAV  517
            GSALQLTAV
Sbjct  149  GSALQLTAV  157



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  142

Query  494  SALQLTAV  517
            SALQLTAV
Sbjct  143  SALQLTAV  150



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  142

Query  494  SALQLTAV  517
            SALQLTAV
Sbjct  143  SALQLTAV  150



>gb|KJB14313.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=600

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  142

Query  494  SALQLTAV  517
            SALQLTAV
Sbjct  143  SALQLTAV  150



>gb|KJB14312.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=588

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  142

Query  494  SALQLTAV  517
            SALQLTAV
Sbjct  143  SALQLTAV  150



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S ATLAALLFS++APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHTVKTLQSHATLAALLFSAVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  142

Query  494  SALQLTAV  517
            SALQLTAV
Sbjct  143  SALQLTAV  150



>ref|XP_007017988.1| FTSH protease 1 isoform 2 [Theobroma cacao]
 gb|EOY15213.1| FTSH protease 1 isoform 2 [Theobroma cacao]
Length=577

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +2

Query  191  SFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
            S K L S ATLAALLFSS+ PQA+A+DNA P  PP  I+A+  +P+ SN SPF+QN++L 
Sbjct  47   SLKTLQSHATLAALLFSSVTPQALAVDNA-PPTPPAVIEAQPTKPSPSNQSPFAQNLLLT  105

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV
Sbjct  106  APKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  153



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +2

Query  191  SFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
            S K L S ATLAALLFSS+ PQA+A+DNA P  PP  I+A+  +P+ SN SPF+QN++L 
Sbjct  47   SLKTLQSHATLAALLFSSVTPQALAVDNA-PPTPPAVIEAQPTKPSPSNQSPFAQNLLLT  105

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV
Sbjct  106  APKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  153



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 105/135 (78%), Gaps = 9/135 (7%)
 Frame = +2

Query  137  SRRRFLAPQSLTKN---SNPDSFKGLSSKATLAALLFSSIA---PQAIALDNA--TPAAP  292
            ++R+FL  +S  K    SN ++ + + S+ATLAAL+FSSIA   P A+A+DN   TP+ P
Sbjct  38   TKRKFLITKSTLKRNPISNSNTLRNIPSQATLAALIFSSIAQNPPAALAIDNNINTPSPP  97

Query  293  PTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVER  472
            P  I+AEA +   S +SPFSQN++L APKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVER
Sbjct  98   PA-IEAEATKANPSASSPFSQNLLLTAPKPQAQSTSDLPEGSQWRYSEFLNAVKKGKVER  156

Query  473  VRFSKDGSALQLTAV  517
            VRFSKDGSALQLTAV
Sbjct  157  VRFSKDGSALQLTAV  171



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQ  322
            R+   PQS+      +  K + + A  AA LFSS+AP A+ALDN +P AP   I+ EA +
Sbjct  27   RKLFVPQSILDGKCSNRSKCIQNHAAFAAFLFSSVAPNALALDNVSPPAPQV-IEIEAQK  85

Query  323  PTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSAL  502
             T+S  SPF+QN++LNAPKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVERVRFSK+GSAL
Sbjct  86   TTSS--SPFAQNLILNAPKPQAQSNSDLPEGSQWRYSEFLNAVKKGKVERVRFSKEGSAL  143

Query  503  QLTAV  517
            QLTA+
Sbjct  144  QLTAI  148



>emb|CDP03477.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = +2

Query  149  FLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQP  325
            FL+P +  T  S P  F  + SKATLAALLFSSI P+A+A+DN  P   P  IQAEAPQP
Sbjct  15   FLSPPTPKTTKSLPRKFLDIPSKATLAALLFSSINPRALAVDNTAPPTLPPVIQAEAPQP  74

Query  326  TASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQ  505
            + SN SPFSQN++LNAP+PQAQP++DLPEGSQWRYSEFLNAVKKGKVERVRF KDGSALQ
Sbjct  75   SPSNPSPFSQNLILNAPQPQAQPSTDLPEGSQWRYSEFLNAVKKGKVERVRFGKDGSALQ  134

Query  506  LTAV  517
            LTAV
Sbjct  135  LTAV  138



>gb|EYU17514.1| hypothetical protein MIMGU_mgv1a004291mg [Erythranthe guttata]
Length=534

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 100/136 (74%), Gaps = 19/136 (14%)
 Frame = +2

Query  143  RRFLAPQSL----------TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP  292
            RRFL PQS+          TK++N +    +++ A LAALLFSSI PQA ALDN+ P AP
Sbjct  35   RRFLLPQSILNRRIISDKSTKSNNNN----ITNHAALAALLFSSITPQAFALDNSPPPAP  90

Query  293  PT-EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVE  469
               EI+A+     A  +SP +QN+VLNAPKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVE
Sbjct  91   QVIEIEAQ----KAVQSSPVAQNLVLNAPKPQAQSNSDLPEGSQWRYSEFLNAVKKGKVE  146

Query  470  RVRFSKDGSALQLTAV  517
            RVRFSK+GS LQLTAV
Sbjct  147  RVRFSKEGSTLQLTAV  162



>emb|CDP18582.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  209  SKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQA  388
            SKATLAALLFSSI P+A+A+DN  P   P  IQAEAPQP+ SN SPFSQN++LNAP+PQA
Sbjct  9    SKATLAALLFSSINPRALAVDNTAPPTLPPVIQAEAPQPSPSNPSPFSQNLILNAPQPQA  68

Query  389  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            QP++DLPEGSQWRYSEFLNAVKKGKVERVRF KDGSALQLTAV
Sbjct  69   QPSTDLPEGSQWRYSEFLNAVKKGKVERVRFGKDGSALQLTAV  111



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 4/127 (3%)
 Frame = +2

Query  143  RRFLAPQSLTKN--SNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  316
            R+    QS+  N  ++  +F+ L S ATLAAL FSS+ PQA+A+DNA P  PP  I+A+ 
Sbjct  26   RKLQVTQSILNNKPNSNHTFRALQSHATLAALYFSSVTPQALAVDNAPPTPPPV-IEAQP  84

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  496
              P+  N SPFSQ+++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS
Sbjct  85   TNPSPLNQSPFSQDLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  143

Query  497  ALQLTAV  517
             LQL+AV
Sbjct  144  FLQLSAV  150



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 101/129 (78%), Gaps = 5/129 (4%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  310
            S+R+  A +++  NS PDS   K  +S+ATLAALLFSS+ PQA+A+DN     PP  +Q 
Sbjct  44   SKRKLFATKNIF-NSQPDSEPLKSAASQATLAALLFSSLTPQALAIDNTPTPTPPPVLQP  102

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
            +  +  A  ASPFSQN++LNAPKPQ+Q A+DLPEGSQWRYSEFLNAVKKGKVERVRF KD
Sbjct  103  QPSKSNA--ASPFSQNLLLNAPKPQSQVATDLPEGSQWRYSEFLNAVKKGKVERVRFMKD  160

Query  491  GSALQLTAV  517
            GSALQLTAV
Sbjct  161  GSALQLTAV  169



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 102/131 (78%), Gaps = 6/131 (5%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQ  307
            S+R+  A +++  NS PDS  FK  +S+ATLAALLFSS+ PQ A+A+DN     P   + 
Sbjct  44   SQRKLFATKNIF-NSKPDSQPFKSATSQATLAALLFSSLTPQPALAIDNTPTPTPTPPLV  102

Query  308  AEAPQPTASNAS-PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFS  484
             +A QP+  NAS PFSQN++LNAPKPQ+Q  +DLPEGSQWRYSEFLNAVKKGKVERVRF 
Sbjct  103  LQA-QPSKPNASSPFSQNLLLNAPKPQSQVTTDLPEGSQWRYSEFLNAVKKGKVERVRFV  161

Query  485  KDGSALQLTAV  517
            KDGSALQLTAV
Sbjct  162  KDGSALQLTAV  172



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 102/131 (78%), Gaps = 6/131 (5%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQ  307
            S+R+  A +++  NS PDS  FK  +S+ATLAALLFSS+ PQ A+A+DN     P   + 
Sbjct  44   SQRKLFATKNIF-NSKPDSQPFKSATSQATLAALLFSSLTPQPALAIDNTPTPTPTPPLV  102

Query  308  AEAPQPTASNAS-PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFS  484
             +A QP+  NAS PFSQN++LNAPKPQ+Q  +DLPEGSQWRYSEFLNAVKKGKVERVRF 
Sbjct  103  LQA-QPSKPNASSPFSQNLLLNAPKPQSQVTTDLPEGSQWRYSEFLNAVKKGKVERVRFV  161

Query  485  KDGSALQLTAV  517
            KDGSALQLTAV
Sbjct  162  KDGSALQLTAV  172



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 97/128 (76%), Gaps = 7/128 (5%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNA---TPAAPPTEIQAE  313
            R FL PQ++    N    K +++ A LAALLFSS+ PQA+ALD+     PAA   EI+A+
Sbjct  31   RSFLVPQAILNRKNSSKSKNVANHAALAALLFSSVTPQALALDSTPPPAPAAQVIEIEAQ  90

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
             P P+    SPF+QN++LNAPKPQ+QP SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  91   RPGPS----SPFAQNLILNAPKPQSQPTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  146

Query  494  SALQLTAV  517
              LQLTAV
Sbjct  147  GVLQLTAV  154



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 93/113 (82%), Gaps = 3/113 (3%)
 Frame = +2

Query  182  NPDSFKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQAEAPQPTASNASPFSQN  358
            N DS K ++S+ATLAALLFSS+  Q A+A+DN TP + P  +  EA QPT  N+SPFSQ 
Sbjct  52   NSDSIKSITSQATLAALLFSSLTTQPALAVDNVTPPSQPAPV-LEA-QPTKPNSSPFSQA  109

Query  359  VVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            + L APKPQ+Q A+DLPEGSQWRYSEFLNAVKKGKVERVRFSK+GSALQLTAV
Sbjct  110  LNLTAPKPQSQAATDLPEGSQWRYSEFLNAVKKGKVERVRFSKEGSALQLTAV  162



>gb|KDO85047.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=606

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +2

Query  203  LSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  382
            ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L APKP
Sbjct  71   VTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAPKP  130

Query  383  QAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            Q+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV
Sbjct  131  QSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  174



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +2

Query  203  LSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  382
            ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L APKP
Sbjct  71   VTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAPKP  130

Query  383  QAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            Q+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV
Sbjct  131  QSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  174



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +2

Query  203  LSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  382
            ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L APKP
Sbjct  71   VTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAPKP  130

Query  383  QAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            Q+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV
Sbjct  131  QSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  174



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  319
            R+ FL    L++  N + +K + S+A LAAL+FSSIAPQA+A+D+A+P  PP  I+A+A 
Sbjct  41   RKSFLTRSVLSEKPNFEPYKSIPSQAALAALIFSSIAPQALAVDDASPPPPPPVIEAQAV  100

Query  320  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  499
             P+ S +SPFSQN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA
Sbjct  101  SPSTSTSSPFSQNLLLTAPKPQSQSVSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  160

Query  500  LQLTAV  517
            LQLTA+
Sbjct  161  LQLTAI  166



>gb|KJB57986.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=531

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 3/114 (3%)
 Frame = +2

Query  176  NSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQ  355
            NSN  +F+ L S ATLAAL FSS+ PQA+A+DN+ P  PP  I+A+   P+ SN S FSQ
Sbjct  59   NSN-HTFRALRSHATLAALFFSSVTPQALAVDNSPPTPPPV-IEAQPTNPSPSNQSHFSQ  116

Query  356  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            +++L APKPQ+Q +SDLPEGSQWRY EFLNAVKKGKVERVRFSKDGS LQL+AV
Sbjct  117  DLLLIAPKPQSQ-SSDLPEGSQWRYIEFLNAVKKGKVERVRFSKDGSVLQLSAV  169



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 3/114 (3%)
 Frame = +2

Query  176  NSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQ  355
            NSN  +F+ L S ATLAAL FSS+ PQA+A+DN+ P  PP  I+A+   P+ SN S FSQ
Sbjct  59   NSN-HTFRALRSHATLAALFFSSVTPQALAVDNSPPTPPPV-IEAQPTNPSPSNQSHFSQ  116

Query  356  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            +++L APKPQ+Q +SDLPEGSQWRY EFLNAVKKGKVERVRFSKDGS LQL+AV
Sbjct  117  DLLLIAPKPQSQ-SSDLPEGSQWRYIEFLNAVKKGKVERVRFSKDGSVLQLSAV  169



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 8/132 (6%)
 Frame = +2

Query  137  SRRRFLAPQSLT----KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTE  301
            SRRR+   +S       +S+    K LSS+A LAALLFSS++P+A ALD  AT + PP  
Sbjct  38   SRRRYQITRSALGRKPNSSDAKPMKSLSSQAALAALLFSSVSPRASALDEPATVSPPPMV  97

Query  302  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  481
            ++A+A +P+ + AS F QN+V+ APKPQAQ  SDLP+GSQWRYSEFLNAVKKGKVERVRF
Sbjct  98   VEAQAAKPSPT-ASSFGQNLVMTAPKPQAQ--SDLPDGSQWRYSEFLNAVKKGKVERVRF  154

Query  482  SKDGSALQLTAV  517
            SKDGSALQLTAV
Sbjct  155  SKDGSALQLTAV  166



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  319
            R+  L    L++  N + +K + S+A LAAL+FSSIAPQA+A+D+A+P  PP  I+A+A 
Sbjct  41   RKSVLTQSVLSEKPNSEPYKSIPSQAALAALIFSSIAPQALAVDDASPPPPPPVIEAQAV  100

Query  320  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  499
             P+ S +SPFSQN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA
Sbjct  101  SPSTSTSSPFSQNLLLTAPKPQSQSVSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  160

Query  500  LQLTAV  517
            LQLTA+
Sbjct  161  LQLTAI  166



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 102/127 (80%), Gaps = 5/127 (4%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  316
            SRRRF   +S+  N  P S   L SKA LAA++ SS+APQA+A+DNATP  PP  I+A+ 
Sbjct  36   SRRRFEVTRSIL-NGKPRS--ELPSKAALAAIIASSLAPQALAVDNATPPVPPPVIEAQP  92

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  496
             +P+ SN+SPF+QN++L APKPQ Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS
Sbjct  93   TKPSPSNSSPFAQNLLLTAPKPQTQ--SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  150

Query  497  ALQLTAV  517
            ALQLTAV
Sbjct  151  ALQLTAV  157



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 102/127 (80%), Gaps = 5/127 (4%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  316
            SRRRF   +S+  N  P S   L SKA LAA++ SS+APQA+A+DNATP  PP  I+A+ 
Sbjct  36   SRRRFDVTRSIL-NGKPRS--ELPSKAALAAIIASSLAPQALAVDNATPPVPPPVIEAQP  92

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  496
             +P+ SN+SPF+QN++L APKPQ Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS
Sbjct  93   TKPSPSNSSPFAQNLLLTAPKPQTQ--SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  150

Query  497  ALQLTAV  517
            ALQLTAV
Sbjct  151  ALQLTAV  157



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 93/129 (72%), Gaps = 5/129 (4%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIA---PQAIALDNATPAAPPTEIQA  310
            R  F       +  N +  K  +S+ATLAALLFSS+    PQA+ALD      PP  +QA
Sbjct  44   RNLFTTKNIFNQKPNSEPVKSAASQATLAALLFSSVTSLTPQALALDATPTPTPPPVLQA  103

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
            +  +P AS  SPFSQN+++ APKPQ+Q A+DLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  104  QPTKPNAS--SPFSQNLLVTAPKPQSQVATDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  161

Query  491  GSALQLTAV  517
            GS LQLTAV
Sbjct  162  GSGLQLTAV  170



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 93/129 (72%), Gaps = 5/129 (4%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIA---PQAIALDNATPAAPPTEIQA  310
            R  F       +  N +  K  +S+ATLAALLFSS+    PQA+ALD      PP  +QA
Sbjct  44   RNLFTTKNIFNQKPNSEPLKSATSQATLAALLFSSVTSLTPQALALDATPTPTPPPVLQA  103

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
            +  +P AS  SPFSQN+++ APKPQ+Q A+DLPEGSQWRYS+FLNAVKKGKVERVRFSKD
Sbjct  104  QPTKPNAS--SPFSQNLLVTAPKPQSQAATDLPEGSQWRYSDFLNAVKKGKVERVRFSKD  161

Query  491  GSALQLTAV  517
            GS LQLTAV
Sbjct  162  GSGLQLTAV  170



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 96/129 (74%), Gaps = 5/129 (4%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNP--DSFKGLSSKATLAALLF-SSIAPQAIALDNATPAAPPTEIQA  310
            RR+  A +S+  N  P  +  K   SKA+LAALLF SSI PQA A D      PP  IQA
Sbjct  38   RRKLRATRSVLNNDVPNFERLKSAQSKASLAALLFASSIVPQAQAADAPNLPTPPPVIQA  97

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  490
            +  +P+ S++SPF+QN++L APKP A  +SDLPEGSQWRYSEFL+AVKKGKVERVRFSKD
Sbjct  98   QPTKPSPSDSSPFAQNLLLTAPKPSA--SSDLPEGSQWRYSEFLSAVKKGKVERVRFSKD  155

Query  491  GSALQLTAV  517
            GSALQLTAV
Sbjct  156  GSALQLTAV  164



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 96/128 (75%), Gaps = 9/128 (7%)
 Frame = +2

Query  149  FLAP---QSLTKNSNPDSFKGLSSKATLA-ALLFSSIAPQAIALDNATPAAPPTE-IQAE  313
            FL P   Q +    N +S K L S+AT+A AL+FSS+ PQA+A+DN TP   P   I+A+
Sbjct  32   FLLPKKFQKIVNEKNYESLKSLQSQATIATALIFSSLTPQALAIDNPTPPPTPPPVIEAQ  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
              +P+++ A    QN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   PTRPSSTVA----QNLLLTAPKPQSQSTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  147

Query  494  SALQLTAV  517
            SALQLTAV
Sbjct  148  SALQLTAV  155



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 94/128 (73%), Gaps = 9/128 (7%)
 Frame = +2

Query  149  FLAPQSLTKNSNP---DSFKGLSSKATLAA-LLFSSIAPQAIALDNATPAAPPTE-IQAE  313
            FL  ++L K  N     SFK L S+AT+AA LLFSS+ PQA+ALDN      P   I+A 
Sbjct  33   FLLSKNLLKIVNKKKSGSFKSLQSQATIAAALLFSSLTPQALALDNPALPPTPPPVIEAL  92

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
              +P+    SPF+QN+++ APKPQ++  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  93   PTKPS----SPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  148

Query  494  SALQLTAV  517
            S LQL+AV
Sbjct  149  STLQLSAV  156



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 95/128 (74%), Gaps = 9/128 (7%)
 Frame = +2

Query  149  FLAPQSLTKNSNP---DSFKGLSSKATLAA-LLFSSIAPQAIALDNATPAAPPTE-IQAE  313
            FL  ++L K  N     SFK L S+AT+AA LLFSS+ PQA+A+DN  P   P   I+A 
Sbjct  33   FLLSKNLLKIVNKKKSGSFKSLQSQATIAAALLFSSLTPQALAIDNPAPPPTPPPVIEAL  92

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
              +P+    SPF+QN+++ APKPQ++  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  93   PTKPS----SPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  148

Query  494  SALQLTAV  517
            S LQL+AV
Sbjct  149  STLQLSAV  156



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 94/128 (73%), Gaps = 9/128 (7%)
 Frame = +2

Query  149  FLAP---QSLTKNSNPDSFKGLSSKATLA-ALLFSSIAPQAIALDNATPAAPPTE-IQAE  313
            FL P   Q +    N +S K L S+AT+A AL+FSS+ PQA+A+DN TP   P   I+A+
Sbjct  32   FLLPKNFQKIVNEKNHESLKSLQSQATIATALIFSSLTPQALAIDNPTPPPTPPPVIEAQ  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
              +P+    S  +QN++L APKPQ+Q  SDLPEGS WRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   PTRPS----STLAQNLLLTAPKPQSQSTSDLPEGSXWRYSEFLNAVKKGKVERVRFSKDG  147

Query  494  SALQLTAV  517
            SALQLTAV
Sbjct  148  SALQLTAV  155



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 91/128 (71%), Gaps = 5/128 (4%)
 Frame = +2

Query  143  RRFLA-PQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATP--AAPPTEIQAE  313
            +RF A P+SL  + N +  +   ++A LAA +FSSI PQA ALDN  P  +  P  I+ E
Sbjct  31   KRFAAVPKSLLNHKNSNKSQNAINRAALAAFIFSSITPQAFALDNNIPPPSPAPQVIEIE  90

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
            A +      SP +QN+ LNAP PQAQPA D+P+G+QWRYSEFLNAVKKGKVERVRF+K+G
Sbjct  91   AQKSPLQ--SPVAQNLTLNAPNPQAQPAPDIPDGTQWRYSEFLNAVKKGKVERVRFNKEG  148

Query  494  SALQLTAV  517
              LQLTAV
Sbjct  149  GILQLTAV  156



>gb|EYU36826.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=656

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 91/128 (71%), Gaps = 5/128 (4%)
 Frame = +2

Query  143  RRFLA-PQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATP--AAPPTEIQAE  313
            +RF A P+SL  + N +  +   ++A LAA +FSSI PQA ALDN  P  +  P  I+ E
Sbjct  31   KRFAAVPKSLLNHKNSNKSQNAINRAALAAFIFSSITPQAFALDNNIPPPSPAPQVIEIE  90

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
            A +      SP +QN+ LNAP PQAQPA D+P+G+QWRYSEFLNAVKKGKVERVRF+K+G
Sbjct  91   AQKSPLQ--SPVAQNLTLNAPNPQAQPAPDIPDGTQWRYSEFLNAVKKGKVERVRFNKEG  148

Query  494  SALQLTAV  517
              LQLTAV
Sbjct  149  GILQLTAV  156



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 97/133 (73%), Gaps = 8/133 (6%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSF---KGLSSKATLAALLFSSIAPQAIALDNATPAAPPTE--  301
            S R+FL  +++  +  PDS      + +KATLA LLFSS+APQA+ALD   P    T   
Sbjct  31   STRKFLIARNVL-DKKPDSKPSKNSIQTKATLATLLFSSLAPQALALDAPNPPPQTTTPP  89

Query  302  -IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  478
             +QA  P  + S++SPF QN++L APKP+++  SDLPEGSQWRYSEFL+AVKKGKVERVR
Sbjct  90   VLQAR-PSQSESSSSPFGQNLLLTAPKPESRNVSDLPEGSQWRYSEFLSAVKKGKVERVR  148

Query  479  FSKDGSALQLTAV  517
            FSKDGS LQLTAV
Sbjct  149  FSKDGSGLQLTAV  161



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 92/128 (72%), Gaps = 16/128 (13%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  313
            SRRR+ + + +         K L S+A LAALLFSS +PQA+A++    P AP   ++A+
Sbjct  40   SRRRYQSEKLM---------KSLPSQAALAALLFSSTSPQALAVNEPVQPPAPTVTVEAQ  90

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
            +P     N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  91   SP-----NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  144

Query  494  SALQLTAV  517
            S LQLTAV
Sbjct  145  SVLQLTAV  152



>dbj|BAH56755.1| AT5G42270 [Arabidopsis thaliana]
Length=574

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 90/128 (70%), Gaps = 13/128 (10%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-EIQAE  313
            SR+R+   QS          K L S+A LAALLFSS +PQA+A++   P  PP   I AE
Sbjct  40   SRKRYQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNE--PVQPPAPTITAE  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
            A  P   N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  92   AQSP---NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  147

Query  494  SALQLTAV  517
            S LQLTAV
Sbjct  148  SVLQLTAV  155



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 90/128 (70%), Gaps = 13/128 (10%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-EIQAE  313
            SR+R+   QS          K L S+A LAALLFSS +PQA+A++   P  PP   I AE
Sbjct  40   SRKRYQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNE--PVQPPAPTITAE  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
            A  P   N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  92   AQSP---NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  147

Query  494  SALQLTAV  517
            S LQLTAV
Sbjct  148  SVLQLTAV  155



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 87/128 (68%), Gaps = 9/128 (7%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  313
            SRRR    QS          K L S+A LAALLFSS +PQA+A++    P AP   I  E
Sbjct  40   SRRRCQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNEPVQPLAPAPTITVE  93

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
            A Q T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  94   A-QATNPNLS-FGQNVMMTAPNPQQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  151

Query  494  SALQLTAV  517
            S LQLTAV
Sbjct  152  SVLQLTAV  159



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 78/102 (76%), Gaps = 2/102 (2%)
 Frame = +2

Query  215  ATLAALLFSSI-APQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQ  391
            A ++AL+ SS+  P A+A DN  P  P  E Q     P A++ SPFSQN+ L APKPQ+Q
Sbjct  57   AAVSALILSSMFTPAALAADNLPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPKPQSQ  115

Query  392  PASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
             ++DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAV
Sbjct  116  SSTDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAV  157



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 89/132 (67%), Gaps = 16/132 (12%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-----ATPAAPPTE  301
            SRRR    QS          K L S+A LAALLFSS +PQA+A++      A   AP   
Sbjct  40   SRRRCQISQS------EKLMKSLPSQAALAALLFSSASPQALAVNEPVQPQAPVPAPTMT  93

Query  302  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  481
            ++A+A  P  S    F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+F
Sbjct  94   VEAQATSPNLS----FGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKF  148

Query  482  SKDGSALQLTAV  517
            SKDGS LQLTAV
Sbjct  149  SKDGSVLQLTAV  160



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 78/102 (76%), Gaps = 2/102 (2%)
 Frame = +2

Query  215  ATLAALLFSSI-APQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQ  391
            A ++AL+ SS+  P A+A DN  P  P  E Q     P A++ SPFSQN+ L APKPQ+Q
Sbjct  57   AAVSALILSSMFTPAALAADNLPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPKPQSQ  115

Query  392  PASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
             ++DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAV
Sbjct  116  SSTDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAV  157



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 90/122 (74%), Gaps = 5/122 (4%)
 Frame = +2

Query  167  LTKNSNPDS-FKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTA  331
            +T++S  D   K L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+ 
Sbjct  32   ITRSSLDDKPIKSLPSRAALAAILFSSSISSQSPKALALDEPLTPTQPIVIEAQSLSPSP  91

Query  332  SNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT  511
            S+ SPF+QN V+ AP P+AQ +SDLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLT
Sbjct  92   SSLSPFAQNQVITAPNPKAQSSSDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLT  151

Query  512  AV  517
            AV
Sbjct  152  AV  153



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 88/130 (68%), Gaps = 13/130 (10%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNAT--PA-APPTEIQ  307
            SRRR+   QS          K L S+A LAA+LFSS + QA+A++     PA AP   ++
Sbjct  40   SRRRYQISQS------EKLMKSLPSQAALAAVLFSSSSLQALAVNEPVQPPAPAPTIAVE  93

Query  308  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSK  487
            A+A  P  S    F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVKKGKVERV+FSK
Sbjct  94   AQATNPNLS----FGQNVLMTAPNPQQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSK  149

Query  488  DGSALQLTAV  517
            DGS LQLTAV
Sbjct  150  DGSVLQLTAV  159



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 94/127 (74%), Gaps = 13/127 (10%)
 Frame = +2

Query  149  FLAPQSLTKNSNPDSFKGLSSKATLAALLFSS----IAPQAIALDNATPAAPPTEIQAEA  316
            FL  +S+ K  N +  K  SS+A LAAL+ SS    + P+A+A DN TP  PP  I+A+ 
Sbjct  30   FLFKRSILKAQNSEQVKSASSRAALAALIVSSASLSVTPEALAADNLTP--PPV-IEAQQ  86

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  496
             QP+    SPFSQN++L APKPQ+  +SDLPEG+ WRYS+FLNAVKKGKVERVRFSKDGS
Sbjct  87   SQPS----SPFSQNLLLTAPKPQS--SSDLPEGTNWRYSDFLNAVKKGKVERVRFSKDGS  140

Query  497  ALQLTAV  517
            ALQLTAV
Sbjct  141  ALQLTAV  147



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 5/119 (4%)
 Frame = +2

Query  173  KNSNPDSFKGLSSKATLAALLFSSIAPQ---AIALDNATPAAPPTEIQAEAPQPTASNAS  343
            +  N    K L S+  LAA+LFSSI+     A+ALD    A     ++A+A +P+ S  S
Sbjct  55   EEDNGKPIKSLPSRVALAAILFSSISSSPRGALALDEPIAATQTVVVEAQAVKPSTS-PS  113

Query  344  PFSQNVVLNAPKPQAQPAS-DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            PFS+   + AP P+AQ +S DLPEG+QWRYSEFLNAVKKGKVERVRFSKDGS LQLTAV
Sbjct  114  PFSETQTITAPNPKAQSSSSDLPEGTQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAV  172



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 81/108 (75%), Gaps = 7/108 (6%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASP-FSQNVVLNA  373
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+  Q    + SP F QN +L A
Sbjct  69   LSSKIALAAILFSSISSSPRALALVD-EPPSPSVVVEAQVQQAVKPSTSPLFIQNEILKA  127

Query  374  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            P P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAV
Sbjct  128  PSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAV  172



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 81/108 (75%), Gaps = 7/108 (6%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASP-FSQNVVLNA  373
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+  Q    + SP F QN +L A
Sbjct  69   LSSKIALAAILFSSISSSPRALALVD-EPPSPSVVVEAQVQQAVKPSTSPLFIQNEILKA  127

Query  374  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            P P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAV
Sbjct  128  PSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAV  172



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 94/128 (73%), Gaps = 17/128 (13%)
 Frame = +2

Query  170  TKNSNPDSF-------KGLSSKATLAALLFSS----IAPQAIALDNATPAAPPTEIQAEA  316
            TK+S P  F          +S+A LAAL+FSS    + PQA+A DN TP  PP  I+A+ 
Sbjct  23   TKSSTPLQFLFKRSILNAHNSQAALAALIFSSASLSVTPQALAADNVTP--PPV-IEAQQ  79

Query  317  PQ-PTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  493
             Q   ++++SPFSQN++L APKPQA  +SDLPEG+ WRYSEFLNAVKKGKVERVRFSKDG
Sbjct  80   SQLNPSNSSSPFSQNLLLTAPKPQA--SSDLPEGTNWRYSEFLNAVKKGKVERVRFSKDG  137

Query  494  SALQLTAV  517
            SALQLTA+
Sbjct  138  SALQLTAI  145



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +2

Query  215  ATLAALLFSSI-APQAIALDNATPAAPPTEIQAEAPQPTASNA-SPFSQNVVLNAPKPQA  388
            A ++AL+ SS+  P A+A DN  P  PP  ++A+  Q   +N+ SPFSQN+ L APKPQA
Sbjct  57   AAVSALILSSMFTPAALAADNLPPPPPPV-LEAQPNQLNPANSTSPFSQNISLTAPKPQA  115

Query  389  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            Q ++DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAV
Sbjct  116  QSSTDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAV  158



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 93/133 (70%), Gaps = 10/133 (8%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKG--LSSKATLAALLFSSIA---PQAIALDNATPAAPPTE  301
            SR ++   +S   N++P+       SS+  LAA+LFSSI+   P+A+A+ +  PA+P   
Sbjct  41   SRAKYQITRSSLDNNSPNGKPNSPFSSQVALAAILFSSISSSPPRALAVVD-EPASPSVV  99

Query  302  IQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  478
            ++A+A     S +SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKKGKVERVR
Sbjct  100  VEAQAQAVKPSTSSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVR  156

Query  479  FSKDGSALQLTAV  517
            FSKDGS LQLTAV
Sbjct  157  FSKDGSVLQLTAV  169



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 82/108 (76%), Gaps = 8/108 (7%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA--PQAIALDNATPA-APPTEIQAEAPQPTASNASPFSQNVVLNA  373
            LSSK  LAA+LFSSI+  P+A+AL +  P+ +   E QA+A +P+ S    F QN +L A
Sbjct  69   LSSKVALAAILFSSISSSPRALALVDEPPSPSLVVEAQAQAVKPSTS--PLFIQNEILKA  126

Query  374  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            P P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAV
Sbjct  127  PSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAV  171



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 88/131 (67%), Gaps = 10/131 (8%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSI--APQAIALDNATPAAPPTE--I  304
            SR++F+  QS   + N    K  S+ A   AL+ SS   + QA+A+DN  P        I
Sbjct  32   SRKKFVITQSFPNSQN---LKFPSNSALTTALILSSTLGSQQALAVDNLPPPQSQPPQVI  88

Query  305  QAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFS  484
            +A+   P   N+SPFSQN++LNAPKP + P  DLPEG+QWRYSEFL AVKKGKVERVRFS
Sbjct  89   EAQPNNPNLPNSSPFSQNLILNAPKP-SNP--DLPEGAQWRYSEFLTAVKKGKVERVRFS  145

Query  485  KDGSALQLTAV  517
            KDGS LQLTA+
Sbjct  146  KDGSVLQLTAI  156



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +2

Query  167  LTKNSNPDS-FKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTA  331
            +T++S  D   K L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+ 
Sbjct  32   ITRSSVDDKPLKSLPSRAALAAILFSSSISSQSPKALALDQPLTPTQPIVIEAQSLSPSP  91

Query  332  SNASPFSQNVVLNAPKPQAQPAS-DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQL  508
            S+ SPF+Q+ V+ AP P+AQ +S DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQL
Sbjct  92   SSLSPFAQSQVITAPNPKAQSSSSDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQL  151

Query  509  TAV  517
            TAV
Sbjct  152  TAV  154



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 74/103 (72%), Gaps = 10/103 (10%)
 Frame = +2

Query  209  SKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQA  388
            S ATL+A       P A+A DN TP  P  E Q     P+ S +SPFS N+ L APKPQA
Sbjct  68   SSATLSA------TPHALAADNVTPP-PVIEAQQSQLNPSNSTSSPFSTNL-LTAPKPQA  119

Query  389  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
              +SDLPEG+ WRYSEFLNAVKKGKVERVRFSKDGSALQLTAV
Sbjct  120  --SSDLPEGTNWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  160



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
            L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+ S+ SPF+Q+  + 
Sbjct  17   LPSRAALAAILFSSSISSQSPKALALDQPLTPTQPIVIEAQSLSPSPSSLSPFAQSQSIT  76

Query  371  APKPQAQPAS-DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            AP P+AQ +S DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAV
Sbjct  77   APNPKAQSSSSDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAV  126



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 8/89 (9%)
 Frame = +2

Query  251  PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRY  430
            PQA+A+D   P AP   ++A+A  P+A     F Q V++ AP PQ Q +SDLP+G+QWRY
Sbjct  76   PQALAIDE--PPAPVITVEAQAVNPSA-----FGQKVLMTAPNPQGQ-SSDLPDGTQWRY  127

Query  431  SEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            SEFLNAVKKGKVERV+FSKDGS LQLTAV
Sbjct  128  SEFLNAVKKGKVERVKFSKDGSVLQLTAV  156



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 10/109 (9%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
             SSK  LAA+LFSS++    P+A+A+ +  P +P   ++A+A +P+ S    F QN +L 
Sbjct  65   FSSKVALAAILFSSMSSSSPPRALAVVD-EPPSPSVVVEAQAVKPSTSPL--FIQNEILK  121

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            AP P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAV
Sbjct  122  APSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAV  167



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  319
            + RF   Q    ++N +  K  +  A + + +  +I P A+A DN TP  PP        
Sbjct  41   KTRFSNSQKSINDNNSEPLKSAAVSALILSSMTLNITPVALAADNITPPPPPVLEAQPNK  100

Query  320  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  499
               ++++SPFSQN+ L APKPQ+  +SDLP+G+QWRYSEFLNAVKKGKVERVRFSKDGS 
Sbjct  101  LNPSNSSSPFSQNISLTAPKPQS--SSDLPDGNQWRYSEFLNAVKKGKVERVRFSKDGSV  158

Query  500  LQLTAV  517
            LQLTAV
Sbjct  159  LQLTAV  164



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = +2

Query  203  LSSKATLAALLFSSIAPQAIA--LDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  376
            L S+A LA LLFSS    AIA     A P AP   I  EA Q    +A+ F QNV+  AP
Sbjct  54   LPSQAALATLLFSS-PSLAIAEPYTVAQPPAPTDTITVEA-QAITPSATAFGQNVLQTAP  111

Query  377  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
             PQAQ + D+P+G+QWRYSEFLN+VKKGKVERV+FSKDGS LQLTAV
Sbjct  112  NPQAQ-SPDIPDGTQWRYSEFLNSVKKGKVERVKFSKDGSVLQLTAV  157



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +2

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  496
            PQ T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDGS
Sbjct  96   PQATNPNLS-FGQNVLMTAPNPQQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDGS  154

Query  497  ALQLTAV  517
             LQLTAV
Sbjct  155  VLQLTAV  161



>gb|AFW75732.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=378

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 5/73 (7%)
 Frame = +2

Query  299  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  478
            E+QAEAP PT +   PFS ++ L APKP A  ASDLPEG+QWRYSEFL+AVK+GKVERVR
Sbjct  69   ELQAEAPTPTVN---PFSSSL-LTAPKPSAA-ASDLPEGAQWRYSEFLSAVKRGKVERVR  123

Query  479  FSKDGSALQLTAV  517
            FSKDG  LQLTAV
Sbjct  124  FSKDGGLLQLTAV  136



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 76/109 (70%), Gaps = 9/109 (8%)
 Frame = +2

Query  206  SSKATLAALLFSSIAPQ-----AIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
            S  A +A+ L S++A Q     A+A  + +P      +Q E+    ++ +SPFSQ++ L 
Sbjct  70   SVNAAVASFLLSTLAQQQPLSPALAD-DLSPPPDSPPVQLESATKPSAPSSPFSQSL-LT  127

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            APKPQ  P  DLPEGSQWRYSEFLNAVKKGKVERVRFSKDG ALQLTAV
Sbjct  128  APKPQTSP--DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGGALQLTAV  174



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 6/80 (8%)
 Frame = +2

Query  281  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKK  457
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKK
Sbjct  91   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKK  145

Query  458  GKVERVRFSKDGSALQLTAV  517
            GKVERVRFSKDGS +QLTAV
Sbjct  146  GKVERVRFSKDGSVVQLTAV  165



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 6/80 (8%)
 Frame = +2

Query  281  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKK  457
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKK
Sbjct  91   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKK  145

Query  458  GKVERVRFSKDGSALQLTAV  517
            GKVERVRFSKDGS +QLTAV
Sbjct  146  GKVERVRFSKDGSVVQLTAV  165



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 5/82 (6%)
 Frame = +2

Query  275  ATPAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAV  451
            A P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AV
Sbjct  57   APPPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAV  112

Query  452  KKGKVERVRFSKDGSALQLTAV  517
            KKGKVERVRFSKDG  LQLTA+
Sbjct  113  KKGKVERVRFSKDGGLLQLTAI  134



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 5/73 (7%)
 Frame = +2

Query  299  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  478
            E+QAEAP PT +   PFS ++ L APKP A  ASDLPEG+QWRYSEFL+AVK+GKVERVR
Sbjct  69   ELQAEAPTPTVN---PFSSSL-LTAPKPSA-AASDLPEGAQWRYSEFLSAVKRGKVERVR  123

Query  479  FSKDGSALQLTAV  517
            FSKDG  LQLTAV
Sbjct  124  FSKDGGLLQLTAV  136



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 5/82 (6%)
 Frame = +2

Query  275  ATPAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAV  451
            A P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AV
Sbjct  57   APPPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAV  112

Query  452  KKGKVERVRFSKDGSALQLTAV  517
            KKGKVERVRFSKDG  LQLTA+
Sbjct  113  KKGKVERVRFSKDGGLLQLTAI  134



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 5/82 (6%)
 Frame = +2

Query  275  ATPAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAV  451
            A P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AV
Sbjct  57   APPPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAV  112

Query  452  KKGKVERVRFSKDGSALQLTAV  517
            KKGKVERVRFSKDG  LQLTA+
Sbjct  113  KKGKVERVRFSKDGGLLQLTAI  134



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 2/57 (4%)
 Frame = +2

Query  347  FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
             +QN VL APKPQA P  D+PEGSQWRYSEFLNAVKKGKVERVRFSKDG  LQLTAV
Sbjct  95   LTQNNVLTAPKPQANP--DIPEGSQWRYSEFLNAVKKGKVERVRFSKDGGVLQLTAV  149



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 74/110 (67%), Gaps = 11/110 (10%)
 Frame = +2

Query  206  SSKATLAALLFSSIAPQ-----AIALDNATP-AAPPTEIQAEAPQPTASNASPFSQNVVL  367
            S  A +A+ L S++A Q     A+A D + P A+PP ++++       S+        +L
Sbjct  69   SVNAAVASFLLSTLAHQQPLAPALAEDLSPPPASPPIQMESATKPSPPSSPF---SQSLL  125

Query  368  NAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
             APKPQ+ P  DLPEGSQWRYSEFLNAVKKGKVERVRFSKDG ALQLTAV
Sbjct  126  TAPKPQSSP--DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGGALQLTAV  173



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 60/73 (82%), Gaps = 6/73 (8%)
 Frame = +2

Query  299  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  478
            E+QAEA  PTA+   PF+ N +L APKP A  A+DLPEG+QWRYSEFL+AVK+GKVERVR
Sbjct  67   ELQAEATTPTAN---PFA-NSLLTAPKPSA--AADLPEGAQWRYSEFLSAVKRGKVERVR  120

Query  479  FSKDGSALQLTAV  517
            FSKDG  LQLTAV
Sbjct  121  FSKDGGLLQLTAV  133



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 77/118 (65%), Gaps = 10/118 (8%)
 Frame = +2

Query  173  KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE---APQPTASNAS  343
            KNSN +      S A  AA L SS+ P AIA D A    P +    +   A +P     +
Sbjct  46   KNSNDNRLTLSPSVAAAAAFLLSSLPPVAIAEDVAPVPPPTSPPAVQFDAASKPD----N  101

Query  344  PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            PF+Q++ L AP+PQ   +SDLPEGSQWRYSEFL+AVKKGKVERVRFSKDG  LQLTAV
Sbjct  102  PFAQSL-LTAPRPQT--SSDLPEGSQWRYSEFLDAVKKGKVERVRFSKDGGVLQLTAV  156



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 2/60 (3%)
 Frame = +2

Query  338  ASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            ASPF+ N +L+APKPQ+  + D+P+GSQWRYSEFLNAVKKGKVERVRFSKDG  LQLTAV
Sbjct  107  ASPFA-NSLLSAPKPQSS-SPDIPDGSQWRYSEFLNAVKKGKVERVRFSKDGGVLQLTAV  164



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 57/70 (81%), Gaps = 4/70 (6%)
 Frame = +2

Query  308  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSK  487
            A  P P AS ++PFSQ++ L AP+PQA P  DL +GSQWRYSEFLNAVK+GKVERVRFSK
Sbjct  100  ASKPAPPAS-SNPFSQSL-LTAPRPQASP--DLLDGSQWRYSEFLNAVKRGKVERVRFSK  155

Query  488  DGSALQLTAV  517
            DG  LQLTA+
Sbjct  156  DGGLLQLTAI  165



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 6/75 (8%)
 Frame = +2

Query  281  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKK  457
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKK
Sbjct  22   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKK  76

Query  458  GKVERVRFSKDGSAL  502
            GKVERVRFSKDGS  
Sbjct  77   GKVERVRFSKDGSVC  91



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 54/70 (77%), Gaps = 8/70 (11%)
 Frame = +2

Query  308  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSK  487
            AEAP P A+   PF+ + +L AP    QP+SD+P+G QWRYSEFL AVKKGKVERVRFSK
Sbjct  68   AEAPTPAAN---PFA-DTLLTAP----QPSSDIPDGGQWRYSEFLGAVKKGKVERVRFSK  119

Query  488  DGSALQLTAV  517
            DG  LQLTAV
Sbjct  120  DGGVLQLTAV  129



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +2

Query  320  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  499
            + T +  SPFS   ++ AP  +A+   DLPEG+QWRYSEFLNAVK GKVERVRFS+DGS 
Sbjct  17   EQTPAAGSPFS---LMEAPPVEARKKLDLPEGNQWRYSEFLNAVKGGKVERVRFSRDGSV  73

Query  500  LQLTAV  517
            LQLTAV
Sbjct  74   LQLTAV  79



>gb|KIZ07525.1| cell division protease FtsH [Monoraphidium neglectum]
Length=129

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            AP  +   AS LPEG+QWRYSEF+NAV+ GKVERVRFSKDGS LQLTA+
Sbjct  44   APALRDDAASGLPEGNQWRYSEFINAVQGGKVERVRFSKDGSMLQLTAI  92



>ref|XP_003057154.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58799.1| predicted protein [Micromonas pusilla CCMP1545]
Length=731

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = +2

Query  206  SSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP-----QPTASNASPFSQNVVLN  370
            ++ A+  A L +S A   +A+  A   APP    AEAP     Q   S  S FS      
Sbjct  57   TTAASFMAFLAASGATSLVAM--ADDFAPPA--TAEAPTSALAQFQQSAKSAFSDADSQT  112

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            AP       + LPEG+ WRYSEF+NAV+KGKVERVRF+KDGS+LQLTAV
Sbjct  113  APSTAVADPNALPEGNTWRYSEFINAVQKGKVERVRFAKDGSSLQLTAV  161



>ref|XP_001753657.1| predicted protein [Physcomitrella patens]
 gb|EDQ81409.1| predicted protein [Physcomitrella patens]
Length=647

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  398  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            SDLPEG+ WRYSEFLNAVK GKVERVRF+KDG+ LQLTA+
Sbjct  59   SDLPEGTNWRYSEFLNAVKGGKVERVRFAKDGTTLQLTAI  98



>ref|XP_001760664.1| predicted protein [Physcomitrella patens]
 gb|EDQ74403.1| predicted protein [Physcomitrella patens]
Length=634

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  398  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            SDLPEG+ WRYSEFLNAVK GKVERVRF+KDG+ LQLTAV
Sbjct  46   SDLPEGANWRYSEFLNAVKAGKVERVRFAKDGTTLQLTAV  85



>gb|KIZ03250.1| cell division protease FtsH [Monoraphidium neglectum]
Length=732

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 64/108 (59%), Gaps = 8/108 (7%)
 Frame = +2

Query  206  SSKATLAALLFSSIAPQAIALDNATP--AAPPTEIQAE--APQPTASNASPFSQNVVLNA  373
            ++ A L A L ++    A+A D   P   A  T   AE  APQ  A   +   Q     A
Sbjct  63   TAMAGLVAFLMAATPNAAVAADTFAPPEGATTTTTFAERPAPQSLALGGASAGQQ----A  118

Query  374  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            P  + +  + LPEG+QWRYSEF+NAV+ GKVERVRFSKDG+ LQLTA+
Sbjct  119  PALRDEATAGLPEGNQWRYSEFINAVQSGKVERVRFSKDGTMLQLTAI  166



>emb|CEF99105.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=572

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 62/105 (59%), Gaps = 8/105 (8%)
 Frame = +2

Query  209  SKATLAALLFS--SIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  382
            + +T+AA L +  ++A    A  +  PA  PT  QA A Q   SN+   SQ+       P
Sbjct  32   ADSTVAATLMAVATLASAGAAKADFAPAPEPT--QAVAEQRGESNSIFASQS----QEAP  85

Query  383  QAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
                A  LPEG  WRYSEF+ AV  GKVERVRFSKDGSALQLTAV
Sbjct  86   AVTNADGLPEGINWRYSEFIRAVTSGKVERVRFSKDGSALQLTAV  130



>ref|XP_005843263.1| hypothetical protein CHLNCDRAFT_141387 [Chlorella variabilis]
 gb|EFN51161.1| hypothetical protein CHLNCDRAFT_141387 [Chlorella variabilis]
Length=259

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  404  LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            LPEG+QWRYSEF+NAV+ GKVERVRFSKDG+ LQLTAV
Sbjct  82   LPEGTQWRYSEFINAVQSGKVERVRFSKDGTQLQLTAV  119



>ref|XP_001690889.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP05335.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
Length=727

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  SQNVVLNAP--KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            S N   +AP   P+ +    LPEG+QWRYSEF+NAV+ GKVERVRFSKDGS LQLTAV
Sbjct  105  SMNFASSAPLAAPEVRSEYTLPEGNQWRYSEFVNAVEAGKVERVRFSKDGSQLQLTAV  162



>ref|XP_003081278.1| FTSH_MEDSA Cell division protein ftsH homolog, chloroplast precursor 
(ISS) [Ostreococcus tauri]
Length=662

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = +2

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPA----SDLPEGSQWRYSEFLNAVKKGKVERVRF  481
            AP+PT + A    ++  + A + Q  PA      LPEG  WRYSEF+ AV  GKVERVRF
Sbjct  19   APEPTQAVAEQRGESNSIFASQSQEAPAVTNADGLPEGINWRYSEFIRAVTSGKVERVRF  78

Query  482  SKDGSALQLTAV  517
            SKDGSALQLTAV
Sbjct  79   SKDGSALQLTAV  90



>ref|XP_007510744.1| cell division protein FtsH2 [Bathycoccus prasinos]
 emb|CCO18277.1| cell division protein FtsH2 [Bathycoccus prasinos]
Length=719

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 59/104 (57%), Gaps = 12/104 (12%)
 Frame = +2

Query  215  ATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQP  394
            ATL A      A  A A+D   PA P  E Q  A Q T +  S       L+AP      
Sbjct  55   ATLTAFATLQNAQMASAID--FPAMPAVEQQQSAEQTTEAFPS-------LSAPSTTVAS  105

Query  395  ASD---LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
             +D   LPEG+ WRYSEF+ AV  GKVERVRF+KDGS+LQLTAV
Sbjct  106  TTDASGLPEGATWRYSEFIKAVLGGKVERVRFAKDGSSLQLTAV  149



>ref|XP_002948337.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
 gb|EFJ50744.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
Length=722

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 51/79 (65%), Gaps = 7/79 (9%)
 Frame = +2

Query  287  APPTEIQAEAPQPTASNASPFSQNVVLNAP--KPQAQPASDLPEGSQWRYSEFLNAVKKG  460
            APP E        T  N +P S     +AP   P+ +    LPEG+QWRYS+F+NAV+ G
Sbjct  85   APPPETNT-----TTINQAPQSVQFGASAPLTAPEVRSEYQLPEGNQWRYSDFVNAVEAG  139

Query  461  KVERVRFSKDGSALQLTAV  517
            KVERVRFSKDGS LQLTAV
Sbjct  140  KVERVRFSKDGSQLQLTAV  158



>ref|XP_001419590.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97883.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=651

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  395  ASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            A  LPEG+ WRYSEF+ AV  GKVERVRFSKDGSALQLTAV
Sbjct  46   ADGLPEGNNWRYSEFIKAVMSGKVERVRFSKDGSALQLTAV  86



>ref|XP_011396167.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23297.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
Length=726

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  404  LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            LPEG+QWRYS+F+NAV+ GK+ERVRFSKDG+ LQLTA+
Sbjct  120  LPEGTQWRYSDFINAVESGKIERVRFSKDGTQLQLTAI  157



>ref|XP_005650371.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
 gb|EIE25827.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
Length=736

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  404  LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            LPEG+QWRYSEF+NAV+ GKVERVRFSK+G  LQLTAV
Sbjct  131  LPEGNQWRYSEFINAVQNGKVERVRFSKEGGQLQLTAV  168



>ref|XP_002505995.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
 gb|ACO67253.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
Length=718

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  365  LNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
            L AP  +    + LPEG+ WRYSEF+ AV  GKVERVRF+KDG++LQLTAV
Sbjct  102  LTAPDTKVVDPNALPEGNTWRYSEFIRAVMGGKVERVRFAKDGTSLQLTAV  152



>gb|AFW63099.1| hypothetical protein ZEAMMB73_047704 [Zea mays]
Length=321

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 11/92 (12%)
 Frame = +2

Query  257  AIALDNA--TPA---APPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQ  421
            A+A D +  TPA    P  ++Q EAP PTA+   PFS N +L A KP A  A DLPEG+ 
Sbjct  88   ALATDTSATTPAPLSVPAPKLQIEAPAPTAN---PFS-NSLLTALKPSAS-AYDLPEGAD  142

Query  422  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  517
             R+  F + +K+GK E VRFSKDG  LQL AV
Sbjct  143  NRHIVFPSVIKRGK-EPVRFSKDGGLLQLAAV  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000