BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005M03

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB51998.1|  hypothetical protein B456_008G258800                    208   9e-65   Gossypium raimondii
gb|KJB51996.1|  hypothetical protein B456_008G258800                    208   2e-64   Gossypium raimondii
gb|KHG13856.1|  Mediator of RNA polymerase II transcription subun...    208   2e-64   Gossypium arboreum [tree cotton]
ref|XP_006439221.1|  hypothetical protein CICLE_v10022441mg             204   7e-63   Citrus clementina [clementine]
ref|XP_009358713.1|  PREDICTED: mediator of RNA polymerase II tra...    204   7e-63   Pyrus x bretschneideri [bai li]
ref|XP_007039392.1|  Mediator complex, subunit Med10 isoform 4          203   7e-63   
ref|XP_007039391.1|  Mediator complex, subunit Med10 isoform 3          203   9e-63   
ref|XP_007039389.1|  Mediator complex, subunit Med10 isoform 1          203   1e-62   
ref|XP_002280081.1|  PREDICTED: mediator of RNA polymerase II tra...    202   2e-62   Vitis vinifera
ref|XP_007039390.1|  Mediator complex, subunit Med10 isoform 2          202   2e-62   
ref|XP_009359543.1|  PREDICTED: mediator of RNA polymerase II tra...    202   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_010089858.1|  Mediator of RNA polymerase II transcription ...    202   3e-62   
ref|XP_011026786.1|  PREDICTED: mediator of RNA polymerase II tra...    202   5e-62   Populus euphratica
ref|XP_011070384.1|  PREDICTED: mediator of RNA polymerase II tra...    202   5e-62   Sesamum indicum [beniseed]
ref|XP_006476288.1|  PREDICTED: mediator of RNA polymerase II tra...    201   5e-62   Citrus sinensis [apfelsine]
ref|XP_002527873.1|  nut2, putative                                     201   7e-62   
ref|XP_010533544.1|  PREDICTED: mediator of RNA polymerase II tra...    201   7e-62   Tarenaya hassleriana [spider flower]
ref|XP_008390269.1|  PREDICTED: mediator of RNA polymerase II tra...    201   8e-62   Malus domestica [apple tree]
ref|XP_008346652.1|  PREDICTED: mediator of RNA polymerase II tra...    200   2e-61   
ref|XP_009608619.1|  PREDICTED: mediator of RNA polymerase II tra...    200   2e-61   Nicotiana tomentosiformis
ref|XP_002299427.1|  RNA polymerase II mediator complex family pr...    200   2e-61   Populus trichocarpa [western balsam poplar]
emb|CBI34587.3|  unnamed protein product                                203   2e-61   Vitis vinifera
ref|XP_008234780.1|  PREDICTED: mediator of RNA polymerase II tra...    200   2e-61   Prunus mume [ume]
ref|XP_007218477.1|  hypothetical protein PRUPE_ppa012016mg             200   2e-61   Prunus persica
ref|XP_009608620.1|  PREDICTED: mediator of RNA polymerase II tra...    200   3e-61   Nicotiana tomentosiformis
ref|XP_009608618.1|  PREDICTED: mediator of RNA polymerase II tra...    200   3e-61   Nicotiana tomentosiformis
gb|KDO76724.1|  hypothetical protein CISIN_1g028220mg                   200   3e-61   Citrus sinensis [apfelsine]
gb|KDP24502.1|  hypothetical protein JCGZ_25066                         199   5e-61   Jatropha curcas
ref|XP_011022410.1|  PREDICTED: mediator of RNA polymerase II tra...    198   1e-60   Populus euphratica
ref|XP_004170927.1|  PREDICTED: mediator of RNA polymerase II tra...    197   1e-60   
ref|XP_008448559.1|  PREDICTED: mediator of RNA polymerase II tra...    197   2e-60   Cucumis melo [Oriental melon]
ref|XP_009787277.1|  PREDICTED: mediator of RNA polymerase II tra...    197   2e-60   Nicotiana sylvestris
ref|XP_011022415.1|  PREDICTED: mediator of RNA polymerase II tra...    197   2e-60   Populus euphratica
ref|XP_004146135.1|  PREDICTED: mediator of RNA polymerase II tra...    197   3e-60   Cucumis sativus [cucumbers]
emb|CDP12227.1|  unnamed protein product                                196   3e-60   Coffea canephora [robusta coffee]
ref|XP_007209640.1|  hypothetical protein PRUPE_ppa011942mg             197   4e-60   Prunus persica
ref|XP_006360992.1|  PREDICTED: mediator of RNA polymerase II tra...    197   5e-60   Solanum tuberosum [potatoes]
ref|XP_004245099.1|  PREDICTED: mediator of RNA polymerase II tra...    197   6e-60   Solanum lycopersicum
gb|EYU33473.1|  hypothetical protein MIMGU_mgv1a013913mg                196   8e-60   Erythranthe guttata [common monkey flower]
gb|EPS62420.1|  hypothetical protein M569_12371                         196   1e-59   Genlisea aurea
ref|XP_008239229.1|  PREDICTED: mediator of RNA polymerase II tra...    196   1e-59   Prunus mume [ume]
ref|XP_011462613.1|  PREDICTED: mediator of RNA polymerase II tra...    195   1e-59   Fragaria vesca subsp. vesca
ref|XP_004296727.1|  PREDICTED: mediator of RNA polymerase II tra...    195   2e-59   Fragaria vesca subsp. vesca
ref|NP_001150529.1|  mediator complex subunit 10 CG5057-PA              194   3e-59   Zea mays [maize]
gb|KGN55669.1|  Nut2                                                    196   4e-59   Cucumis sativus [cucumbers]
ref|XP_010251657.1|  PREDICTED: mediator of RNA polymerase II tra...    194   4e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010931382.1|  PREDICTED: mediator of RNA polymerase II tra...    194   8e-59   Elaeis guineensis
ref|XP_004957432.1|  PREDICTED: mediator of RNA polymerase II tra...    193   8e-59   Setaria italica
ref|XP_002460557.1|  hypothetical protein SORBIDRAFT_02g030650          193   9e-59   Sorghum bicolor [broomcorn]
tpg|DAA62423.1|  TPA: mediator complex subunit 10 CG5057-PA isofo...    193   1e-58   
ref|XP_002303692.1|  RNA polymerase II mediator complex family pr...    192   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_006415945.1|  hypothetical protein EUTSA_v10008848mg             192   2e-58   Eutrema salsugineum [saltwater cress]
ref|XP_009398711.1|  PREDICTED: mediator of RNA polymerase II tra...    191   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001150327.1|  mediator complex subunit 10 CG5057-PA              191   1e-57   Zea mays [maize]
ref|XP_004488501.1|  PREDICTED: mediator of RNA polymerase II tra...    189   3e-57   Cicer arietinum [garbanzo]
ref|XP_010676908.1|  PREDICTED: mediator of RNA polymerase II tra...    189   4e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001241316.1|  uncharacterized protein LOC100806084               188   1e-56   Glycine max [soybeans]
ref|XP_004504338.1|  PREDICTED: mediator of RNA polymerase II tra...    188   1e-56   Cicer arietinum [garbanzo]
ref|XP_004504337.1|  PREDICTED: mediator of RNA polymerase II tra...    187   1e-56   
gb|KCW82860.1|  hypothetical protein EUGRSUZ_C04229                     187   2e-56   Eucalyptus grandis [rose gum]
ref|XP_010050022.1|  PREDICTED: mediator of RNA polymerase II tra...    187   3e-56   Eucalyptus grandis [rose gum]
ref|XP_006660876.1|  PREDICTED: mediator of RNA polymerase II tra...    186   4e-56   Oryza brachyantha
gb|KDO76725.1|  hypothetical protein CISIN_1g028220mg                   184   5e-56   Citrus sinensis [apfelsine]
ref|XP_009103104.1|  PREDICTED: mediator of RNA polymerase II tra...    186   5e-56   Brassica rapa
ref|XP_008788520.1|  PREDICTED: mediator of RNA polymerase II tra...    187   5e-56   Phoenix dactylifera
ref|XP_006586008.1|  PREDICTED: mediator of RNA polymerase II tra...    185   7e-56   Glycine max [soybeans]
gb|EMS63705.1|  Mediator of RNA polymerase II transcription subun...    186   9e-56   Triticum urartu
ref|XP_006586003.1|  PREDICTED: mediator of RNA polymerase II tra...    185   1e-55   Glycine max [soybeans]
ref|XP_010238414.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    185   1e-55   Brachypodium distachyon [annual false brome]
ref|XP_010922762.1|  PREDICTED: mediator of RNA polymerase II tra...    186   1e-55   Elaeis guineensis
emb|CDM85480.1|  unnamed protein product                                185   2e-55   Triticum aestivum [Canadian hard winter wheat]
emb|CDY20567.1|  BnaC07g12340D                                          187   2e-55   Brassica napus [oilseed rape]
ref|XP_007153845.1|  hypothetical protein PHAVU_003G069600g             185   2e-55   Phaseolus vulgaris [French bean]
emb|CDM85486.1|  unnamed protein product                                184   3e-55   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK04300.1|  predicted protein                                      184   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_564254.1|  Mediator complex, subunit Med10                       184   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973916.1|  Mediator complex, subunit Med10                       184   3e-55   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ94367.1|  predicted protein                                      184   4e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT06746.1|  Mediator of RNA polymerase II transcription subun...    184   2e-54   
ref|XP_008788119.1|  PREDICTED: mediator of RNA polymerase II tra...    182   3e-54   Phoenix dactylifera
ref|XP_002893389.1|  T24P13.4                                           185   4e-54   
gb|AAF87025.1|AC006535_3  T24P13.4                                      185   6e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54170.1|  mediator of RNA polymerase II transcription subunit     180   1e-53   Phaseolus vulgaris [French bean]
gb|AFK33660.1|  unknown                                                 179   4e-53   Medicago truncatula
ref|XP_003629699.1|  Mediator of RNA polymerase II transcription ...    177   4e-53   
ref|NP_001063737.1|  Os09g0528300                                       178   7e-53   
ref|XP_003629698.1|  Mediator of RNA polymerase II transcription ...    177   1e-52   Medicago truncatula
gb|AFK42425.1|  unknown                                                 176   4e-52   Lotus japonicus
ref|XP_006849160.1|  hypothetical protein AMTR_s00027p00143800          176   5e-52   Amborella trichopoda
emb|CDY40258.1|  BnaA07g09420D                                          184   5e-52   Brassica napus [oilseed rape]
ref|XP_002868569.1|  hypothetical protein ARALYDRAFT_493793             175   9e-52   
ref|XP_010499011.1|  PREDICTED: mediator of RNA polymerase II tra...    175   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009766948.1|  PREDICTED: mediator of RNA polymerase II tra...    171   4e-50   Nicotiana sylvestris
gb|EMS49589.1|  Mediator of RNA polymerase II transcription subun...    170   5e-50   Triticum urartu
ref|XP_008788120.1|  PREDICTED: mediator of RNA polymerase II tra...    170   8e-50   
ref|NP_199006.1|  Mediator complex, subunit Med10                       170   9e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25204.1|  hypothetical protein JCGZ_20360                         170   1e-49   Jatropha curcas
ref|XP_009606753.1|  PREDICTED: mediator of RNA polymerase II tra...    166   3e-48   Nicotiana tomentosiformis
ref|XP_006380132.1|  hypothetical protein POPTR_0008s22200g             160   1e-46   
ref|XP_010477833.1|  PREDICTED: mediator of RNA polymerase II tra...    155   7e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006305653.1|  hypothetical protein CARUB_v10010356mg             147   7e-41   Capsella rubella
gb|EAZ03627.1|  hypothetical protein OsI_25763                          144   2e-39   Oryza sativa Indica Group [Indian rice]
gb|AGV54175.1|  mediator of RNA polymerase II transcription subunit     142   1e-38   Phaseolus vulgaris [French bean]
ref|XP_006367261.1|  PREDICTED: mediator of RNA polymerase II tra...    135   4e-37   Solanum tuberosum [potatoes]
ref|XP_006367259.1|  PREDICTED: mediator of RNA polymerase II tra...    134   1e-36   Solanum tuberosum [potatoes]
gb|ABK23782.1|  unknown                                                 133   2e-35   Picea sitchensis
ref|XP_009115391.1|  PREDICTED: mediator of RNA polymerase II tra...    131   9e-35   Brassica rapa
emb|CDY16179.1|  BnaA09g29130D                                          131   1e-34   Brassica napus [oilseed rape]
gb|EMT18148.1|  Mediator of RNA polymerase II transcription subun...    127   9e-34   
ref|XP_001765923.1|  predicted protein                                  122   2e-31   
emb|CAN83497.1|  hypothetical protein VITISV_026967                     123   3e-31   Vitis vinifera
emb|CDX85042.1|  BnaC05g20130D                                          121   3e-31   
gb|KJB51999.1|  hypothetical protein B456_008G258800                    119   9e-31   Gossypium raimondii
tpg|DAA40596.1|  TPA: hypothetical protein ZEAMMB73_822884              117   6e-30   
ref|XP_010460282.1|  PREDICTED: mediator of RNA polymerase II tra...    107   2e-26   
ref|XP_002986650.1|  hypothetical protein SELMODRAFT_235078             103   2e-24   
ref|XP_004493708.1|  PREDICTED: mediator of RNA polymerase II tra...  99.0    5e-23   
tpg|DAA40593.1|  TPA: hypothetical protein ZEAMMB73_822884            95.5    1e-21   
ref|XP_006387573.1|  hypothetical protein POPTR_0829s00210g           94.4    3e-21   
tpg|DAA40595.1|  TPA: hypothetical protein ZEAMMB73_822884            93.6    6e-21   
ref|XP_004512812.1|  PREDICTED: uncharacterized protein LOC101488839  81.6    2e-16   
ref|XP_001639313.1|  predicted protein                                73.2    3e-13   Nematostella vectensis
ref|XP_001621967.1|  hypothetical protein NEMVEDRAFT_v1g176376        73.2    3e-13   Nematostella vectensis
ref|XP_794222.1|  PREDICTED: mediator of RNA polymerase II transc...  73.2    4e-13   Strongylocentrotus purpuratus [purple urchin]
gb|EFX81997.1|  hypothetical protein DAPPUDRAFT_302806                72.8    6e-13   Daphnia pulex
gb|EHJ63693.1|  putative mediator complex, subunit                    71.6    1e-12   
ref|XP_004932922.1|  PREDICTED: mediator of RNA polymerase II tra...  71.2    1e-12   
ref|XP_004932921.1|  PREDICTED: mediator of RNA polymerase II tra...  71.2    1e-12   Bombyx mori [silk moth]
ref|XP_005681589.1|  PREDICTED: mediator of RNA polymerase II tra...  71.6    2e-12   
ref|XP_005102641.1|  PREDICTED: mediator of RNA polymerase II tra...  71.2    2e-12   Aplysia californica
ref|XP_001845336.1|  RNA polymerase II mediator complex subunit 10    70.9    3e-12   Culex quinquefasciatus
ref|XP_011412649.1|  PREDICTED: mediator of RNA polymerase II tra...  68.9    1e-11   
ref|XP_316314.2|  AGAP006248-PA                                       68.9    1e-11   Anopheles gambiae str. PEST
gb|ENN74363.1|  hypothetical protein YQE_09044                        68.9    1e-11   Dendroctonus ponderosae
ref|XP_001648875.1|  AAEL014501-PA                                    68.6    2e-11   Aedes aegypti
gb|ETN67202.1|  RNA polymerase II mediator complex subunit 10         68.2    2e-11   Anopheles darlingi [American malaria mosquito]
ref|XP_007520627.1|  PREDICTED: mediator of RNA polymerase II tra...  68.2    2e-11   Erinaceus europaeus [common hedgehog]
gb|KFH71415.1|  hypothetical protein MVEG_01714                       68.9    3e-11   Mortierella verticillata NRRL 6337
ref|XP_010968666.1|  PREDICTED: mediator of RNA polymerase II tra...  67.8    3e-11   Camelus bactrianus [camel]
ref|XP_005645629.1|  hypothetical protein COCSUDRAFT_8935             66.6    3e-11   Coccomyxa subellipsoidea C-169
ref|XP_009867898.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    3e-11   Apaloderma vittatum
ref|XP_010984281.1|  PREDICTED: mediator of RNA polymerase II tra...  68.2    3e-11   Camelus dromedarius [camel]
gb|KFV94189.1|  Mediator of RNA polymerase II transcription subun...  67.4    4e-11   Eurypyga helias
ref|XP_007898728.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    4e-11   Callorhinchus milii [Australian ghost shark]
ref|NP_613062.1|  mediator of RNA polymerase II transcription sub...  67.4    4e-11   Mus musculus [mouse]
ref|XP_010194202.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    4e-11   Colius striatus
ref|XP_005356754.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    4e-11   Microtus ochrogaster [prairie voles]
ref|XP_008832792.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    4e-11   Nannospalax galili
ref|XP_006198447.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    4e-11   Vicugna pacos
ref|XP_007435877.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    4e-11   Python bivittatus
ref|XP_969834.1|  PREDICTED: mediator of RNA polymerase II transc...  67.4    4e-11   Tribolium castaneum [rust-red flour beetle]
dbj|BAE33733.1|  unnamed protein product                              67.4    4e-11   Mus musculus [mouse]
ref|XP_010152321.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  67.4    4e-11   Eurypyga helias
ref|NP_001004914.1|  mediator of RNA polymerase II transcription ...  67.0    5e-11   Xenopus tropicalis [western clawed frog]
ref|XP_011242829.1|  PREDICTED: mediator of RNA polymerase II tra...  67.4    5e-11   Mus musculus [mouse]
ref|XP_001363617.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    5e-11   Monodelphis domestica
ref|XP_006081530.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-11   Myotis lucifugus
ref|XP_008948061.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-11   Merops nubicus
ref|XP_003462300.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-11   Cavia porcellus [guinea pig]
ref|XP_004380332.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-11   Trichechus manatus latirostris
ref|XP_004274551.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-11   Orcinus orca [Orca]
ref|XP_004625247.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-11   
ref|XP_001601868.2|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-11   Nasonia vitripennis
ref|XP_006875023.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-11   Chrysochloris asiatica
ref|XP_004678110.1|  PREDICTED: mediator of RNA polymerase II tra...  67.0    6e-11   Condylura cristata
ref|NP_115662.2|  mediator of RNA polymerase II transcription sub...  67.0    6e-11   Homo sapiens [man]
gb|ETE62868.1|  Mediator of RNA polymerase II transcription subun...  66.6    6e-11   Ophiophagus hannah
ref|XP_003134205.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    6e-11   Sus scrofa [pigs]
gb|ENN74364.1|  hypothetical protein YQE_09045                        66.6    7e-11   Dendroctonus ponderosae
ref|XP_006025079.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    7e-11   Alligator sinensis
ref|NP_001085232.1|  mediator of RNA polymerase II transcription ...  66.6    7e-11   Xenopus laevis [clawed frog]
ref|NP_001232567.1|  putative MGC89063 protein variant 2              66.6    7e-11   Taeniopygia guttata
ref|NP_001247782.1|  mediator of RNA polymerase II transcription ...  66.6    7e-11   Macaca mulatta [rhesus macaque]
ref|XP_010295441.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    7e-11   Phaethon lepturus
ref|XP_009078838.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    7e-11   Acanthisitta chloris
ref|XP_004894714.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    7e-11   
ref|XP_007453559.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    7e-11   Lipotes vexillifer [baiji]
ref|XP_008489554.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    8e-11   Calypte anna
ref|XP_010569720.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    8e-11   Haliaeetus leucocephalus
gb|KFQ70639.1|  Mediator of RNA polymerase II transcription subun...  66.6    8e-11   Phaethon lepturus
ref|XP_009568584.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    8e-11   Cuculus canorus
ref|XP_006001826.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    8e-11   Latimeria chalumnae
ref|XP_004597953.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    8e-11   Ochotona princeps [southern American pika]
ref|XP_006171581.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    9e-11   Tupaia chinensis
gb|ENN78401.1|  hypothetical protein YQE_05201                        66.6    9e-11   Dendroctonus ponderosae
ref|XP_004935190.1|  PREDICTED: mediator of RNA polymerase II tra...  66.6    9e-11   
ref|XP_005102640.1|  PREDICTED: mediator of RNA polymerase II tra...  66.2    1e-10   
ref|XP_003800937.1|  PREDICTED: mediator of RNA polymerase II tra...  66.2    1e-10   Otolemur garnettii
gb|KFW71686.1|  Mediator of RNA polymerase II transcription subun...  66.2    1e-10   Pygoscelis adeliae
ref|XP_002594058.1|  hypothetical protein BRAFLDRAFT_118806           66.2    1e-10   Branchiostoma floridae
ref|XP_005427987.1|  PREDICTED: mediator of RNA polymerase II tra...  66.2    1e-10   Geospiza fortis
ref|XP_006635939.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    1e-10   Lepisosteus oculatus
gb|KFQ66578.1|  Mediator of RNA polymerase II transcription subun...  65.9    1e-10   Pelecanus crispus
ref|XP_002424879.1|  nut2, putative                                   66.2    1e-10   Pediculus humanus corporis [human body lice]
ref|XP_009328746.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    1e-10   Pygoscelis adeliae
gb|KFO14882.1|  Mediator of RNA polymerase II transcription subun...  65.9    1e-10   Balearica regulorum gibbericeps
ref|XP_010308856.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    1e-10   Balearica regulorum gibbericeps
ref|XP_004698165.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    1e-10   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009489761.1|  PREDICTED: mediator of RNA polymerase II tra...  65.5    1e-10   Pelecanus crispus
ref|XP_419024.4|  PREDICTED: mediator of RNA polymerase II transc...  66.6    1e-10   
ref|XP_005959297.1|  PREDICTED: mediator of RNA polymerase II tra...  65.9    1e-10   Pantholops hodgsonii [Tibetan antelope]
ref|XP_003408084.1|  PREDICTED: mediator of RNA polymerase II tra...  65.5    2e-10   Loxodonta africana [African bush elephant]
ref|XP_005294660.2|  PREDICTED: mediator of RNA polymerase II tra...  67.0    2e-10   Chrysemys picta bellii
ref|XP_006001827.1|  PREDICTED: mediator of RNA polymerase II tra...  64.7    2e-10   Latimeria chalumnae
gb|KIH45973.1|  mediator of RNA polymerase II transcription subun...  65.5    2e-10   Ancylostoma duodenale
ref|XP_001600793.1|  PREDICTED: mediator of RNA polymerase II tra...  65.1    2e-10   Nasonia vitripennis
ref|NP_001271609.1|  mediator of RNA polymerase II transcription ...  65.1    3e-10   Macaca fascicularis [crab eating macaque]
ref|XP_003223649.1|  PREDICTED: mediator of RNA polymerase II tra...  65.1    3e-10   Anolis carolinensis [Carolina anole]
ref|XP_011285416.1|  PREDICTED: mediator of RNA polymerase II tra...  65.1    3e-10   
ref|XP_005873843.1|  PREDICTED: mediator of RNA polymerase II tra...  65.1    3e-10   Myotis brandtii
ref|XP_003342237.2|  PREDICTED: mediator of RNA polymerase II tra...  64.3    3e-10   Monodelphis domestica
ref|XP_004270303.1|  PREDICTED: mediator of RNA polymerase II tra...  64.7    4e-10   
ref|XP_007067402.1|  PREDICTED: mediator of RNA polymerase II tra...  63.9    4e-10   
emb|CDJ97162.1|  Mediator complex domain containing protein           64.7    4e-10   Haemonchus contortus [red stomach worm]
ref|XP_002412765.1|  nut2, putative                                   64.7    4e-10   Ixodes scapularis [blacklegged tick]
sp|Q0VIA1.1|MED10_DANRE  RecName: Full=Mediator of RNA polymerase...  64.3    4e-10   Danio rerio [leopard danio]
gb|KIH63536.1|  mediator of RNA polymerase II transcription subun...  63.9    5e-10   Ancylostoma duodenale
ref|NP_001017699.1|  mediator of RNA polymerase II transcription ...  64.3    5e-10   Danio rerio [leopard danio]
ref|XP_002112039.1|  hypothetical protein TRIADDRAFT_24417            63.9    6e-10   Trichoplax adhaerens
ref|XP_003737748.1|  PREDICTED: mediator of RNA polymerase II tra...  64.3    6e-10   Galendromus occidentalis
ref|XP_008543284.1|  PREDICTED: mediator of RNA polymerase II tra...  63.9    7e-10   Microplitis demolitor
ref|XP_006517338.1|  PREDICTED: mediator of RNA polymerase II tra...  64.3    8e-10   Mus musculus [mouse]
gb|KFM58995.1|  Mediator of RNA polymerase II transcription subun...  63.5    9e-10   Stegodyphus mimosarum
ref|XP_004845207.1|  PREDICTED: mediator of RNA polymerase II tra...  63.5    9e-10   
ref|NP_001188215.1|  mediator of RNA polymerase II transcription ...  63.5    1e-09   Ictalurus punctatus
ref|XP_011141422.1|  PREDICTED: mediator of RNA polymerase II tra...  63.2    1e-09   Harpegnathos saltator
ref|XP_003397402.1|  PREDICTED: mediator of RNA polymerase II tra...  63.2    1e-09   Bombus terrestris [large earth bumblebee]
gb|EFZ10240.1|  hypothetical protein SINV_14848                       63.2    1e-09   
ref|XP_624779.1|  PREDICTED: mediator of RNA polymerase II transc...  63.2    1e-09   Apis mellifera [bee]
ref|XP_011171735.1|  PREDICTED: mediator of RNA polymerase II tra...  63.2    1e-09   Solenopsis invicta [imported red fire ant]
ref|XP_011050147.1|  PREDICTED: mediator of RNA polymerase II tra...  62.8    1e-09   Acromyrmex echinatior
ref|XP_005188303.1|  PREDICTED: mediator of RNA polymerase II tra...  62.8    1e-09   Musca domestica
gb|KHJ40733.1|  hypothetical protein D918_09175                       63.9    1e-09   Trichuris suis
ref|XP_004315303.1|  PREDICTED: mediator of RNA polymerase II tra...  62.8    2e-09   
gb|KFD52471.1|  hypothetical protein M513_06668                       63.9    2e-09   Trichuris suis
gb|ETN84836.1|  hypothetical protein NECAME_06640                     63.9    2e-09   Necator americanus
ref|XP_005809155.1|  PREDICTED: mediator of RNA polymerase II tra...  62.4    2e-09   Xiphophorus maculatus
ref|XP_009058257.1|  hypothetical protein LOTGIDRAFT_233490           62.0    3e-09   Lottia gigantea
ref|XP_007563794.1|  PREDICTED: mediator of RNA polymerase II tra...  62.0    3e-09   Poecilia formosa
ref|XP_007231771.1|  PREDICTED: mediator of RNA polymerase II tra...  62.0    3e-09   Astyanax mexicanus [blind cave fish]
ref|XP_001511205.2|  PREDICTED: mediator of RNA polymerase II tra...  62.4    3e-09   
ref|XP_010733995.1|  PREDICTED: mediator of RNA polymerase II tra...  62.0    3e-09   Larimichthys crocea [croceine croaker]
ref|XP_008302435.1|  PREDICTED: mediator of RNA polymerase II tra...  62.0    3e-09   Stegastes partitus
ref|XP_003707557.1|  PREDICTED: mediator of RNA polymerase II tra...  61.6    3e-09   Megachile rotundata
emb|CDW52045.1|  UPF0203 and Med10 domain containing protein          63.2    3e-09   Trichuris trichiura
gb|ACQ57947.1|  Mediator of RNA polymerase II transcription subun...  61.6    4e-09   Anoplopoma fimbria
ref|XP_008329460.1|  PREDICTED: mediator of RNA polymerase II tra...  62.0    4e-09   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003443822.1|  PREDICTED: mediator of RNA polymerase II tra...  61.6    4e-09   Oreochromis niloticus
gb|ACM09055.1|  Mediator of RNA polymerase II transcription subun...  61.2    5e-09   Salmo salar
gb|ACO08870.1|  RNA polymerase II mediator complex subunit 10         61.2    5e-09   Osmerus mordax
emb|CAF99495.1|  unnamed protein product                              61.2    5e-09   Tetraodon nigroviridis
ref|XP_003969055.1|  PREDICTED: mediator of RNA polymerase II tra...  61.2    6e-09   Takifugu rubripes [tiger puffer]
ref|XP_011189186.1|  PREDICTED: mediator of RNA polymerase II tra...  60.8    7e-09   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004655747.1|  PREDICTED: mediator of RNA polymerase II tra...  60.5    7e-09   
gb|ACM09244.1|  Mediator of RNA polymerase II transcription subun...  60.8    7e-09   Salmo salar
ref|XP_004525900.1|  PREDICTED: mediator of RNA polymerase II tra...  60.8    7e-09   Ceratitis capitata [medfly]
gb|ACM08909.1|  Mediator of RNA polymerase II transcription subun...  60.8    8e-09   Salmo salar
ref|XP_004017144.1|  PREDICTED: mediator of RNA polymerase II tra...  60.8    8e-09   
ref|XP_004074478.1|  PREDICTED: mediator of RNA polymerase II tra...  60.5    9e-09   Oryzias latipes [Japanese rice fish]
ref|XP_003690347.1|  PREDICTED: mediator of RNA polymerase II tra...  60.5    1e-08   Apis florea [dwarf honeybee]
ref|XP_010871525.1|  PREDICTED: mediator of RNA polymerase II tra...  60.5    1e-08   
ref|XP_009858943.1|  PREDICTED: mediator of RNA polymerase II tra...  60.5    1e-08   Ciona intestinalis [sea vase]
ref|XP_011501311.1|  PREDICTED: mediator of RNA polymerase II tra...  60.5    1e-08   Ceratosolen solmsi marchali
ref|XP_010789639.1|  PREDICTED: mediator of RNA polymerase II tra...  60.1    1e-08   Notothenia coriiceps [yellowbelly rockcod]
ref|NP_001291005.1|  mediator complex subunit 10                      60.1    1e-08   Esox lucius
ref|XP_002732894.1|  PREDICTED: mediator of RNA polymerase II tra...  60.1    2e-08   Saccoglossus kowalevskii
ref|XP_003367725.1|  mediator of RNA polymerase II transcription ...  60.8    2e-08   Trichinella spiralis
ref|XP_003145125.1|  hypothetical protein LOAG_09550                  60.1    2e-08   Loa loa
gb|ACM09594.1|  Mediator of RNA polymerase II transcription subun...  58.9    2e-08   Salmo salar
ref|XP_006675478.1|  hypothetical protein BATDEDRAFT_22126            59.3    2e-08   Batrachochytrium dendrobatidis JAM81
ref|XP_008552382.1|  PREDICTED: mediator of RNA polymerase II tra...  59.3    3e-08   Microplitis demolitor
ref|XP_003381082.1|  mediator of RNA polymerase II transcription ...  60.8    3e-08   Trichinella spiralis
ref|XP_009024289.1|  hypothetical protein HELRODRAFT_85402            58.9    3e-08   Helobdella robusta
ref|XP_005029392.1|  PREDICTED: mediator of RNA polymerase II tra...  58.9    3e-08   
ref|XP_002839723.1|  hypothetical protein                             58.9    4e-08   Tuber melanosporum Mel28
ref|XP_001902787.1|  SD24044p                                         59.3    4e-08   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003287426.1|  hypothetical protein DICPUDRAFT_151521           59.7    4e-08   Dictyostelium purpureum
emb|CDP91692.1|  Protein BM-MDT-10, isoform a                         59.3    4e-08   
ref|XP_011310696.1|  PREDICTED: mediator of RNA polymerase II tra...  58.5    4e-08   Fopius arisanus
emb|CDQ80437.1|  unnamed protein product                              58.2    5e-08   
ref|XP_504022.1|  YALI0E16456p                                        58.5    6e-08   
gb|ERG87834.1|  mediator of rna polymerase ii transcription subun...  60.1    6e-08   
ref|XP_635833.1|  hypothetical protein DDB_G0290209                   59.3    7e-08   
ref|XP_849860.2|  PREDICTED: mediator of RNA polymerase II transc...  57.8    7e-08   
ref|XP_008487303.1|  PREDICTED: mediator of RNA polymerase II tra...  57.0    8e-08   
gb|ELU05881.1|  hypothetical protein CAPTEDRAFT_225426                57.8    9e-08   
ref|XP_008182011.1|  PREDICTED: mediator of RNA polymerase II tra...  58.2    2e-07   
gb|KFP40156.1|  Mediator of RNA polymerase II transcription subun...  56.2    2e-07   
ref|XP_002024961.1|  GL17837                                          56.6    2e-07   
ref|XP_001957222.1|  GF24162                                          56.6    2e-07   
ref|XP_010114904.1|  PREDICTED: mediator of RNA polymerase II tra...  56.2    2e-07   
ref|XP_001983366.1|  GH15858                                          56.6    2e-07   
ref|XP_001951882.1|  PREDICTED: mediator of RNA polymerase II tra...  58.2    2e-07   
ref|NP_648849.3|  mediator complex subunit 10, isoform B              56.6    2e-07   
gb|KGB38934.1|  Mediator of RNA polymerase II transcription subun...  57.0    2e-07   
ref|XP_002046184.1|  GJ12760                                          56.2    3e-07   
gb|AAP06408.1|  SJCHGC01009 protein                                   56.6    3e-07   
emb|CCD82369.1|  hypothetical protein Smp_025340                      56.6    3e-07   
ref|XP_005604461.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...  56.2    4e-07   
ref|XP_009940822.1|  PREDICTED: mediator of RNA polymerase II tra...  55.5    4e-07   
gb|EFA86244.1|  putative mediator complex subunit 10                  55.8    6e-07   
dbj|GAM21938.1|  hypothetical protein SAMD00019534_051130             55.5    7e-07   
gb|EDL87620.1|  similar to DNA segment, Chr 13, Wayne State Unive...  54.3    7e-07   
ref|XP_002006967.1|  GI12641                                          55.1    8e-07   
ref|XP_010460283.1|  PREDICTED: mediator of RNA polymerase II tra...  53.9    9e-07   
ref|XP_001973198.1|  GG15965                                          56.6    1e-06   
ref|XP_002086399.1|  GE23117                                          56.6    1e-06   
ref|XP_002095754.1|  GE19533                                          56.6    1e-06   
gb|KFO38462.1|  Mediator of RNA polymerase II transcription subun...  54.3    1e-06   
ref|XP_010604223.1|  PREDICTED: mediator of RNA polymerase II tra...  53.9    1e-06   
gb|KDR16737.1|  Mediator of RNA polymerase II transcription subun...  54.3    1e-06   
emb|CDH55146.1|  predicted protein                                    54.7    2e-06   
ref|XP_004666141.1|  PREDICTED: mediator of RNA polymerase II tra...  53.9    2e-06   
ref|XP_006195326.1|  PREDICTED: mediator of RNA polymerase II tra...  53.5    2e-06   
gb|KIW06185.1|  hypothetical protein PV09_02667                       53.9    2e-06   
ref|XP_009637011.1|  PREDICTED: mediator of RNA polymerase II tra...  53.5    2e-06   
ref|XP_003759658.1|  PREDICTED: mediator of RNA polymerase II tra...  53.5    2e-06   
ref|XP_005434542.1|  PREDICTED: mediator of RNA polymerase II tra...  53.5    2e-06   
ref|XP_004364730.1|  hypothetical protein CAOG_01862                  54.3    2e-06   
ref|XP_007451718.1|  PREDICTED: mediator of RNA polymerase II tra...  53.1    3e-06   
ref|XP_006127355.1|  PREDICTED: mediator of RNA polymerase II tra...  53.1    3e-06   
ref|XP_005239796.1|  PREDICTED: mediator of RNA polymerase II tra...  53.1    3e-06   
ref|XP_009928719.1|  PREDICTED: mediator of RNA polymerase II tra...  53.1    3e-06   
gb|KDQ24390.1|  hypothetical protein PLEOSDRAFT_1046852               53.5    4e-06   
ref|XP_006882964.1|  PREDICTED: mediator of RNA polymerase II tra...  53.1    4e-06   
ref|XP_008706982.1|  PREDICTED: mediator of RNA polymerase II tra...  52.8    4e-06   
gb|KFU85695.1|  Mediator of RNA polymerase II transcription subun...  52.4    4e-06   
ref|XP_010006665.1|  PREDICTED: mediator of RNA polymerase II tra...  52.4    4e-06   
ref|XP_005335249.1|  PREDICTED: mediator of RNA polymerase II tra...  53.1    4e-06   
gb|KDN40546.1|  hypothetical protein RSAG8_08018                      53.9    5e-06   
ref|XP_008517121.1|  PREDICTED: mediator of RNA polymerase II tra...  52.4    5e-06   
gb|EDL37023.1|  DNA segment, Chr 13, Wayne State University 50, e...  52.0    5e-06   
gb|EHH54143.1|  Mediator complex subunit 10                           52.0    5e-06   
ref|XP_009498982.1|  PREDICTED: mediator of RNA polymerase II tra...  52.0    5e-06   
ref|XP_002927789.1|  PREDICTED: mediator of RNA polymerase II tra...  52.0    5e-06   
ref|XP_009276992.1|  PREDICTED: mediator of RNA polymerase II tra...  52.4    5e-06   
ref|XP_009974490.1|  PREDICTED: mediator of RNA polymerase II tra...  52.8    5e-06   
ref|XP_008022103.1|  hypothetical protein SETTUDRAFT_175313           52.8    6e-06   
ref|XP_007684085.1|  hypothetical protein COCMIDRAFT_33257            52.8    6e-06   
ref|XP_007705280.1|  hypothetical protein COCSADRAFT_128289           52.8    6e-06   
emb|CDS14086.1|  hypothetical protein LRAMOSA06257                    52.8    6e-06   
ref|XP_006127356.1|  PREDICTED: mediator of RNA polymerase II tra...  51.6    7e-06   
gb|KIM84047.1|  hypothetical protein PILCRDRAFT_97098                 52.8    7e-06   
gb|EMD90481.1|  hypothetical protein COCHEDRAFT_1179325               52.4    8e-06   
ref|XP_005513368.1|  PREDICTED: mediator of RNA polymerase II tra...  52.0    8e-06   
gb|EUC63838.1|  transcription factor subunit Med10 of mediator co...  53.1    8e-06   
ref|XP_008921071.1|  PREDICTED: mediator of RNA polymerase II tra...  51.6    8e-06   
gb|KIH42732.1|  hypothetical protein ANCDUO_27279                     50.8    9e-06   
gb|EUN31105.1|  hypothetical protein COCVIDRAFT_23266                 52.0    9e-06   
ref|XP_009663478.1|  PREDICTED: mediator of RNA polymerase II tra...  52.0    9e-06   
ref|XP_008635473.1|  PREDICTED: mediator of RNA polymerase II tra...  52.0    9e-06   
ref|XP_007713373.1|  hypothetical protein COCCADRAFT_37714            52.0    9e-06   
ref|XP_001930579.1|  mediator of RNA polymerase II transcription ...  52.0    1e-05   
gb|KDD75001.1|  hypothetical protein H632_c932p0                      51.2    1e-05   
ref|XP_007096375.1|  PREDICTED: mediator of RNA polymerase II tra...  52.0    1e-05   
ref|XP_005896991.1|  PREDICTED: mediator of RNA polymerase II tra...  51.6    1e-05   
ref|XP_004604300.1|  PREDICTED: mediator of RNA polymerase II tra...  52.0    1e-05   
ref|XP_003301498.1|  hypothetical protein PTT_13018                   52.4    1e-05   
ref|XP_011107705.1|  hypothetical protein H072_1714                   52.4    2e-05   
gb|ESW98536.1|  Mediator of RNA polymerase II transcription subun...  51.2    2e-05   
gb|EUB61582.1|  Mediator of RNA polymerase II transcription subunit   51.6    2e-05   
dbj|GAN04769.1|  mediator of RNA polymerase II transcription subu...  51.2    2e-05   
emb|CDJ02263.1|  Mediator of RNA polymerase II transcription          51.6    2e-05   
ref|XP_004209439.1|  PREDICTED: mediator of RNA polymerase II tra...  50.8    2e-05   
gb|EYC39823.1|  hypothetical protein Y032_0639g986                    50.1    2e-05   
gb|EPB92340.1|  hypothetical protein HMPREF1544_00909                 50.8    3e-05   
emb|CEP62396.1|  LALA0S05e04698g1_1                                   50.8    3e-05   
gb|ACM08981.1|  Mediator of RNA polymerase II transcription subun...  50.1    3e-05   
ref|XP_009176929.1|  hypothetical protein T265_11866                  51.2    3e-05   
emb|CCG83714.1|  protein of unknown function                          50.4    3e-05   
gb|KIW06187.1|  hypothetical protein, variant 2                       50.1    4e-05   
gb|KHN86453.1|  Mediator of RNA polymerase II transcription subun...  50.4    5e-05   
emb|CDH55147.1|  predicted protein                                    50.1    5e-05   
ref|XP_007268068.1|  hypothetical protein FOMMEDRAFT_65242            50.1    5e-05   
ref|XP_007375550.1|  mediator of RNA polymerase II transcription ...  50.1    5e-05   
emb|CEP14746.1|  hypothetical protein                                 50.1    5e-05   
gb|EMG49532.1|  hypothetical protein G210_5672                        50.1    6e-05   
emb|CEL52755.1|  Mediator of RNA polymerase II transcription subu...  50.8    6e-05   
emb|CDS33518.1|  Mediator of RNA polymerase II transcription          50.1    6e-05   
gb|EYC39824.1|  hypothetical protein Y032_0639g986                    49.3    6e-05   
gb|EYC39825.1|  hypothetical protein Y032_0639g986                    48.9    6e-05   
ref|XP_006689443.1|  hypothetical protein CANTEDRAFT_111350           49.7    7e-05   
ref|XP_011275790.1|  Mediator of RNA polymerase II transcription ...  49.7    7e-05   
ref|XP_004358323.1|  putative mediator complex subunit 10             50.1    8e-05   
ref|XP_002549154.1|  hypothetical protein CTRG_03451                  50.1    8e-05   
ref|XP_007364484.1|  hypothetical protein DICSQDRAFT_179782           50.4    8e-05   
ref|XP_003366893.1|  mediator of RNA polymerase II transcription ...  50.4    8e-05   
gb|KHJ78989.1|  hypothetical protein OESDEN_21380                     51.2    9e-05   
ref|XP_011119949.1|  hypothetical protein AOL_s00054g331              50.4    9e-05   
ref|XP_011408963.1|  PREDICTED: mediator of RNA polymerase II tra...  49.3    1e-04   
ref|XP_003383806.1|  PREDICTED: mediator of RNA polymerase II tra...  49.3    1e-04   
gb|KJA30096.1|  hypothetical protein HYPSUDRAFT_105712                48.9    1e-04   
gb|EJU05979.1|  hypothetical protein DACRYDRAFT_97632                 50.8    1e-04   
emb|CAX82881.1|  RNA polymerase II mediator complex subunit 10        48.5    1e-04   
ref|XP_007830647.1|  hypothetical protein PFICI_03875                 49.3    1e-04   
ref|XP_002946506.1|  hypothetical protein VOLCADRAFT_120267           49.3    1e-04   
ref|XP_005843815.1|  hypothetical protein CHLNCDRAFT_54921            49.3    2e-04   
ref|XP_002631446.1|  C. briggsae CBR-MDT-10 protein                   49.3    2e-04   
ref|NP_495650.1|  Protein MDT-10                                      49.3    2e-04   
ref|XP_003844155.1|  similar to RNA polymerase II mediator comple...  48.9    2e-04   
ref|XP_007864503.1|  hypothetical protein GLOTRDRAFT_74149            49.3    2e-04   
gb|EPS95903.1|  hypothetical protein FOMPIDRAFT_1025594               48.9    2e-04   
gb|KHJ91970.1|  hypothetical protein OESDEN_08150                     49.3    2e-04   
gb|EKG17022.1|  Mediator complex subunit Med10                        48.5    2e-04   
ref|XP_007296725.1|  transcription factor subunit Med10               48.5    2e-04   
gb|EME49304.1|  hypothetical protein DOTSEDRAFT_19766                 48.1    2e-04   
ref|XP_008053076.1|  PREDICTED: mediator of RNA polymerase II tra...  50.1    3e-04   
ref|XP_008080838.1|  mediator of RNA polymerase II transcription ...  48.1    3e-04   
ref|XP_007301440.1|  hypothetical protein STEHIDRAFT_137898           48.5    3e-04   
emb|CDR37597.1|  CYFA0S01e12970g1_1                                   48.1    3e-04   
ref|XP_001486029.1|  hypothetical protein PGUG_01700                  48.1    3e-04   
ref|NP_015494.1|  Nut2p                                               48.1    3e-04   
ref|XP_004334288.1|  hypothetical protein ACA1_372640                 47.8    3e-04   
gb|EJT41286.1|  NUT2-like protein                                     48.1    4e-04   
emb|CCK70269.1|  hypothetical protein KNAG_0D05310                    48.1    4e-04   
ref|XP_011378322.1|  PREDICTED: mediator of RNA polymerase II tra...  47.4    4e-04   
gb|KIL68120.1|  hypothetical protein M378DRAFT_72105                  47.8    4e-04   
gb|EHM99685.1|  Nut2p                                                 47.8    4e-04   
ref|XP_003677682.1|  hypothetical protein NCAS_0H00210                47.8    5e-04   
gb|EIF47336.1|  nut2p                                                 47.4    5e-04   
ref|XP_006460159.1|  hypothetical protein AGABI2DRAFT_67575           47.8    5e-04   
ref|XP_003686304.1|  hypothetical protein TPHA_0G00320                47.8    5e-04   
ref|XP_003669574.1|  hypothetical protein NDAI_0D00170                47.8    6e-04   
gb|KDQ65127.1|  hypothetical protein JAAARDRAFT_116447                47.8    6e-04   
ref|XP_003712875.1|  hypothetical protein MGG_05314                   48.1    6e-04   
ref|XP_003683117.1|  hypothetical protein TDEL_0H00470                47.0    9e-04   
gb|KIP10593.1|  hypothetical protein PHLGIDRAFT_65317                 47.4    0.001   



>gb|KJB51998.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
 gb|KJB52000.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
Length=169

 Score =   208 bits (529),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVTELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLN CIAKNQ+TKGKTDAFKGLRKHLL+E
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNGCIAKNQVTKGKTDAFKGLRKHLLEE  146



>gb|KJB51996.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
 gb|KJB51997.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
Length=190

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVTELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLN CIAKNQ+TKGKTDAFKGLRKHLL+E
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNGCIAKNQVTKGKTDAFKGLRKHLLEE  146



>gb|KHG13856.1| Mediator of RNA polymerase II transcription subunit 10 [Gossypium 
arboreum]
Length=190

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVTELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLN CIAKNQ+TKGKTDAFKGLRKHLL+E
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNGCIAKNQVTKGKTDAFKGLRKHLLEE  146



>ref|XP_006439221.1| hypothetical protein CICLE_v10022441mg [Citrus clementina]
 gb|ESR52461.1| hypothetical protein CICLE_v10022441mg [Citrus clementina]
Length=186

 Score =   204 bits (518),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+S+QKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+ KL+EKC+IQ
Sbjct  33   KQNLNQVINSVQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMVKLSEKCNIQ  92

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLLDE
Sbjct  93   VPMEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLDE  142



>ref|XP_009358713.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Pyrus x bretschneideri]
Length=189

 Score =   204 bits (518),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG++HQLYLTVSSFNAASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  36   KQNLNQVINSIQKTLGLIHQLYLTVSSFNAASQLPLLQRLNALVMELDNMAKLSEKCNIQ  95

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+E
Sbjct  96   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEE  145



>ref|XP_007039392.1| Mediator complex, subunit Med10 isoform 4, partial [Theobroma 
cacao]
 gb|EOY23893.1| Mediator complex, subunit Med10 isoform 4, partial [Theobroma 
cacao]
Length=177

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLTQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEE  146



>ref|XP_007039391.1| Mediator complex, subunit Med10 isoform 3, partial [Theobroma 
cacao]
 gb|EOY23892.1| Mediator complex, subunit Med10 isoform 3, partial [Theobroma 
cacao]
Length=184

 Score =   203 bits (517),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLTQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEE  146



>ref|XP_007039389.1| Mediator complex, subunit Med10 isoform 1 [Theobroma cacao]
 gb|EOY23890.1| Mediator complex, subunit Med10 isoform 1 [Theobroma cacao]
Length=190

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLTQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEE  146



>ref|XP_002280081.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Vitis vinifera]
Length=194

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+NALV ELDN+ KL+EKC+IQ
Sbjct  41   KQNLNQVINSIQKTLGLLHQLYLTVSSFNVASQLPLLQRLNALVSELDNMTKLSEKCNIQ  100

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LID+GKNPDEFTRDVLNSCIAKNQITKGKTD+FKGLR+HLL+E
Sbjct  101  VPMEVLNLIDEGKNPDEFTRDVLNSCIAKNQITKGKTDSFKGLRRHLLEE  150



>ref|XP_007039390.1| Mediator complex, subunit Med10 isoform 2 [Theobroma cacao]
 gb|EOY23891.1| Mediator complex, subunit Med10 isoform 2 [Theobroma cacao]
Length=189

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLTQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEE  146



>ref|XP_009359543.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Pyrus x bretschneideri]
 ref|XP_009370921.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Pyrus x bretschneideri]
Length=190

 Score =   202 bits (514),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG++HQLYLTVSSFNAASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLIHQLYLTVSSFNAASQLPILQRLNALVMELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV +LIDDGKNPDEFTRDV+N CIAKNQITKGKTD FK LRKHLL+E
Sbjct  97   VPMEVFNLIDDGKNPDEFTRDVINGCIAKNQITKGKTDTFKSLRKHLLEE  146



>ref|XP_010089858.1| Mediator of RNA polymerase II transcription subunit 10 [Morus 
notabilis]
 gb|EXB38474.1| Mediator of RNA polymerase II transcription subunit 10 [Morus 
notabilis]
Length=209

 Score =   202 bits (515),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+S QK LG+LHQLYLTVSSFNAASQLP LQR+N+LVLELDN+ KL+EKC+IQ
Sbjct  38   KQNLNQVINSTQKNLGLLHQLYLTVSSFNAASQLPLLQRLNSLVLELDNMVKLSEKCNIQ  97

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDV+NSCI+KNQITKGKTDAFKGLRKHLL+E
Sbjct  98   VPMEVLNLIDDGKNPDEFTRDVINSCISKNQITKGKTDAFKGLRKHLLEE  147



>ref|XP_011026786.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Populus euphratica]
Length=190

 Score =   202 bits (513),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+N LV ELDN+ KL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMVKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  97   VPMEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLEE  146



>ref|XP_011070384.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Sesamum indicum]
Length=206

 Score =   202 bits (514),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QVI+SIQKTLG+LHQLYLTVSS+N ASQLP LQR+N LVLELDN+ +LAEKC+IQ
Sbjct  53   KQNLTQVINSIQKTLGLLHQLYLTVSSYNVASQLPLLQRLNNLVLELDNMTRLAEKCNIQ  112

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKG+R+HLL+E
Sbjct  113  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGMRRHLLEE  162



>ref|XP_006476288.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Citrus sinensis]
 ref|XP_006476289.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Citrus sinensis]
 gb|KDO76723.1| hypothetical protein CISIN_1g028220mg [Citrus sinensis]
Length=186

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+S+QKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+ KL+EKC+IQ
Sbjct  33   KQNLNQVINSVQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMVKLSEKCNIQ  92

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP EVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLLDE
Sbjct  93   VPTEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLDE  142



>ref|XP_002527873.1| nut2, putative [Ricinus communis]
 gb|EEF34504.1| nut2, putative [Ricinus communis]
Length=187

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLN VI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+N LVLELD +AKL+EKC+IQ
Sbjct  34   KQNLNNVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVLELDKMAKLSEKCNIQ  93

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFKGLRKHLL+E
Sbjct  94   VPLEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKGLRKHLLEE  143



>ref|XP_010533544.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Tarenaya hassleriana]
Length=190

 Score =   201 bits (512),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NLNQVI+SIQK LG+LHQLYLTVSSFN ASQLP LQR+N+LV+ELDN+AKL+EKC+IQ
Sbjct  36   KENLNQVINSIQKNLGLLHQLYLTVSSFNPASQLPLLQRLNSLVMELDNMAKLSEKCNIQ  95

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDV+NSCIA+NQ+TKGKTDAFKGLR+HLL+E
Sbjct  96   VPMEVLNLIDDGKNPDEFTRDVINSCIARNQVTKGKTDAFKGLRRHLLEE  145



>ref|XP_008390269.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Malus domestica]
Length=190

 Score =   201 bits (511),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG++HQLYLTVSSFN+ASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLIHQLYLTVSSFNSASQLPLLQRLNALVMELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV +LIDDGKNPDEFTRDV+N CIAKNQITKGKTD FK LRKHLL+E
Sbjct  97   VPMEVFNLIDDGKNPDEFTRDVINGCIAKNQITKGKTDTFKSLRKHLLEE  146



>ref|XP_008346652.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Malus domestica]
 ref|XP_008346653.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Malus domestica]
Length=189

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+ HQLYLTVSSFNA SQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  36   KQNLNQVINSIQKTLGLXHQLYLTVSSFNAXSQLPLLQRLNALVMELDNMAKLSEKCNIQ  95

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+E
Sbjct  96   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEE  145



>ref|XP_009608619.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Nicotiana tomentosiformis]
Length=194

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SI KTLG+LHQLYLTVSS+N +SQLP LQR+N LVLELDN+AKL EKC+IQ
Sbjct  43   KQNLNQVINSIDKTLGILHQLYLTVSSYNVSSQLPLLQRLNNLVLELDNMAKLGEKCNIQ  102

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFKGLR HLL+E
Sbjct  103  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKGLRGHLLEE  152



>ref|XP_002299427.1| RNA polymerase II mediator complex family protein [Populus trichocarpa]
 gb|EEE84232.1| RNA polymerase II mediator complex family protein [Populus trichocarpa]
Length=190

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+N LV ELDN+ KL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMVKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEF+RDV+NSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  97   VPMEVLNLIDDGKNPDEFSRDVINSCIAKNQVTKGKTDAFKSLRKHLLEE  146



>emb|CBI34587.3| unnamed protein product [Vitis vinifera]
Length=284

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+NALV ELDN+ KL+EKC+IQ
Sbjct  131  KQNLNQVINSIQKTLGLLHQLYLTVSSFNVASQLPLLQRLNALVSELDNMTKLSEKCNIQ  190

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LID+GKNPDEFTRDVLNSCIAKNQITKGKTD+FKGLR+HLL+E
Sbjct  191  VPMEVLNLIDEGKNPDEFTRDVLNSCIAKNQITKGKTDSFKGLRRHLLEE  240



>ref|XP_008234780.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Prunus mume]
Length=187

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLN+VI+SIQKTLG++HQLYLTVSSFN ASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  34   KQNLNEVINSIQKTLGLIHQLYLTVSSFNDASQLPLLQRLNALVIELDNMAKLSEKCNIQ  93

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+E
Sbjct  94   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEE  143



>ref|XP_007218477.1| hypothetical protein PRUPE_ppa012016mg [Prunus persica]
 gb|EMJ19676.1| hypothetical protein PRUPE_ppa012016mg [Prunus persica]
Length=187

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLN+VI+SIQKTLG++HQLYLTVSSFN ASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  34   KQNLNEVINSIQKTLGLIHQLYLTVSSFNDASQLPLLQRLNALVIELDNMAKLSEKCNIQ  93

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+E
Sbjct  94   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEE  143



>ref|XP_009608620.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X3 [Nicotiana tomentosiformis]
Length=193

 Score =   200 bits (508),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SI KTLG+LHQLYLTVSS+N +SQLP LQR+N LVLELDN+AKL EKC+IQ
Sbjct  43   KQNLNQVINSIDKTLGILHQLYLTVSSYNVSSQLPLLQRLNNLVLELDNMAKLGEKCNIQ  102

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFKGLR HLL+E
Sbjct  103  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKGLRGHLLEE  152



>ref|XP_009608618.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Nicotiana tomentosiformis]
Length=196

 Score =   200 bits (508),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SI KTLG+LHQLYLTVSS+N +SQLP LQR+N LVLELDN+AKL EKC+IQ
Sbjct  43   KQNLNQVINSIDKTLGILHQLYLTVSSYNVSSQLPLLQRLNNLVLELDNMAKLGEKCNIQ  102

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFKGLR HLL+E
Sbjct  103  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKGLRGHLLEE  152



>gb|KDO76724.1| hypothetical protein CISIN_1g028220mg [Citrus sinensis]
Length=212

 Score =   200 bits (509),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+S+QKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+ KL+EKC+IQ
Sbjct  33   KQNLNQVINSVQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMVKLSEKCNIQ  92

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP EVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLLDE
Sbjct  93   VPTEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLDE  142



>gb|KDP24502.1| hypothetical protein JCGZ_25066 [Jatropha curcas]
Length=187

 Score =   199 bits (506),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+N LV+ELDN+ KL+EKCDIQ
Sbjct  34   KQNLNQVINSIQKTLGLLHQLYLTVSSFNTASQLPLLQRLNGLVVELDNMVKLSEKCDIQ  93

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LID+G+NPDEFTR+V+NSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  94   VPMEVLNLIDEGENPDEFTRNVINSCIAKNQVTKGKTDAFKSLRKHLLEE  143



>ref|XP_011022410.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Populus euphratica]
 ref|XP_011022411.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Populus euphratica]
 ref|XP_011022412.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Populus euphratica]
 ref|XP_011022413.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Populus euphratica]
Length=185

 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI SIQKTLG LHQLYLTVSSFN ASQLP LQR+N LV ELDN+AKL+E+C+IQ
Sbjct  32   KQNLNQVIDSIQKTLGQLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMAKLSERCNIQ  91

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTR V+NSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  92   VPMEVLNLIDDGKNPDEFTRGVMNSCIAKNQVTKGKTDAFKSLRKHLLEE  141



>ref|XP_004170927.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like, partial [Cucumis sativus]
Length=166

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQL LTVS+FNAA QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  36   KQNLNQVINSIQKTLGILHQLNLTVSNFNAAYQLPLLQRLNSLVLELDNMVKLSEKCPIQ  95

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ TKGKTDAFKGLRKHLL+E
Sbjct  96   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQSTKGKTDAFKGLRKHLLEE  145



>ref|XP_008448559.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Cucumis melo]
 ref|XP_008448560.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Cucumis melo]
 ref|XP_008448561.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Cucumis melo]
Length=189

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQL LTVS+FNAA QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  36   KQNLNQVINSIQKTLGILHQLNLTVSNFNAAYQLPLLQRLNSLVLELDNMVKLSEKCPIQ  95

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ TKGKTDAFKGLRKHLL+E
Sbjct  96   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQSTKGKTDAFKGLRKHLLEE  145



>ref|XP_009787277.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009787278.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Nicotiana sylvestris]
Length=196

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SI KTLG+LHQLYLTVSS+N +SQLP LQR+N LVLELDN+AKL EKC+IQ
Sbjct  43   KQNLNQVINSIDKTLGILHQLYLTVSSYNVSSQLPLLQRLNNLVLELDNMAKLGEKCNIQ  102

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLD  524
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFKGLR HLL+
Sbjct  103  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKGLRGHLLE  151



>ref|XP_011022415.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Populus euphratica]
Length=179

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI SIQKTLG LHQLYLTVSSFN ASQLP LQR+N LV ELDN+AKL+E+C+IQ
Sbjct  32   KQNLNQVIDSIQKTLGQLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMAKLSERCNIQ  91

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTR V+NSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  92   VPMEVLNLIDDGKNPDEFTRGVMNSCIAKNQVTKGKTDAFKSLRKHLLEE  141



>ref|XP_004146135.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Cucumis sativus]
Length=189

 Score =   197 bits (501),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQL LTVS+FNAA QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  36   KQNLNQVINSIQKTLGILHQLNLTVSNFNAAYQLPLLQRLNSLVLELDNMVKLSEKCPIQ  95

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ TKGKTDAFKGLRKHLL+E
Sbjct  96   VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQSTKGKTDAFKGLRKHLLEE  145



>emb|CDP12227.1| unnamed protein product [Coffea canephora]
Length=166

 Score =   196 bits (499),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K NL QVI+S+QKTLG+LHQLYLTVSSFN ASQLP LQR+N LVLELDN++KLAEKC+IQ
Sbjct  13   KHNLTQVINSVQKTLGILHQLYLTVSSFNVASQLPLLQRLNNLVLELDNMSKLAEKCNIQ  72

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFT+DV+N+CIAKNQITKGKTDAFKGLR+HLL+E
Sbjct  73   VPMEVLNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDAFKGLRRHLLEE  122



>ref|XP_007209640.1| hypothetical protein PRUPE_ppa011942mg [Prunus persica]
 gb|EMJ10839.1| hypothetical protein PRUPE_ppa011942mg [Prunus persica]
Length=190

 Score =   197 bits (500),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLN+V +SIQK LG++HQLYLT+SSFNAASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNEVNNSIQKILGLIHQLYLTISSFNAASQLPLLQRLNALVIELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+E
Sbjct  97   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLEE  146



>ref|XP_006360992.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Solanum tuberosum]
Length=201

 Score =   197 bits (500),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SI KTLG+LHQL LTVSS+N +SQLP LQRMN LVLELDN+AKL EKC+IQ
Sbjct  48   KQNLNQVINSIDKTLGILHQLNLTVSSYNVSSQLPLLQRMNNLVLELDNMAKLGEKCNIQ  107

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLR HLL++
Sbjct  108  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRGHLLED  157



>ref|XP_004245099.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Solanum lycopersicum]
Length=201

 Score =   197 bits (500),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SI KTLG+LHQL LTVSS+N +SQLP LQRMN LVLELDN+AKL EKC+IQ
Sbjct  48   KQNLNQVINSIDKTLGILHQLNLTVSSYNVSSQLPLLQRMNNLVLELDNMAKLGEKCNIQ  107

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLR HLL++
Sbjct  108  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRGHLLED  157



>gb|EYU33473.1| hypothetical protein MIMGU_mgv1a013913mg [Erythranthe guttata]
Length=206

 Score =   196 bits (499),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NL QV +SIQKTLG+LHQLYLTVSSFN ASQLP LQRMN LVLELDN+ +LA+KC+IQ
Sbjct  53   KENLTQVTNSIQKTLGILHQLYLTVSSFNVASQLPLLQRMNNLVLELDNMTRLADKCNIQ  112

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL LIDDGKNPDEFTRD+LN CIAKNQITKGKTDAFKG+R+HLL+E
Sbjct  113  VPMEVLQLIDDGKNPDEFTRDMLNGCIAKNQITKGKTDAFKGMRRHLLEE  162



>gb|EPS62420.1| hypothetical protein M569_12371 [Genlisea aurea]
Length=199

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSS+N ASQLP LQRMN LVLELD+++KLAEKC+IQ
Sbjct  44   KQNLNQVINSIQKTLGILHQLYLTVSSYNVASQLPLLQRMNNLVLELDSMSKLAEKCNIQ  103

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EVL+LIDDGKNPDEFTRD+LN CI KNQITKGKTD+FK LR+HLL+E
Sbjct  104  VPIEVLNLIDDGKNPDEFTRDMLNGCITKNQITKGKTDSFKSLRRHLLEE  153



>ref|XP_008239229.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Prunus mume]
Length=190

 Score =   196 bits (497),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLN V +SIQK LG++HQLYLTVSSFNAASQLP LQR+NALV+ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNDVNNSIQKILGLIHQLYLTVSSFNAASQLPLLQRLNALVIELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLL+E
Sbjct  97   VPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDIFKSLRKHLLEE  146



>ref|XP_011462613.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011462614.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011462615.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011462616.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011462617.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X2 [Fragaria vesca subsp. vesca]
Length=190

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQ+LN+VI+SIQKTLG++HQLYLTVSSFNA SQLP LQR+N+L+ ELDN+AKL++KC+IQ
Sbjct  37   KQDLNKVINSIQKTLGLIHQLYLTVSSFNAGSQLPLLQRLNSLITELDNMAKLSDKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +PMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLLDE
Sbjct  97   IPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLDE  146



>ref|XP_004296727.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b isoform X1 [Fragaria vesca subsp. vesca]
Length=196

 Score =   195 bits (496),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQ+LN+VI+SIQKTLG++HQLYLTVSSFNA SQLP LQR+N+L+ ELDN+AKL++KC+IQ
Sbjct  43   KQDLNKVINSIQKTLGLIHQLYLTVSSFNAGSQLPLLQRLNSLITELDNMAKLSDKCNIQ  102

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +PMEV +LIDDGKNPDEFTRDV+NSCIAKNQITKGKTD FK LRKHLLDE
Sbjct  103  IPMEVFNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDTFKSLRKHLLDE  152



>ref|NP_001150529.1| mediator complex subunit 10 CG5057-PA [Zea mays]
 gb|ACG32758.1| mediator complex subunit 10 CG5057-PA [Zea mays]
 gb|ACG39422.1| mediator complex subunit 10 CG5057-PA [Zea mays]
 tpg|DAA40594.1| TPA: mediator complex subunit 10 CG5057-PA [Zea mays]
Length=190

 Score =   194 bits (494),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  37   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCI KNQITKGKTDAFKGLRKHLL+E
Sbjct  97   VPMEVVNLIDDGKNPDEFTRDVLNSCIVKNQITKGKTDAFKGLRKHLLEE  146



>gb|KGN55669.1| Nut2 [Cucumis sativus]
Length=249

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQL LTVS+FNAA QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  96   KQNLNQVINSIQKTLGILHQLNLTVSNFNAAYQLPLLQRLNSLVLELDNMVKLSEKCPIQ  155

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTRDVLNSCIAKNQ TKGKTDAFKGLRKHLL+E
Sbjct  156  VPMEVLNLIDDGKNPDEFTRDVLNSCIAKNQSTKGKTDAFKGLRKHLLEE  205



>ref|XP_010251657.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Nelumbo nucifera]
Length=181

 Score =   194 bits (492),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+NA+V ELD + KLAE C+IQ
Sbjct  28   KQNLNQVINSIQKTLGLLHQLYLTVSSFNLASQLPLLQRLNAVVSELDTMQKLAENCNIQ  87

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDV+N CIA+NQITKGKTDAFK LRKHLL+E
Sbjct  88   VPMEVVNLIDDGKNPDEFTRDVINGCIARNQITKGKTDAFKSLRKHLLEE  137



>ref|XP_010931382.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Elaeis guineensis]
Length=203

 Score =   194 bits (492),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            QNL QVI+S+ KTLG+LHQLYLTVSSF+AASQLP LQR+NALV ELD + KLAE CDIQV
Sbjct  51   QNLKQVINSVDKTLGLLHQLYLTVSSFSAASQLPLLQRLNALVAELDTMQKLAENCDIQV  110

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRK+LL+E
Sbjct  111  PMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKYLLEE  159



>ref|XP_004957432.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Setaria italica]
Length=188

 Score =   193 bits (491),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  35   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  94

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  95   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  144



>ref|XP_002460557.1| hypothetical protein SORBIDRAFT_02g030650 [Sorghum bicolor]
 gb|EER97078.1| hypothetical protein SORBIDRAFT_02g030650 [Sorghum bicolor]
Length=188

 Score =   193 bits (491),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  35   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  94

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  95   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  144



>tpg|DAA62423.1| TPA: mediator complex subunit 10 CG5057-PA isoform 1 [Zea mays]
 tpg|DAA62424.1| TPA: mediator complex subunit 10 CG5057-PA isoform 2 [Zea mays]
Length=187

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  34   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  93

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  94   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  143



>ref|XP_002303692.1| RNA polymerase II mediator complex family protein [Populus trichocarpa]
 gb|EEE78671.1| RNA polymerase II mediator complex family protein [Populus trichocarpa]
Length=185

 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI SIQKTLG LHQLYLTVSSFN ASQLP LQR+N LV ELDN+ KL+E+C+IQ
Sbjct  32   KQNLNQVIDSIQKTLGQLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMVKLSERCNIQ  91

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFTR V+NSCI KNQ+TKGKTD FK LRKHLL+E
Sbjct  92   VPMEVLNLIDDGKNPDEFTRGVINSCITKNQVTKGKTDGFKSLRKHLLEE  141



>ref|XP_006415945.1| hypothetical protein EUTSA_v10008848mg [Eutrema salsugineum]
 gb|ESQ34298.1| hypothetical protein EUTSA_v10008848mg [Eutrema salsugineum]
Length=191

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NLNQVI+SIQKTLG+LHQL+LTVSSF  ASQL  LQR+N+LVLELD++AKL+EKC+IQ
Sbjct  38   KENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVLELDSMAKLSEKCNIQ  97

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +PMEVLSLIDDGKNPDEFTRDVLNSCIA+NQ+TKGKTDAFK LRKH+L+E
Sbjct  98   IPMEVLSLIDDGKNPDEFTRDVLNSCIARNQVTKGKTDAFKDLRKHILEE  147



>ref|XP_009398711.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Musa acuminata subsp. malaccensis]
Length=202

 Score =   191 bits (486),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QVI+S+ KTLG+LHQLYLTVSSF+ ASQLP LQR+NALV ELD + K+A+KC+IQ
Sbjct  49   KQNLTQVINSVDKTLGLLHQLYLTVSSFSVASQLPLLQRLNALVAELDAMQKMADKCNIQ  108

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDV+NSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  109  VPMEVVNLIDDGKNPDEFTRDVINSCIAKNQITKGKTDAFKSLRKHLLEE  158



>ref|NP_001150327.1| mediator complex subunit 10 CG5057-PA [Zea mays]
 gb|ACG38665.1| mediator complex subunit 10 CG5057-PA [Zea mays]
Length=187

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV  LD + KLAE C+IQ
Sbjct  34   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAXLDTMQKLAEGCNIQ  93

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  94   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  143



>ref|XP_004488501.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Cicer arietinum]
Length=186

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            QNLNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  34   QNLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  93

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFTRD++N+CIAKNQITKGKTDA K LRKHLL+E
Sbjct  94   PMEVVNLIDDGKNPDEFTRDIINNCIAKNQITKGKTDALKNLRKHLLEE  142



>ref|XP_010676908.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010676909.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Beta vulgaris subsp. vulgaris]
Length=193

 Score =   189 bits (480),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL+ V +SI KTLG+LHQLYLTVSSFN ASQLP LQR+N+LV+ELDN+ KL+ KC+IQ
Sbjct  40   KQNLSDVTNSIDKTLGLLHQLYLTVSSFNVASQLPLLQRINSLVMELDNMMKLSSKCNIQ  99

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +PMEVL+LIDDGKNPDEFT+DVLNSCIAKNQITKGK DAFK LRKHLL+E
Sbjct  100  IPMEVLNLIDDGKNPDEFTKDVLNSCIAKNQITKGKADAFKSLRKHLLEE  149



>ref|NP_001241316.1| uncharacterized protein LOC100806084 [Glycine max]
 ref|XP_006601827.1| PREDICTED: uncharacterized protein LOC100806084 isoform X1 [Glycine 
max]
 ref|XP_006601828.1| PREDICTED: uncharacterized protein LOC100806084 isoform X2 [Glycine 
max]
 gb|ACU23358.1| unknown [Glycine max]
 gb|KHN30521.1| Mediator of RNA polymerase II transcription subunit 10 [Glycine 
soja]
Length=190

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  40   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  99

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFT+DV+NSCIAKNQITKGKTDA K LRKHLL+E
Sbjct  100  PMEVVNLIDDGKNPDEFTKDVINSCIAKNQITKGKTDALKSLRKHLLEE  148



>ref|XP_004504338.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Cicer arietinum]
Length=186

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            QNLNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  34   QNLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  93

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFTRD++N+CIAKNQITKGKTDA K  RKHLL+E
Sbjct  94   PMEVVNLIDDGKNPDEFTRDIINNCIAKNQITKGKTDALKNFRKHLLEE  142



>ref|XP_004504337.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Cicer arietinum]
Length=189

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            QNLNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  34   QNLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  93

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFTRD++N+CIAKNQITKGKTDA K  RKHLL+E
Sbjct  94   PMEVVNLIDDGKNPDEFTRDIINNCIAKNQITKGKTDALKNFRKHLLEE  142



>gb|KCW82860.1| hypothetical protein EUGRSUZ_C04229 [Eucalyptus grandis]
Length=181

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQ+LNQVI+SIQKTLG+LHQLYL VSSFN   QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  28   KQDLNQVINSIQKTLGLLHQLYLNVSSFNTGLQLPLLQRINSLVLELDNMVKLSEKCHIQ  87

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EVL+LIDDGKNPD FT+D++N CIAKNQITKGKTD+FKGLRKHLL+E
Sbjct  88   VPVEVLNLIDDGKNPDGFTKDIINGCIAKNQITKGKTDSFKGLRKHLLEE  137



>ref|XP_010050022.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Eucalyptus grandis]
 gb|KCW82859.1| hypothetical protein EUGRSUZ_C04229 [Eucalyptus grandis]
Length=188

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQ+LNQVI+SIQKTLG+LHQLYL VSSFN   QLP LQR+N+LVLELDN+ KL+EKC IQ
Sbjct  35   KQDLNQVINSIQKTLGLLHQLYLNVSSFNTGLQLPLLQRINSLVLELDNMVKLSEKCHIQ  94

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EVL+LIDDGKNPD FT+D++N CIAKNQITKGKTD+FKGLRKHLL+E
Sbjct  95   VPVEVLNLIDDGKNPDGFTKDIINGCIAKNQITKGKTDSFKGLRKHLLEE  144



>ref|XP_006660876.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Oryza brachyantha]
Length=189

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV +SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  36   KQNLAQVTASIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  95

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  96   VPMEVVNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFKSLRKHLLEE  145



>gb|KDO76725.1| hypothetical protein CISIN_1g028220mg [Citrus sinensis]
 gb|KDO76726.1| hypothetical protein CISIN_1g028220mg [Citrus sinensis]
Length=135

 Score =   184 bits (468),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+S+QKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+ KL+EKC+IQ
Sbjct  33   KQNLNQVINSVQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVSELDNMVKLSEKCNIQ  92

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  500
            VP EVL+LIDDGKNPDEFTRDV+NSCIAKNQ+TKGKTDAFK
Sbjct  93   VPTEVLNLIDDGKNPDEFTRDVINSCIAKNQVTKGKTDAFK  133



>ref|XP_009103104.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Brassica rapa]
Length=190

 Score =   186 bits (473),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NLNQVI+SIQKTLG+LHQL+LTVSSF  ASQL  LQR+N+LV EL+++ KL+EKC+IQ
Sbjct  37   KENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVSELNSMTKLSEKCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVLSLIDDGKNPDEFTRDV+NSC+A+NQ+TKGKTDAFK LRKH+L+E
Sbjct  97   VPMEVLSLIDDGKNPDEFTRDVINSCVARNQVTKGKTDAFKDLRKHILEE  146



>ref|XP_008788520.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Phoenix dactylifera]
Length=207

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            +NL QVI+SI KTLG+LHQLYLTVSSF+ ASQLP LQR+NALV ELD + KLAE CDIQV
Sbjct  55   KNLKQVINSIDKTLGLLHQLYLTVSSFSVASQLPLLQRLNALVAELDTMQKLAENCDIQV  114

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            P EV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRK+LL+E
Sbjct  115  PAEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKYLLEE  163



>ref|XP_006586008.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X6 [Glycine max]
Length=165

 Score =   185 bits (469),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  13   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  72

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFT+DV+NSCI KNQITKGKTDA K LRKHLL+E
Sbjct  73   PMEVVNLIDDGKNPDEFTKDVINSCIVKNQITKGKTDALKSLRKHLLEE  121



>gb|EMS63705.1| Mediator of RNA polymerase II transcription subunit 10 [Triticum 
urartu]
Length=193

 Score =   186 bits (471),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV +SIQ+TLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  40   KQNLAQVTASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  99

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  100  VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  149



>ref|XP_006586003.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Glycine max]
 ref|XP_006586004.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Glycine max]
 ref|XP_006586005.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X3 [Glycine max]
 ref|XP_006586006.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X4 [Glycine max]
 ref|XP_006586007.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X5 [Glycine max]
 gb|KHN13486.1| Mediator of RNA polymerase II transcription subunit 10 [Glycine 
soja]
Length=192

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  40   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVAELDNMVKLAEKCNIQV  99

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFT+DV+NSCI KNQITKGKTDA K LRKHLL+E
Sbjct  100  PMEVVNLIDDGKNPDEFTKDVINSCIVKNQITKGKTDALKSLRKHLLEE  148



>ref|XP_010238414.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 10b-like [Brachypodium distachyon]
Length=187

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  39   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  98

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  99   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  148



>ref|XP_010922762.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Elaeis guineensis]
Length=206

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            +NL QVI+S+  TLG+LHQLYLTVSSF+ ASQLP +QR+NALV ELD + KLAE CDIQV
Sbjct  54   KNLQQVINSVDMTLGLLHQLYLTVSSFSVASQLPLIQRLNALVAELDTMQKLAENCDIQV  113

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRK+LL+E
Sbjct  114  PMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKYLLEE  162



>emb|CDM85480.1| unnamed protein product [Triticum aestivum]
Length=195

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  42   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  101

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  102  VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  151



>emb|CDY20567.1| BnaC07g12340D [Brassica napus]
Length=248

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NLNQVI+SIQKTLG+LHQL+LTVSSF  ASQL  LQR+N+LV EL+++ KL+EKC+IQ
Sbjct  95   KENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVSELNSMTKLSEKCNIQ  154

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVLSLIDDGKNPDEFTRDV+NSC+A+NQ+TKGKTDAFK LRKH+L+E
Sbjct  155  VPMEVLSLIDDGKNPDEFTRDVINSCVARNQVTKGKTDAFKDLRKHILEE  204



>ref|XP_007153845.1| hypothetical protein PHAVU_003G069600g [Phaseolus vulgaris]
 gb|ESW25839.1| hypothetical protein PHAVU_003G069600g [Phaseolus vulgaris]
Length=192

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV+ELDN+ KLAEK +IQV
Sbjct  40   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVVELDNMVKLAEKSNIQV  99

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFT+DV+NSCIAKNQITKGKTDA K LRKHLL+E
Sbjct  100  PMEVVNLIDDGKNPDEFTKDVINSCIAKNQITKGKTDALKNLRKHLLEE  148



>emb|CDM85486.1| unnamed protein product [Triticum aestivum]
Length=193

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  40   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDAMQKLADGCNIQ  99

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  100  VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  149



>dbj|BAK04300.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=191

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV +SIQ+TLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  38   KQNLAQVTASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  97

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  98   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  147



>ref|NP_564254.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
 gb|AAK49628.1|AF372912_1 At1g26660/T24P13_4 [Arabidopsis thaliana]
 gb|AAL15363.1| At1g26660/T24P13_4 [Arabidopsis thaliana]
 gb|AEE30718.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
Length=189

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NL+QVI+SI+KTLG+LHQL+LTV+SF  ASQL  LQR+N+LV+ELDN+ KL+EKC+IQ
Sbjct  36   KENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQ  95

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +PMEVL+LIDDGKNPDEFT+DVLNSCIA+NQ+TKGKTDAFK LRKH+L+E
Sbjct  96   IPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEE  145



>ref|NP_973916.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
 sp|F4HPA7.1|MD10B_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
10b [Arabidopsis thaliana]
 gb|AEE30717.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
Length=189

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NL+QVI+SI+KTLG+LHQL+LTV+SF  ASQL  LQR+N+LV+ELDN+ KL+EKC+IQ
Sbjct  36   KENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQ  95

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +PMEVL+LIDDGKNPDEFT+DVLNSCIA+NQ+TKGKTDAFK LRKH+L+E
Sbjct  96   IPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEE  145



>dbj|BAJ94367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=186

 Score =   184 bits (466),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV +SIQ+TLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  38   KQNLAQVTASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  97

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  98   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  147



>gb|EMT06746.1| Mediator of RNA polymerase II transcription subunit 10 [Aegilops 
tauschii]
Length=241

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  38   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  97

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK LRKHLL+E
Sbjct  98   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEE  147



>ref|XP_008788119.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X1 [Phoenix dactylifera]
Length=204

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            QNL QVI S+ KTLG+LHQLYLTVSSF+  SQLP LQR+NALV +LD + KLAE CDIQV
Sbjct  52   QNLKQVIHSVDKTLGLLHQLYLTVSSFSVVSQLPLLQRLNALVADLDTMQKLAENCDIQV  111

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFTRDVLN+CIAKNQ TKGKTDAFK LRK+LL+E
Sbjct  112  PMEVVNLIDDGKNPDEFTRDVLNNCIAKNQSTKGKTDAFKSLRKYLLEE  160



>ref|XP_002893389.1| T24P13.4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69648.1| T24P13.4 [Arabidopsis lyrata subsp. lyrata]
Length=309

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NL+QVI+SI+KTLG+LHQL+LTV+SF  ASQL  LQR+N+LV+ELDN+ KL+EKC+IQ
Sbjct  176  KENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQ  235

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFT+DVLNSCIA+NQ+TKGKTDAFK LRKH+L+E
Sbjct  236  VPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEE  285



>gb|AAF87025.1|AC006535_3 T24P13.4 [Arabidopsis thaliana]
Length=309

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NL+QVI+SI+KTLG+LHQL+LTV+SF  ASQL  LQR+N+LV+ELDN+ KL+EKC+IQ
Sbjct  176  KENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQ  235

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +PMEVL+LIDDGKNPDEFT+DVLNSCIA+NQ+TKGKTDAFK LRKH+L+E
Sbjct  236  IPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEE  285



>gb|AGV54170.1| mediator of RNA polymerase II transcription subunit [Phaseolus 
vulgaris]
Length=192

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P LQR+N LV+ELDN+ KLAEK +IQV
Sbjct  40   QKLNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLQRINGLVVELDNMVKLAEKSNIQV  99

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEF++DV+NSCIAKNQI KGKTDA K LRKHLL+E
Sbjct  100  PMEVVNLIDDGKNPDEFSKDVINSCIAKNQIPKGKTDALKNLRKHLLEE  148



>gb|AFK33660.1| unknown [Medicago truncatula]
Length=186

 Score =   179 bits (453),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            QNL+Q+ +SI+KTLG++HQL LTVS+FN+A Q+P LQR+N LV+ELDN+ KLAEKC+IQV
Sbjct  34   QNLSQISNSIEKTLGLIHQLSLTVSTFNSALQMPLLQRINGLVVELDNMVKLAEKCNIQV  93

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFT+DV+N+CIAKNQITKGKTDA K LRKHLL+E
Sbjct  94   PMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDALKDLRKHLLEE  142



>ref|XP_003629699.1| Mediator of RNA polymerase II transcription subunit [Medicago 
truncatula]
Length=154

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            QNL+Q+ +SI+KTLG++HQL LTVS+FN+A Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  2    QNLSQISNSIEKTLGLIHQLSLTVSTFNSALQMPLLQRINGLVAELDNMVKLAEKCNIQV  61

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFT+DV+N+CIAKNQITKGKTDA K LRKHLL+E
Sbjct  62   PMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDALKDLRKHLLEE  110



>ref|NP_001063737.1| Os09g0528300 [Oryza sativa Japonica Group]
 dbj|BAF25651.1| Os09g0528300 [Oryza sativa Japonica Group]
 gb|EAZ09832.1| hypothetical protein OsI_32122 [Oryza sativa Indica Group]
 gb|EAZ45438.1| hypothetical protein OsJ_30088 [Oryza sativa Japonica Group]
 dbj|BAH00329.1| unnamed protein product [Oryza sativa Japonica Group]
Length=190

 Score =   178 bits (452),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL  +++SIQ+TLG+LHQL L VSSF++ASQLP LQR+N+LV ELD + K AE C+IQ
Sbjct  37   KQNLALMMASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNSLVAELDTMQKHAEGCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQ+TKGKTDAFK LRKHLL+E
Sbjct  97   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEE  146



>ref|XP_003629698.1| Mediator of RNA polymerase II transcription subunit [Medicago 
truncatula]
 gb|AET04174.1| mediator of RNA polymerase II transcription subunit 10 [Medicago 
truncatula]
Length=186

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            QNL+Q+ +SI+KTLG++HQL LTVS+FN+A Q+P LQR+N LV ELDN+ KLAEKC+IQV
Sbjct  34   QNLSQISNSIEKTLGLIHQLSLTVSTFNSALQMPLLQRINGLVAELDNMVKLAEKCNIQV  93

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFT+DV+N+CIAKNQITKGKTDA K LRKHLL+E
Sbjct  94   PMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDALKDLRKHLLEE  142



>gb|AFK42425.1| unknown [Lotus japonicus]
Length=191

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            Q LNQV +SIQKTLG++HQLYLTVS+FNAA Q+P L+R+N LV ELDN+ KLAEKC+I V
Sbjct  39   QELNQVSNSIQKTLGLIHQLYLTVSTFNAAFQMPLLERINGLVEELDNMVKLAEKCNIHV  98

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            PMEV++LIDDGKNPDEFT+DV+N+CIAKNQITKGKTD  K LRK LL E
Sbjct  99   PMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDGLKNLRKQLLGE  147



>ref|XP_006849160.1| hypothetical protein AMTR_s00027p00143800 [Amborella trichopoda]
 gb|ERN10741.1| hypothetical protein AMTR_s00027p00143800 [Amborella trichopoda]
Length=175

 Score =   176 bits (445),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K NLN VI+SI KTLG+LHQL+LTVSSF+ +SQLP L+R+NA+V ELD + +LA+ C+IQ
Sbjct  22   KHNLNNVINSIDKTLGLLHQLHLTVSSFSVSSQLPLLERLNAVVTELDTMQRLADSCNIQ  81

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +PMEV++LIDDGKNPDEFTRDV N+CIAKNQITKGKT+ FK LRKHLL+E
Sbjct  82   IPMEVVNLIDDGKNPDEFTRDVFNNCIAKNQITKGKTEVFKSLRKHLLEE  131



>emb|CDY40258.1| BnaA07g09420D [Brassica napus]
Length=515

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NLNQVI+SIQKTLG+LHQL+LTVSSF  ASQL  LQR+N+LV EL+++ KL+EKC+IQ
Sbjct  362  KENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVSELNSMTKLSEKCNIQ  421

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVLSLIDDGKNPDEFTRDV+NSC+A+NQ+TKGKTDAFK LRKH+L+E
Sbjct  422  VPMEVLSLIDDGKNPDEFTRDVINSCVARNQVTKGKTDAFKDLRKHILEE  471



>ref|XP_002868569.1| hypothetical protein ARALYDRAFT_493793 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44828.1| hypothetical protein ARALYDRAFT_493793 [Arabidopsis lyrata subsp. 
lyrata]
Length=178

 Score =   175 bits (443),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NLNQVI+S QKTL +LHQL LTVSSF  ASQL  LQR+N LV+ELDN+A+ ++KC+IQ
Sbjct  24   KENLNQVINSNQKTLVLLHQLKLTVSSFTPASQLDLLQRLNCLVMELDNMAQFSDKCNIQ  83

Query  378  VPMEVLSLIDDGKNPDEFTRDVL-NSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPDEFT++VL NSCIA+NQ+TKGKTDAFKGLRKHLL+E
Sbjct  84   VPMEVLNLIDDGKNPDEFTKNVLNNSCIARNQVTKGKTDAFKGLRKHLLEE  134



>ref|XP_010499011.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Camelina sativa]
Length=195

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NLNQVI+SI   L +LHQ++LT+ SF  ASQLP LQR+N LVLELDN+AKL+EKC IQ
Sbjct  42   KENLNQVINSIHNILTLLHQIHLTIGSFTPASQLPLLQRLNTLVLELDNMAKLSEKCSIQ  101

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +PMEV++L+D+GKNPD++T+DVLN CIA+NQ+TKGKTDAFK LRKH+L+E
Sbjct  102  IPMEVINLVDNGKNPDDYTKDVLNGCIARNQVTKGKTDAFKDLRKHILEE  151



>ref|XP_009766948.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Nicotiana sylvestris]
Length=183

 Score =   171 bits (433),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 97/110 (88%), Gaps = 5/110 (5%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQ I+SI+KTLG+LH+LYLTVSS     QL  +QR+N LVLELDN+A   EKC+IQ
Sbjct  44   KQNLNQSINSIEKTLGILHKLYLTVSS-----QLLLIQRLNNLVLELDNMATFGEKCNIQ  98

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EVL+LID+GKNPDEFTRDVLN+CI KNQITKGKTDAFKGLR+HLL+E
Sbjct  99   VPIEVLNLIDNGKNPDEFTRDVLNNCIVKNQITKGKTDAFKGLRRHLLEE  148



>gb|EMS49589.1| Mediator of RNA polymerase II transcription subunit 10 [Triticum 
urartu]
Length=175

 Score =   170 bits (431),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV  SIQKTLG+LHQL L VSSF++ASQLP LQR+NALV ELD + KLA+ C+IQ
Sbjct  61   KQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQ  120

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  500
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK
Sbjct  121  VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  161



>ref|XP_008788120.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like isoform X2 [Phoenix dactylifera]
Length=174

 Score =   170 bits (430),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            QNL QVI S+ KTLG+LHQLYLTVSSF+  SQLP LQR+NALV +LD + KLAE CDIQV
Sbjct  52   QNLKQVIHSVDKTLGLLHQLYLTVSSFSVVSQLPLLQRLNALVADLDTMQKLAENCDIQV  111

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  500
            PMEV++LIDDGKNPDEFTRDVLN+CIAKNQ TKGKTDAFK
Sbjct  112  PMEVVNLIDDGKNPDEFTRDVLNNCIAKNQSTKGKTDAFK  151



>ref|NP_199006.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
 sp|Q9FHZ2.1|MD10A_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
10a [Arabidopsis thaliana]
 dbj|BAB08424.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO22665.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42425.1| unknown protein [Arabidopsis thaliana]
 gb|AED94743.1| Mediator complex, subunit Med10 [Arabidopsis thaliana]
Length=186

 Score =   170 bits (431),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            + LNQ+I+S QK L +LHQL LTVSSF  ASQL  LQR+N+LV+ELDN+AKL++KC+IQV
Sbjct  33   EKLNQIINSNQKILELLHQLKLTVSSFTPASQLHLLQRLNSLVMELDNMAKLSDKCNIQV  92

Query  381  PMEVLSLIDDGKNPDEFTRDVLN-SCIAKNQITKGKTDAFKGLRKHLLDE  527
            P+EVL+LIDDGKNPDEFT+DVLN +CIAKNQ+TKGK+DAFKGLRKHLL+E
Sbjct  93   PIEVLNLIDDGKNPDEFTKDVLNKNCIAKNQVTKGKSDAFKGLRKHLLEE  142



>gb|KDP25204.1| hypothetical protein JCGZ_20360 [Jatropha curcas]
Length=188

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QVI+SIQ+TL  LH LYLTVS+FNAASQLP L+R+N LV+ELDNL KL++K +IQ
Sbjct  35   KQNLIQVINSIQRTLAFLHHLYLTVSTFNAASQLPLLRRLNVLVMELDNLIKLSDKLNIQ  94

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP EVLS IDDGKNPD+FTRDV+N+CI+ NQ TKG+ DAFK LR HLL+E
Sbjct  95   VPTEVLSYIDDGKNPDDFTRDVINNCISTNQATKGQADAFKSLRSHLLEE  144



>ref|XP_009606753.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Nicotiana tomentosiformis]
Length=168

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQN+N+ I+SI+KTLG+LHQLYLTVSS+N +SQL  LQ +N LVLELDN+ K   KC+IQ
Sbjct  50   KQNINESINSIEKTLGILHQLYLTVSSYNVSSQLLLLQCLNNLVLELDNMVKFGGKCNIQ  109

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LID+GKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLR+HLL+E
Sbjct  110  VPMEVLNLIDNGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRRHLLEE  159



>ref|XP_006380132.1| hypothetical protein POPTR_0008s22200g, partial [Populus trichocarpa]
 gb|ERP57929.1| hypothetical protein POPTR_0008s22200g, partial [Populus trichocarpa]
Length=141

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 89/110 (81%), Gaps = 9/110 (8%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRM---------NALVLELDNLA  350
            KQNLNQVI SIQKTLG LHQLYLT SSFN ASQ P LQR+         N LV ELDN+ 
Sbjct  32   KQNLNQVIDSIQKTLGQLHQLYLTFSSFNTASQPPLLQRLYFSINPLFCNGLVTELDNMV  91

Query  351  KLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  500
            KL+E+C+IQVPMEVL+LIDDG+NPDEFTR V+NSCI KNQ+TK KTDAFK
Sbjct  92   KLSERCNIQVPMEVLNLIDDGRNPDEFTRAVINSCITKNQVTKEKTDAFK  141



>ref|XP_010477833.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Camelina sativa]
Length=196

 Score =   155 bits (392),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+NLNQVI+SI K L +LHQL+LT+SSF  ASQL  LQR+N LVLELDN+AKL+EKC IQ
Sbjct  43   KENLNQVINSIDKVLTLLHQLHLTISSFTPASQLHLLQRLNNLVLELDNMAKLSEKCSIQ  102

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLD  524
            +PMEV++L+DDGKNPD+FT+DV+N CIA+NQ+TKGKTDAFK LRKH+++
Sbjct  103  IPMEVINLVDDGKNPDDFTKDVVNGCIARNQVTKGKTDAFKDLRKHIME  151



>ref|XP_006305653.1| hypothetical protein CARUB_v10010356mg [Capsella rubella]
 gb|EOA38551.1| hypothetical protein CARUB_v10010356mg [Capsella rubella]
Length=193

 Score =   147 bits (372),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K+N+NQV++S +K L ++HQL LT++SF  ASQL  LQR+N LV ELDN+ KL+EKC+ Q
Sbjct  40   KENINQVVNSTEKILTLVHQLQLTLTSFTPASQLHLLQRLNLLVSELDNMDKLSEKCNFQ  99

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+LIDDGKNPD+F ++ LNSCIA+NQ+TKGKTDAFK LRKH+L+E
Sbjct  100  VPMEVLNLIDDGKNPDDFMKEALNSCIARNQVTKGKTDAFKDLRKHILEE  149



>gb|EAZ03627.1| hypothetical protein OsI_25763 [Oryza sativa Indica Group]
Length=216

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL  +++SIQ+TLG+LHQL L VSSF++ASQLP LQR+N+LV ELD + K AE C+IQ
Sbjct  37   KQNLALMMASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNSLVAELDTMQKHAEGCNIQ  96

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF  497
            VPMEV++LIDDGKNPDEFTRDVLNSCIAKNQ  + K   F
Sbjct  97   VPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQEKEKKNHQF  136



>gb|AGV54175.1| mediator of RNA polymerase II transcription subunit [Phaseolus 
vulgaris]
Length=209

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQV  380
            + LNQV +SIQKTLG++HQ YL V +FNAA Q+P +QR+N LV+ELDN+ KLAEK    V
Sbjct  39   RKLNQVSNSIQKTLGLIHQFYLPVFTFNAAFQMPRIQRINGLVVELDNMVKLAEKSRFPV  98

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            P EV++LIDDGKNPDEF++DV+  C AKNQIT+GKT A     KH L+E
Sbjct  99   PREVVNLIDDGKNPDEFSKDVIKRCFAKNQITQGKTGALNISGKHFLEE  147



>ref|XP_006367261.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Solanum tuberosum]
Length=124

 Score =   135 bits (341),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 85/113 (75%), Gaps = 13/113 (12%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSF--NAASQLPFLQRMNALVLELDNLAKLAEKC-  368
            KQNLNQVI SI KTL +LHQL    SSF  N AS L      N LV E DN+AKL E C 
Sbjct  5    KQNLNQVIYSIDKTLEILHQL----SSFDVNVASHL------NNLVFEFDNMAKLGENCH  54

Query  369  DIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             I+VPMEVL+LID+GKNPDEF RD+LN+CIAKNQITKGK DAFK LR HLL++
Sbjct  55   SIKVPMEVLNLIDNGKNPDEFARDLLNNCIAKNQITKGKVDAFKDLRGHLLED  107



>ref|XP_006367259.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Solanum tuberosum]
Length=124

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 85/111 (77%), Gaps = 9/111 (8%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DI  374
            KQNLNQVI SI KTL +LHQL    SSF+    +     +N LV E+DN+AKL E C  I
Sbjct  5    KQNLNQVIYSIDKTLEILHQL----SSFD----VDVASHLNNLVFEIDNMAKLGENCHSI  56

Query  375  QVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +VPMEVL+LID+GKNPDEF RD+LN+CIAKNQITKGK DAFK LR HLL++
Sbjct  57   KVPMEVLNLIDNGKNPDEFARDLLNNCIAKNQITKGKVDAFKDLRGHLLED  107



>gb|ABK23782.1| unknown [Picea sitchensis]
 gb|ACN40738.1| unknown [Picea sitchensis]
Length=173

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = +3

Query  207  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPM  386
            L+ +  SIQK+LG+LHQ++ TVSSF A SQL  L R+N LV E++ + K A+  DIQVP+
Sbjct  23   LDPISRSIQKSLGILHQMHCTVSSFTANSQLNLLDRINYLVNEINEMQKAAQDIDIQVPL  82

Query  387  EVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRK  512
            EV+ LIDDGKNPDEFT+D++N CI +NQ TKGK++AFK LRK
Sbjct  83   EVIKLIDDGKNPDEFTKDIINKCIQRNQTTKGKSEAFKNLRK  124



>ref|XP_009115391.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Brassica rapa]
Length=180

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLP-FLQRMNALVLELDNLAKLAEKCDI  374
            K++L+QVI+SI K+L +LHQL+L++SS    S     L R+N+LV EL++++KL+EKC+I
Sbjct  26   KESLDQVINSINKSLVVLHQLHLSLSSSLTPSSQLHLLPRLNSLVSELNSISKLSEKCNI  85

Query  375  QVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            Q+PMEVLSLIDDGKNPDEF RDVLNSC+A+NQ TKGKTDAFK LRKH+L+E
Sbjct  86   QIPMEVLSLIDDGKNPDEFARDVLNSCVARNQATKGKTDAFKELRKHILEE  136



>emb|CDY16179.1| BnaA09g29130D [Brassica napus]
Length=180

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLP-FLQRMNALVLELDNLAKLAEKCDI  374
            K++L+QVI+SI K+L +LHQL+L++SS    S     L R+N+LV EL++++KL+EKC+I
Sbjct  26   KESLDQVINSINKSLVVLHQLHLSLSSSLTPSSQLHLLPRLNSLVSELNSISKLSEKCNI  85

Query  375  QVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            Q+PMEVLSLIDDGKNPDEF RDVLNSC+A+NQ TKGKTDAFK LRKH+L+E
Sbjct  86   QIPMEVLSLIDDGKNPDEFARDVLNSCVARNQATKGKTDAFKELRKHILEE  136



>gb|EMT18148.1| Mediator of RNA polymerase II transcription subunit 10 [Aegilops 
tauschii]
Length=148

 Score =   127 bits (320),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +3

Query  318  NALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF  497
            NALV ELD + KLAE C+IQVPMEV++LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF
Sbjct  35   NALVAELDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF  94

Query  498  KGLRKHLLDE  527
            K LRKHLL+E
Sbjct  95   KSLRKHLLEE  104



>ref|XP_001765923.1| predicted protein [Physcomitrella patens]
 gb|EDQ69244.1| predicted protein [Physcomitrella patens]
Length=162

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +3

Query  216  VISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVL  395
             ++S+ + L +LHQL  +VS F   SQL  L+R+N LV E  N+   ++ C IQ+P+EVL
Sbjct  15   TLASVHRALALLHQLQCSVSGFQLPSQLVLLERLNGLVSEFGNMHSASQDCHIQIPLEVL  74

Query  396  SLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            + ID+G+NPDE+T+ +LN CI +NQ +KGK D+FK LRKHLL++
Sbjct  75   NFIDEGRNPDEYTKHLLNGCIQQNQASKGKVDSFKALRKHLLEQ  118



>emb|CAN83497.1| hypothetical protein VITISV_026967 [Vitis vinifera]
Length=209

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 81/114 (71%), Gaps = 5/114 (4%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFN ASQLP LQR+NALV ELDN+ KL+EKC+IQ
Sbjct  44   KQNLNQVINSIQKTLGLLHQLYLTVSSFNVASQLPLLQRLNALVSELDNMTKLSEKCNIQ  103

Query  378  VPMEVLS----LIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VPMEVL+     +    + +    DV    +    I  G  D   GLR+HLL+E
Sbjct  104  VPMEVLNWGLRFVRQLHDWELEEVDVFFGRLYDQSIRSGFEDTM-GLRRHLLEE  156



>emb|CDX85042.1| BnaC05g20130D [Brassica napus]
Length=157

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  312  RMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTD  491
            R+N+LV EL++++ L+EKC+IQ+P+EVLSLIDDGKNPDEFTRDVLNSCI++NQ+TKGKTD
Sbjct  44   RLNSLVSELNSMSNLSEKCNIQIPVEVLSLIDDGKNPDEFTRDVLNSCISRNQVTKGKTD  103

Query  492  AFKGLRKHLLDE  527
            AFK L KH+L+E
Sbjct  104  AFKELGKHILEE  115



>gb|KJB51999.1| hypothetical protein B456_008G258800 [Gossypium raimondii]
Length=128

 Score =   119 bits (299),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNLNQVI+SIQKTLG+LHQLYLTVSSFNAASQLP LQR+N+LV ELDN+AKL+EKC+IQ
Sbjct  37   KQNLNQVINSIQKTLGLLHQLYLTVSSFNAASQLPLLQRLNSLVTELDNMAKLSEKCNIQ  96

Query  378  VPMEVLSLI  404
            VPMEVL  +
Sbjct  97   VPMEVLKWV  105



>tpg|DAA40596.1| TPA: hypothetical protein ZEAMMB73_822884 [Zea mays]
Length=105

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  345  LAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLD  524
            + KLAE C+IQVPMEV++LIDDGKNPDEFTRDVLNSCI KNQITKGKTDAFKGLRKHLL+
Sbjct  1    MQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIVKNQITKGKTDAFKGLRKHLLE  60

Query  525  E  527
            E
Sbjct  61   E  61



>ref|XP_010460282.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b [Camelina sativa]
Length=105

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +3

Query  345  LAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLD  524
            +AKL+EKC IQ+PMEV++L+DDGKNPD+FT+DVLN CIA+NQ+TKGKTDAFK LRKH+++
Sbjct  1    MAKLSEKCSIQIPMEVINLVDDGKNPDDFTKDVLNGCIARNQVTKGKTDAFKDLRKHIME  60



>ref|XP_002986650.1| hypothetical protein SELMODRAFT_235078 [Selaginella moellendorffii]
 gb|EFJ12213.1| hypothetical protein SELMODRAFT_235078 [Selaginella moellendorffii]
Length=157

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            K  L  +  S+   L  LHQL+ +VSSF   SQL  L+R+N LV +L+ +   + +C+++
Sbjct  6    KMALAGMEESLHSALATLHQLHCSVSSFTLPSQLLVLERLNELVKDLNLMQSSSNQCNLE  65

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLL  521
            +P+EV+  ID+GKNPDEFT+D+LN CI +NQ TKG     K LRKH+L
Sbjct  66   IPVEVIRFIDEGKNPDEFTKDLLNHCIQRNQATKG-----KALRKHIL  108



>ref|XP_004493708.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10b-like [Cicer arietinum]
Length=113

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  297  LPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQIT  476
            +P LQ +N L ++LDN+ KL EKC  QVPM+ ++LID  KNPDEF RD++N+CI KNQIT
Sbjct  1    MPLLQLVNGLFVKLDNMVKLIEKCSFQVPMKFVNLIDVNKNPDEFIRDIINNCIVKNQIT  60

Query  477  KGKTDAFKGLRKHLLDE  527
            KGKT   K L +HLL E
Sbjct  61   KGKTCFLKNLCQHLLKE  77



>tpg|DAA40593.1| TPA: hypothetical protein ZEAMMB73_822884 [Zea mays]
Length=108

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQ  377
            KQNL QV SSIQKTLG+LHQL LTVSSFN+ASQLP LQR+NALV ELD + KLAE C+IQ
Sbjct  37   KQNLAQVTSSIQKTLGLLHQLNLTVSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQ  96



>ref|XP_006387573.1| hypothetical protein POPTR_0829s00210g [Populus trichocarpa]
 gb|ERP46487.1| hypothetical protein POPTR_0829s00210g [Populus trichocarpa]
Length=113

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +3

Query  345  LAKLAEKCDIQ-VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLL  521
            + KL+E+C+IQ V   VLSLIDDGKNPDEFTR V+NSCI KNQ+TKGKTDAFK L KH L
Sbjct  1    MVKLSERCNIQQVYCFVLSLIDDGKNPDEFTRGVINSCITKNQVTKGKTDAFKSLCKHQL  60

Query  522  DE  527
            +E
Sbjct  61   EE  62



>tpg|DAA40595.1| TPA: hypothetical protein ZEAMMB73_822884 [Zea mays]
Length=107

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  396  SLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            SLIDDGKNPDEFTRDVLNSCI KNQITKGKTDAFKGLRKHLL+E
Sbjct  20   SLIDDGKNPDEFTRDVLNSCIVKNQITKGKTDAFKGLRKHLLEE  63



>ref|XP_004512812.1| PREDICTED: uncharacterized protein LOC101488839 [Cicer arietinum]
Length=123

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  342  NLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  500
            N   +AE  +IQVPMEV+ LID  KNPDEFTRD++N+CI KNQITKGKTDA K
Sbjct  66   NFPAMAENRNIQVPMEVVDLIDHRKNPDEFTRDIINNCIPKNQITKGKTDALK  118



>ref|XP_001639313.1| predicted protein [Nematostella vectensis]
 gb|EDO47250.1| predicted protein [Nematostella vectensis]
Length=139

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 62/106 (58%), Gaps = 9/106 (8%)
 Frame = +3

Query  225  SIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-----DIQVPME  389
            +I++ +    Q+ + VS F   SQ    Q++N +V   DNL ++ EKC     D++VP+E
Sbjct  17   TIEQFVETTRQIGIIVSDFQPGSQGVLNQKINMMV---DNLREI-EKCKAHVADVEVPLE  72

Query  390  VLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            V   ID G+NP  +T+D L   + KN+  KGK DA+K  +  L+DE
Sbjct  73   VFEYIDQGRNPQLYTKDCLEKALVKNEQVKGKIDAYKNFKSLLVDE  118



>ref|XP_001621967.1| hypothetical protein NEMVEDRAFT_v1g176376 [Nematostella vectensis]
 gb|EDO29867.1| predicted protein [Nematostella vectensis]
Length=139

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 62/106 (58%), Gaps = 9/106 (8%)
 Frame = +3

Query  225  SIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-----DIQVPME  389
            +I++ +    Q+ + VS F   SQ    Q++N +V   DNL ++ EKC     D++VP+E
Sbjct  17   TIEQFVETTRQIGIIVSDFQPGSQGVLNQKINMMV---DNLREI-EKCKAHVADVEVPLE  72

Query  390  VLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            V   ID G+NP  +T+D L   + KN+  KGK DA+K  +  L+DE
Sbjct  73   VFEYIDQGRNPQLYTKDCLEKALVKNEQVKGKIDAYKNFKSLLVDE  118



>ref|XP_794222.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Strongylocentrotus purpuratus]
 ref|XP_780323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Strongylocentrotus purpuratus]
Length=137

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = +3

Query  216  VISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPME-  389
            ++ ++++ + +  QL L VS F    Q P  Q+++ LV  L  L K  E+  D+QVP+E 
Sbjct  12   LVENLERFIEITRQLGLVVSDFQPQGQAPLNQKLHMLVSSLQELDKNKEQVQDVQVPLEL  71

Query  390  VLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +   +D GKNP  +T+D +   +AKN++ KGK + F+  +K L+ E
Sbjct  72   IYEYVDQGKNPQLYTKDCMERAVAKNELVKGKIETFRRFKKALVTE  117



>gb|EFX81997.1| hypothetical protein DAPPUDRAFT_302806 [Daphnia pulex]
Length=136

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++N++V  L  + KL  +  D+ VP+EV   ID+G+NP 
Sbjct  19   IRQVKIIVSDFQPQGQSVLNQKINSIVQGLQEIDKLKSQVQDVHVPLEVFEYIDEGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK D+++  R HLL+E
Sbjct  79   LYTKDCMEKALNKNEQVKGKIDSYRKFRAHLLEE  112



>gb|EHJ63693.1| putative mediator complex, subunit [Danaus plexippus]
Length=131

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++ +LV  L  + KL A+  DI VP EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQSVLNQKIQSLVTGLQEVDKLKAQVHDIHVPTEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D ++  +AKN+  KGK D++K  + HLL E
Sbjct  79   LYTKDCIDKALAKNEEVKGKIDSYKRFKSHLLSE  112



>ref|XP_004932922.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X2 [Bombyx mori]
Length=118

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++ +LV  L  + KL  +  DI VP EV   ID G+NP 
Sbjct  6    VRQIRIIVSDFQPQGQSVLNQKIQSLVTGLQEIDKLKSQVHDIHVPTEVFDYIDQGRNPQ  65

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D ++  +AKN+  KGK D++K  + HLL E
Sbjct  66   LYTKDCIDKALAKNEEVKGKIDSYKRFKTHLLSE  99



>ref|XP_004932921.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X1 [Bombyx mori]
Length=131

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++ +LV  L  + KL  +  DI VP EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQSVLNQKIQSLVTGLQEIDKLKSQVHDIHVPTEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D ++  +AKN+  KGK D++K  + HLL E
Sbjct  79   LYTKDCIDKALAKNEEVKGKIDSYKRFKTHLLSE  112



>ref|XP_005681589.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X2 [Capra hircus]
Length=139

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 5/114 (4%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC----  368
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  +KC    
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKYIDKCRQQL  62

Query  369  -DIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             DI VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   HDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  116



>ref|XP_005102641.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X2 [Aplysia californica]
Length=134

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +3

Query  252  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDE  428
             Q+ + VS F    Q    Q++  +V EL+ + KL  +  D+QVP+EV   ID G+NP  
Sbjct  20   RQMGIIVSDFQPQGQNVLNQKIQTMVTELNEIDKLRTQIQDVQVPLEVFDYIDQGRNPSL  79

Query  429  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +T+D L   +AKN+  KGKTD+ K  +  LL E
Sbjct  80   YTKDCLEKALAKNEQVKGKTDSLKRFKAMLLQE  112



>ref|XP_001845336.1| RNA polymerase II mediator complex subunit 10 [Culex quinquefasciatus]
 gb|EDS40177.1| RNA polymerase II mediator complex subunit 10 [Culex quinquefasciatus]
Length=130

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  428
            + Q+ + VS F    Q    Q++ +LV  L  + KL  + D+ VP+EV   ID G+NP  
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKNQVDVNVPLEVFDYIDQGRNPQL  78

Query  429  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +T+D ++  + KN+  KGK DA++  + +LL E
Sbjct  79   YTKDCIDKALTKNEEVKGKIDAYRKFKSNLLSE  111



>ref|XP_011412649.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Crassostrea gigas]
 gb|EKC26203.1| Mediator of RNA polymerase II transcription subunit 10 [Crassostrea 
gigas]
Length=137

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = +3

Query  255  QLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDIQVPMEVLSLIDDGKNPDEF  431
            QL + VS F    Q    Q+++ +V  L  + KL  +  DIQVP+EV   ID GKNP+ +
Sbjct  24   QLGIIVSDFQPQGQNVLNQKLHTMVTGLQEIDKLKTQMGDIQVPLEVFDYIDQGKNPNLY  83

Query  432  TRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            T+D L   +AKN+  KGK D FK  +  LL E
Sbjct  84   TKDCLEKALAKNEQVKGKIDNFKKFKAALLVE  115



>ref|XP_316314.2| AGAP006248-PA [Anopheles gambiae str. PEST]
 sp|Q7Q5R5.2|MED10_ANOGA RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Anopheles 
gambiae]
 gb|EAA11572.2| AGAP006248-PA [Anopheles gambiae str. PEST]
 gb|KFB36016.1| AGAP006248-PA-like protein [Anopheles sinensis]
Length=130

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  428
            + Q+ + VS F    Q    Q++ +LV  L  + KL  + D+ VP+EV   ID G+NP  
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKNQIDVNVPLEVFDYIDQGRNPQL  78

Query  429  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +T+D ++  + KN+  KGK D+++  + +L+ E
Sbjct  79   YTKDCIDKALTKNEEVKGKIDSYRKFKSNLMKE  111



>gb|ENN74363.1| hypothetical protein YQE_09044, partial [Dendroctonus ponderosae]
 gb|ERL90584.1| hypothetical protein D910_07931 [Dendroctonus ponderosae]
Length=135

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = +3

Query  255  QLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDEF  431
            Q+++ VS F   SQ    Q++  +V  L  + KL  +  D+QVP EVL  ID G+NP  +
Sbjct  21   QMHIIVSDFQPQSQNALNQKLQTMVHGLQEVDKLKSQFQDVQVPPEVLDYIDQGRNPKLY  80

Query  432  TRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            T++ +   +AKN+  KGK DA++ L+K L+ E
Sbjct  81   TKNCIEKALAKNEQVKGKIDAYQKLKKSLIVE  112



>ref|XP_001648875.1| AAEL014501-PA [Aedes aegypti]
 sp|Q16G71.1|MED10_AEDAE RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Aedes aegypti]
 gb|EAT33233.1| AAEL014501-PA [Aedes aegypti]
Length=130

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  428
            + Q+ + VS F    Q    Q++ +LV  L  + KL  + D+ VP+EV   ID G+NP  
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKNQVDVNVPLEVFDYIDQGRNPQL  78

Query  429  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +T+D ++  + KN+  KGK D+++  + +L+ E
Sbjct  79   YTKDCIDKALTKNEEVKGKIDSYRKFKSNLMKE  111



>gb|ETN67202.1| RNA polymerase II mediator complex subunit 10 [Anopheles darlingi]
Length=130

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  428
            + Q+ + VS F    Q    Q++ +LV  L  + KL  + D+ VP+EV   ID G+NP  
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVTGLQEIDKLKTQIDVNVPLEVFDYIDQGRNPQL  78

Query  429  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +T+D ++  + KN+  KGK D+++  + +L+ E
Sbjct  79   YTKDCIDKALTKNEEVKGKIDSYRKFKSNLMKE  111



>ref|XP_007520627.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Erinaceus europaeus]
Length=135

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   IAKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERAIAKNEQVKGKIDTMKKFKSLLIQE  112



>gb|KFH71415.1| hypothetical protein MVEG_01714 [Mortierella verticillata NRRL 
6337]
Length=239

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDE  428
            L +L +TV  F   S     Q++  L+ ++ ++    +K DI VPMEVLS I+DGKNPD 
Sbjct  71   LLELSITVYDFQPESNSLVHQKIQELISQISDIEAFKDKLDIMVPMEVLSFIEDGKNPDL  130

Query  429  FTRDVLNSCIAKNQITKGKTDAFKGLRKHL  518
            FT+  +     +NQ T GK  A K     L
Sbjct  131  FTKSFIECVAGENQFTNGKITAMKSFESSL  160



>ref|XP_010968666.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Camelus bactrianus]
 ref|XP_010970329.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Camelus bactrianus]
Length=135

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 62/110 (56%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP+ +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPELYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_005645629.1| hypothetical protein COCSUDRAFT_8935, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21085.1| hypothetical protein COCSUDRAFT_8935, partial [Coccomyxa subellipsoidea 
C-169]
Length=90

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +3

Query  318  NALVLELDNLAKLAEKCDIQVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAF  497
            N LV EL  L+   E   + VP+E+L  ID+G NPD FT ++ N     NQ+ KGK +AF
Sbjct  1    NGLVAELGGLSSHREALAVDVPVELLRYIDEGGNPDAFTSEIFNRANRSNQLAKGKVEAF  60

Query  498  KGLRKHLLDE  527
               R+ LL E
Sbjct  61   GAFREALLKE  70



>ref|XP_009867898.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Apaloderma vittatum]
 gb|KFP88940.1| Mediator of RNA polymerase II transcription subunit 10 [Apaloderma 
vittatum]
Length=134

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 59/101 (58%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ+   Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQVGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_010984281.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Camelus dromedarius]
Length=159

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 62/110 (56%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  27   EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  86

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP+ +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  87   VPLEVFEYIDQGRNPELYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  136



>gb|KFV94189.1| Mediator of RNA polymerase II transcription subunit 10, partial 
[Eurypyga helias]
Length=129

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 60/107 (56%), Gaps = 1/107 (1%)
 Frame = +3

Query  210  NQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPM  386
            N +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+
Sbjct  1    NSLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPL  60

Query  387  EVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  61   EVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  107



>ref|XP_007898728.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Callorhinchus milii]
Length=135

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 4/102 (4%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N+++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAGLNQKLNSMITGLQDVDKCRQQLHDINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDA---FKGLRKHLL  521
            D G+NP  +T++ L   +AKN+  KGK D    FKGL  H L
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLKKFKGLLIHEL  113



>ref|NP_613062.1| mediator of RNA polymerase II transcription subunit 10 [Mus musculus]
 ref|NP_001099567.2| mediator of RNA polymerase II transcription subunit 10 [Rattus 
norvegicus]
 ref|XP_005065510.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Mesocricetus auratus]
 ref|XP_006227831.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Rattus norvegicus]
 ref|XP_006987848.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Peromyscus maniculatus bairdii]
 ref|XP_007640532.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cricetulus griseus]
 ref|XP_007632054.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cricetulus griseus]
 sp|Q9CXU0.1|MED10_MOUSE RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Mus musculus]
 dbj|BAB29103.1| unnamed protein product [Mus musculus]
 gb|AAH56438.1| Mediator of RNA polymerase II transcription, subunit 10 homolog 
(NUT2, S. cerevisiae) [Mus musculus]
 gb|AAH48638.2| Mediator of RNA polymerase II transcription, subunit 10 homolog 
(NUT2, S. cerevisiae) [Mus musculus]
 gb|EDL87621.1| similar to DNA segment, Chr 13, Wayne State University 50, expressed 
(predicted), isoform CRA_b [Rattus norvegicus]
 gb|ERE82644.1| mediator of RNA polymerase II transcription subunit 10-like protein 
[Cricetulus griseus]
Length=135

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_010194202.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Colius striatus]
 gb|KFP29313.1| Mediator of RNA polymerase II transcription subunit 10 [Colius 
striatus]
Length=134

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNCMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_005356754.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Microtus ochrogaster]
Length=135

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_008832792.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Nannospalax galili]
Length=135

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_006198447.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Vicugna pacos]
Length=137

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 59/101 (58%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYI  73

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP+ +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  74   DQGRNPELYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  114



>ref|XP_007435877.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Python bivittatus]
Length=134

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_969834.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Tribolium castaneum]
 gb|EFA00809.1| hypothetical protein TcasGA2_TC003696 [Tribolium castaneum]
Length=131

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+++ VS F   SQ    Q++ ALV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIHIIVSDFQPQSQNVLNQKLLALVHGLQEVDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   +AKN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCIEKALAKNEQVKGKIDAYRKFKANMLLE  112



>dbj|BAE33733.1| unnamed protein product [Mus musculus]
Length=135

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_010152321.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 10 [Eurypyga helias]
Length=138

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 60/107 (56%), Gaps = 1/107 (1%)
 Frame = +3

Query  210  NQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPM  386
            N +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+
Sbjct  10   NSLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPL  69

Query  387  EVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  70   EVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  116



>ref|NP_001004914.1| mediator of RNA polymerase II transcription subunit 10 [Xenopus 
(Silurana) tropicalis]
 sp|Q6DJ25.1|MED10_XENTR RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Xenopus 
(Silurana) tropicalis]
 gb|AAH75360.1| MGC89063 protein [Xenopus (Silurana) tropicalis]
Length=135

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N LV  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFLVTGLQDIDKCRQQLHDITVPLEVFDYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLKKFKSLLIQE  112



>ref|XP_011242829.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X2 [Mus musculus]
Length=164

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  32   EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDIT  91

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  92   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  141



>ref|XP_001363617.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Monodelphis domestica]
Length=135

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIS  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_006081530.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Myotis lucifugus]
Length=135

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_008948061.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Merops nubicus]
 gb|KFQ17374.1| Mediator of RNA polymerase II transcription subunit 10 [Merops 
nubicus]
Length=134

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 62/110 (56%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +  +++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDSLEENLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDIS  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_003462300.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cavia porcellus]
Length=135

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_004380332.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Trichechus manatus latirostris]
 ref|XP_006901362.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Elephantulus edwardii]
 ref|XP_007951450.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Orycteropus afer afer]
Length=135

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_004274551.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Orcinus orca]
Length=135

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_004625247.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Octodon degus]
 ref|XP_005407122.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chinchilla lanigera]
Length=135

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_001601868.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Nasonia vitripennis]
Length=149

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = +3

Query  198  KQNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDI  374
            ++NL   + S  + + +++   + V+ F   +Q    Q++  +V +L ++ K   E  D+
Sbjct  9    QENLETTLESFIENVRLIN---IMVADFQPQAQTVLNQKIQKIVTDLRDINKFKTEMMDV  65

Query  375  QVPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLL  521
            Q+PMEV   ID G NP  +T+D ++  +AKN+  KGK DA+K  + ++L
Sbjct  66   QIPMEVFEYIDQGYNPQLYTKDCMSKALAKNEEAKGKIDAYKRFKANML  114



>ref|XP_006875023.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chrysochloris asiatica]
Length=135

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_004678110.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Condylura cristata]
Length=135

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +TR+ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPLLYTRECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|NP_115662.2| mediator of RNA polymerase II transcription subunit 10 [Homo 
sapiens]
 ref|NP_001029928.1| mediator of RNA polymerase II transcription subunit 10 [Bos taurus]
 ref|NP_001128985.1| mediator of RNA polymerase II transcription subunit 10 [Pongo 
abelii]
 ref|XP_001143506.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pan troglodytes]
 ref|XP_002745181.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Callithrix jacchus]
 ref|XP_003263266.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 1 [Nomascus leucogenys]
 ref|XP_003808015.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pan paniscus]
 ref|XP_003932559.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Saimiri boliviensis boliviensis]
 ref|XP_004059105.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Gorilla gorilla gorilla]
 ref|XP_004088238.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 2 [Nomascus leucogenys]
 ref|XP_004088239.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 3 [Nomascus leucogenys]
 ref|XP_004416501.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 1 [Odobenus rosmarus divergens]
 ref|XP_004416502.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform 2 [Odobenus rosmarus divergens]
 ref|XP_004440105.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ceratotherium simum simum]
 ref|XP_004468983.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Dasypus novemcinctus]
 ref|XP_004768436.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Mustela putorius furo]
 ref|XP_004812565.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Mustela putorius furo]
 ref|XP_005681588.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X1 [Capra hircus]
 ref|XP_005857955.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Myotis brandtii]
 ref|XP_005899029.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Bos mutus]
 ref|XP_006917205.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pteropus alecto]
 ref|XP_007107895.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Physeter catodon]
 ref|XP_006047772.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Bubalus bubalis]
 ref|XP_007191711.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Balaenoptera acutorostrata scammoni]
 ref|XP_008160026.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Eptesicus fuscus]
 ref|XP_008247056.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Oryctolagus cuniculus]
 ref|XP_008570905.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Galeopterus variegatus]
 ref|XP_010855419.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Bison bison bison]
 sp|Q9BTT4.1|MED10_HUMAN RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10; AltName: 
Full=Transformation-related gene 17 protein; Short=TRG-17; 
AltName: Full=Transformation-related gene 20 protein; Short=TRG-20 
[Homo sapiens]
 sp|Q5R6P5.1|MED10_PONAB RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Pongo abelii]
 sp|Q3ZCF2.1|MED10_BOVIN RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Bos taurus]
 gb|AAH03353.1| Mediator complex subunit 10 [Homo sapiens]
 gb|AAQ18038.1| transformation-related protein 17 [Homo sapiens]
 gb|AAS47514.1| transformation-related protein 20 [Homo sapiens]
 gb|AAT06736.1| L6 [Homo sapiens]
 emb|CAH92565.1| hypothetical protein [Pongo abelii]
 gb|AAI02440.1| Mediator complex subunit 10 [Bos taurus]
 gb|EAX08110.1| hypothetical protein MGC5309 [Homo sapiens]
 gb|ACS13739.1| mediator of RNA polymerase II transcription subunit 10-like protein 
[Homo sapiens]
 tpg|DAA17760.1| TPA: mediator of RNA polymerase II transcription subunit 10 [Bos 
taurus]
 dbj|BAJ21185.1| mediator complex subunit 10 [synthetic construct]
 gb|ELK08158.1| Mediator of RNA polymerase II transcription subunit 10 [Pteropus 
alecto]
 gb|ELR54096.1| Mediator of RNA polymerase II transcription subunit 10 [Bos mutus]
 gb|EPQ02513.1| Mediator of RNA polymerase II transcription subunit 10 [Myotis 
brandtii]
 gb|AIC52532.1| MED10, partial [synthetic construct]
Length=135

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>gb|ETE62868.1| Mediator of RNA polymerase II transcription subunit 10 [Ophiophagus 
hannah]
Length=126

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRK  512
            D G+NP  +T++ L   +AKN+  KGK D  K L K
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKELTK  107



>ref|XP_003134205.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Sus scrofa]
Length=135

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>gb|ENN74364.1| hypothetical protein YQE_09045, partial [Dendroctonus ponderosae]
 gb|ERL90585.1| hypothetical protein D910_07932 [Dendroctonus ponderosae]
Length=128

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = +3

Query  255  QLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDEF  431
            Q+++ VS F+  SQ    Q++ ++V  L  + KL  +  D+ VP+EV   ID G+NP  +
Sbjct  21   QMHIIVSDFHPQSQNALNQKLQSMVHGLQEVDKLKSQFQDVHVPLEVFDYIDQGRNPKLY  80

Query  432  TRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            T++ +   +AKN+  KGK DA++ L+ +L+ E
Sbjct  81   TKNCIEKALAKNEQVKGKIDAYRKLKTNLIVE  112



>ref|XP_006025079.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Alligator sinensis]
 ref|XP_006271187.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Alligator mississippiensis]
Length=134

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|NP_001085232.1| mediator of RNA polymerase II transcription subunit 10 [Xenopus 
laevis]
 sp|Q6IP67.1|MED10_XENLA RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Xenopus 
laevis]
 gb|AAH72051.1| Med10 protein [Xenopus laevis]
Length=135

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N LV  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFLVRGLQDIDKCRQQLHDITVPLEVFDYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLKKFKSLLIQE  112



>ref|NP_001232567.1| putative MGC89063 protein variant 2 [Taeniopygia guttata]
 ref|XP_005041752.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ficedula albicollis]
 ref|XP_005484320.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Zonotrichia albicollis]
 ref|XP_005533567.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pseudopodoces humilis]
 ref|XP_009904865.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Picoides pubescens]
 gb|ACH44028.1| putative MGC89063 protein variant 2 [Taeniopygia guttata]
 gb|KFP86373.1| Mediator of RNA polymerase II transcription subunit 10 [Acanthisitta 
chloris]
 gb|KFR04975.1| Mediator of RNA polymerase II transcription subunit 10 [Nipponia 
nippon]
 gb|KFV72041.1| Mediator of RNA polymerase II transcription subunit 10 [Picoides 
pubescens]
Length=134

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|NP_001247782.1| mediator of RNA polymerase II transcription subunit 10 [Macaca 
mulatta]
 ref|XP_003899530.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Papio anubis]
 ref|XP_007959357.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chlorocebus sabaeus]
 ref|XP_010374320.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Rhinopithecus roxellana]
 gb|EHH26385.1| Mediator complex subunit 10 [Macaca mulatta]
Length=135

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_010295441.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Phaethon lepturus]
Length=136

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  114



>ref|XP_009078838.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Acanthisitta chloris]
 ref|XP_009470338.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Nipponia nippon]
Length=136

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  114



>ref|XP_004894714.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Heterocephalus glaber]
 ref|XP_004845208.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X2 [Heterocephalus glaber]
 gb|EHB09385.1| Mediator of RNA polymerase II transcription subunit 10 [Heterocephalus 
glaber]
Length=137

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_007453559.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Lipotes vexillifer]
Length=135

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  D+ 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDVT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKMDTMKKFKIRLIQE  112



>ref|XP_008489554.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Calypte anna]
 ref|XP_009978222.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Tauraco erythrolophus]
 gb|KFO70712.1| Mediator of RNA polymerase II transcription subunit 10 [Cuculus 
canorus]
 gb|KFO98974.1| Mediator of RNA polymerase II transcription subunit 10 [Calypte 
anna]
 gb|KFQ39898.1| Mediator of RNA polymerase II transcription subunit 10 [Mesitornis 
unicolor]
 gb|KFV04415.1| Mediator of RNA polymerase II transcription subunit 10 [Tauraco 
erythrolophus]
 gb|KFV39953.1| Mediator of RNA polymerase II transcription subunit 10 [Gavia 
stellata]
 gb|KFV99228.1| Mediator of RNA polymerase II transcription subunit 10 [Fulmarus 
glacialis]
 gb|KGL82127.1| Mediator of RNA polymerase II transcription subunit 10 [Tinamus 
guttatus]
 gb|KGL92269.1| Mediator of RNA polymerase II transcription subunit 10 [Charadrius 
vociferus]
Length=134

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_010569720.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Haliaeetus leucocephalus]
Length=136

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  114



>gb|KFQ70639.1| Mediator of RNA polymerase II transcription subunit 10, partial 
[Phaethon lepturus]
Length=133

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_009568584.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cuculus canorus]
 ref|XP_009586152.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Fulmarus glacialis]
 ref|XP_009814748.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Gavia stellata]
 ref|XP_009882064.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Charadrius vociferus]
 ref|XP_010189208.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Mesitornis unicolor]
 ref|XP_010219982.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Tinamus guttatus]
 ref|XP_003204894.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Meleagris gallopavo]
Length=136

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  114



>ref|XP_006001826.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Latimeria chalumnae]
Length=135

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_004597953.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ochotona princeps]
Length=135

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_006171581.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Tupaia chinensis]
 gb|ELV09425.1| Mediator of RNA polymerase II transcription subunit 10 [Tupaia 
chinensis]
Length=135

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQANLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>gb|ENN78401.1| hypothetical protein YQE_05201, partial [Dendroctonus ponderosae]
 gb|ERL93280.1| hypothetical protein D910_10576 [Dendroctonus ponderosae]
Length=136

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F   SQ    Q++ A+V  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQMDIIVSDFQPQSQNVLNQKLQAMVHGLQEIDKLKTQVQDVHVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   +AKN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCIEKALAKNEQVKGKIDAYRKFKANMLVE  112



>ref|XP_004935190.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X3 [Gallus gallus]
Length=157

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  26   EKFDSLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDIS  85

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  86   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  135



>ref|XP_005102640.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like isoform X1 [Aplysia californica]
Length=135

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = +3

Query  252  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDE  428
             Q+ + VS F    Q    Q++  +V EL+ + KL  +  D+QVP+EV   ID G+NP  
Sbjct  20   RQMGIIVSDFQPQGQNVLNQKIQTMVTELNEIDKLRTQIQDVQVPLEVFDYIDQGRNPSL  79

Query  429  FTRDVLNSCIAKNQITKGKTDAFK  500
            +T+D L   +AKN+  KGKTD+ K
Sbjct  80   YTKDCLEKALAKNEQVKGKTDSLK  103



>ref|XP_003800937.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Otolemur garnettii]
Length=135

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVSGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>gb|KFW71686.1| Mediator of RNA polymerase II transcription subunit 10 [Pygoscelis 
adeliae]
Length=134

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIFVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_002594058.1| hypothetical protein BRAFLDRAFT_118806 [Branchiostoma floridae]
 gb|EEN50069.1| hypothetical protein BRAFLDRAFT_118806 [Branchiostoma floridae]
Length=136

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            + L Q+   +++ +    Q+ + VS F    Q    Q+++A++  +  + +   +  D+Q
Sbjct  3    EKLEQLEQHLEQFIENTRQMGIIVSDFQPQGQPVLNQKIHAMITGMQEIDRCKSQLQDVQ  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLL  521
            VP+EV   ID G+NP  +T+D +   +AKN+  KGK DA K  R  L+
Sbjct  63   VPLEVFEYIDQGRNPQLYTKDCMEKSLAKNEQVKGKIDALKKFRSQLI  110



>ref|XP_005427987.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Geospiza fortis]
Length=134

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFPPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_006635939.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Lepisosteus oculatus]
Length=134

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMITGLQDIDKCRQQLHDINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>gb|KFQ66578.1| Mediator of RNA polymerase II transcription subunit 10, partial 
[Pelecanus crispus]
Length=115

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 1/93 (1%)
 Frame = +3

Query  252  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDE  428
             QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   ID G+NP  
Sbjct  1    RQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYIDQGRNPQL  60

Query  429  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  61   YTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  93



>ref|XP_002424879.1| nut2, putative [Pediculus humanus corporis]
 gb|EEB12141.1| nut2, putative [Pediculus humanus corporis]
Length=149

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++ +LV  L  + KL  +  ++ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVHGLQEIDKLKSQVQEVHVPLEVFEYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK DA++  + HLL E
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKAHLLVE  112



>ref|XP_009328746.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pygoscelis adeliae]
Length=136

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIFVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  114



>gb|KFO14882.1| Mediator of RNA polymerase II transcription subunit 10 [Balearica 
regulorum gibbericeps]
Length=134

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFPPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_010308856.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Balearica regulorum gibbericeps]
Length=136

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  14   LEKFVENIRQLGIIVSDFPPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  73

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  74   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  114



>ref|XP_004698165.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Echinops telfairi]
Length=135

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  +GK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVRGKMDTMKKFKSLLIQE  112



>ref|XP_009489761.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10, partial [Pelecanus crispus]
Length=115

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = +3

Query  255  QLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDEF  431
            QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   ID G+NP  +
Sbjct  1    QLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYIDQGRNPQLY  60

Query  432  TRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  61   TKECLERALAKNEQVKGKIDTMKKFKSLLIQE  92



>ref|XP_419024.4| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X2 [Gallus gallus]
Length=207

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  76   EKFDSLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDIS  135

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  136  VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  185



>ref|XP_005959297.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Pantholops hodgsonii]
Length=135

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q+ N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKXNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_003408084.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Loxodonta africana]
Length=135

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIM  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K     L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKXXXXXLIQE  112



>ref|XP_005294660.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chrysemys picta bellii]
 ref|XP_008171223.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Chrysemys picta bellii]
Length=267

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  136  EKFDSLEEQLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDIS  195

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  196  VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  245



>ref|XP_006001827.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X2 [Latimeria chalumnae]
Length=109

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMVTGLQDIDKCRQQLHDINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGL  506
            D G+NP  +T++ L   +AKN+  KGK D  K L
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKRL  105



>gb|KIH45973.1| mediator of RNA polymerase II transcription subunit 10 family 
protein [Ancylostoma duodenale]
Length=150

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +3

Query  207  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEK-CDIQVP  383
             NQ+  ++++       L +  + F A SQ PF Q+++ LV  L  L ++  +  D++VP
Sbjct  22   FNQLERTLEQFQENARHLGVIATDFGARSQEPFNQKIHTLVSGLQELDQMRNQFADVKVP  81

Query  384  MEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +E+L ++D GKNP  +T++VL   + KN+   GK + +K     LL E
Sbjct  82   LELLDVLDQGKNPQLYTKEVLERTLQKNKEVNGKVETYKKFHAALLKE  129



>ref|XP_001600793.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Nasonia vitripennis]
Length=131

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++  LV  L  + KL A+  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVTGLQEIDKLKAQVQDVHVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D ++  + KN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCIDKALTKNEQVKGKIDAYRKFKANMLVE  112



>ref|NP_001271609.1| mediator of RNA polymerase II transcription subunit 10 [Macaca 
fascicularis]
 sp|Q4R6W4.1|MED10_MACFA RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10 [Macaca fascicularis]
 dbj|BAE01160.1| unnamed protein product [Macaca fascicularis]
Length=135

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLL  521
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K  +  L+
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLI  110



>ref|XP_003223649.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Anolis carolinensis]
Length=134

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 58/101 (57%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  +I VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHEISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_011285416.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Felis catus]
Length=135

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q+ N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKXNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  +T++ L   +A+N+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALARNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_005873843.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Myotis brandtii]
 gb|EPQ12386.1| Mediator of RNA polymerase II transcription subunit 10 [Myotis 
brandtii]
Length=142

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 59/104 (57%), Gaps = 4/104 (4%)
 Frame = +3

Query  207  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVP  383
            L+ +   ++K +  + QL +  S F  +SQ    Q++N +V  L ++ K  ++  DI VP
Sbjct  5    LDHLEEHLEKFVENIRQLSIIASDFQPSSQAGLNQKLNLIVTGLQDIDKCRQQLHDITVP  64

Query  384  MEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDA---FKGL  506
            +EV   ID G+NP  +T++ L   +AKN+  KGK D    FKGL
Sbjct  65   LEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKMDTMKKFKGL  108



>ref|XP_003342237.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Monodelphis domestica]
Length=107

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  500
            D G+NP  +T++ L   +AKN+  KGK D  K
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMK  103



>ref|XP_004270303.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Orcinus orca]
Length=135

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  + ++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYNKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>ref|XP_007067402.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10, partial [Chelonia mydas]
Length=103

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  500
            D G+NP  +T++ L   +AKN+  KGK D  K
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMK  103



>emb|CDJ97162.1| Mediator complex domain containing protein [Haemonchus contortus]
Length=150

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +3

Query  207  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKL-AEKCDIQVP  383
             NQ+  ++++       L +  + F A SQ PF Q+++ L+  L  L ++ ++  D++VP
Sbjct  22   FNQLERTLEQFQENARHLGVIATDFGARSQEPFNQKIHTLISGLQELDQMRSQFMDVKVP  81

Query  384  MEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +E+L ++D GKNP  +T++VL   + KN+   GK + +K     LL E
Sbjct  82   LELLDVLDQGKNPQLYTKEVLERTLQKNKEVNGKVETYKKFHAALLKE  129



>ref|XP_002412765.1| nut2, putative [Ixodes scapularis]
 gb|EEC16061.1| nut2, putative [Ixodes scapularis]
Length=135

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 54/98 (55%), Gaps = 9/98 (9%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-----DIQVPMEVLSLIDDG  413
            + QL + VS F    Q    Q++N +V     L +  +KC     DIQVP+EV   ID G
Sbjct  19   VRQLGIIVSDFQPQGQTTLNQKINHIV----TLMQEVDKCKPQVQDIQVPLEVFDYIDQG  74

Query  414  KNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +NP  FT+D +   +AKN+  KGK ++++  +  LL E
Sbjct  75   RNPQLFTKDCMEKALAKNEQVKGKIESYRRFKALLLLE  112



>sp|Q0VIA1.1|MED10_DANRE RecName: Full=Mediator of RNA polymerase II transcription subunit 
10; AltName: Full=Mediator complex subunit 10; AltName: 
Full=Protein tennis match [Danio rerio]
 gb|AAW56465.1| Med10 [Danio rerio]
Length=134

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMITGLQDIEKCRQQLHDINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLTKFKSLLISE  112



>gb|KIH63536.1| mediator of RNA polymerase II transcription subunit 10 family 
protein [Ancylostoma duodenale]
Length=120

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +3

Query  258  LYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEK-CDIQVPMEVLSLIDDGKNPDEFT  434
            L +  + F A SQ PF Q+++ LV  L  L ++  +  D++VP+E+L ++D GKNP  +T
Sbjct  9    LGVIATDFGARSQEPFNQKIHTLVSGLQELDQMRNQFADVKVPLELLDVLDQGKNPQLYT  68

Query  435  RDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            ++VL   + KN+   GK + +K     LL E
Sbjct  69   KEVLERTLQKNKEVNGKVETYKKFHAALLKE  99



>ref|NP_001017699.1| mediator of RNA polymerase II transcription subunit 10 [Danio 
rerio]
 gb|AAH93274.1| Mediator of RNA polymerase II transcription, subunit 10 homolog 
[Danio rerio]
Length=134

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFVITGLQDIEKCRQQLHDINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTLTKFKSLLISE  112



>ref|XP_002112039.1| hypothetical protein TRIADDRAFT_24417 [Trichoplax adhaerens]
 gb|EDV26006.1| hypothetical protein TRIADDRAFT_24417 [Trichoplax adhaerens]
Length=137

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = +3

Query  252  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKCD-IQVPMEVLSLIDDGKNPDE  428
             Q+ +  S F A SQ     ++  L+  L  +  + EK D I+VP+EV S ID+G+NP+ 
Sbjct  26   RQVGIIASDFQATSQKVLNDKLRGLITNLREINDMKEKFDDIEVPLEVFSYIDEGRNPEL  85

Query  429  FTRDVLNSCIAKNQITKGKTDAFKGLRKHLLD  524
            +T+  L+  +  NQ  KGK DA+K  +  L +
Sbjct  86   YTKACLDKVVMMNQEMKGKVDAYKNFKTTLCE  117



>ref|XP_003737748.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Metaseiulus occidentalis]
Length=148

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 61/108 (56%), Gaps = 1/108 (1%)
 Frame = +3

Query  207  LNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVP  383
            L Q+ +S++  +  + QL + V+ F    Q    Q++  LV  + +++ +     DIQVP
Sbjct  9    LQQLEASLELFIENVRQLGIVVADFQPQGQPALNQKITTLVSLMQDISAVRPHVEDIQVP  68

Query  384  MEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            +EV   ID+ +NP  +T+D +   +AKN+  KGK DA++  +  LL E
Sbjct  69   LEVCDYIDEARNPQLYTKDCMEKALAKNEQVKGKIDAYRRFKALLLVE  116



>ref|XP_008543284.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Microplitis demolitor]
Length=131

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++ +LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQSLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK DA++  + +LL E
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANLLVE  112



>ref|XP_006517338.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Mus musculus]
Length=183

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   I
Sbjct  41   LEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYI  100

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  500
            D G+NP  +T++ L   +AKN+  KGK D  K
Sbjct  101  DQGRNPQLYTKECLERALAKNEQVKGKIDTMK  132



>gb|KFM58995.1| Mediator of RNA polymerase II transcription subunit 10, partial 
[Stegodyphus mimosarum]
Length=134

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + QL + VS F    Q    Q++  +V  +  + K   +  DIQVP+EV   ID G+NP 
Sbjct  19   VRQLGIIVSDFQPQGQTILNQKIAQMVTYMQEIDKCKNQVQDIQVPLEVFEYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN++ KGK D+++  +  LL E
Sbjct  79   LYTKDCMEKALNKNEVVKGKIDSYRRFKSLLLVE  112



>ref|XP_004845207.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Heterocephalus glaber]
Length=138

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + VS F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK  500
            VP+EV   ID G+NP  +T++ L   +AKN+  KGK D  K
Sbjct  63   VPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMK  103



>ref|NP_001188215.1| mediator of RNA polymerase II transcription subunit 10 [Ictalurus 
punctatus]
 gb|ADO29276.1| mediator of RNA polymerase II transcription subunit 10 [Ictalurus 
punctatus]
Length=134

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+E    I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQTGLNQKLNLMITGLQDIEKCRQQLNDIHVPLEAFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMTKFKSLLISE  112



>ref|XP_011141422.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Harpegnathos saltator]
 gb|EFN83182.1| Mediator of RNA polymerase II transcription subunit 10 [Harpegnathos 
saltator]
Length=131

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVSGLQEVDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVE  112



>ref|XP_003397402.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Bombus terrestris]
 ref|XP_003485779.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Bombus impatiens]
Length=131

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVE  112



>gb|EFZ10240.1| hypothetical protein SINV_14848 [Solenopsis invicta]
Length=133

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  21   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  80

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK DA++  + ++L E
Sbjct  81   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVE  114



>ref|XP_624779.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Apis mellifera]
 ref|XP_006607903.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Apis dorsata]
Length=131

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVE  112



>ref|XP_011171735.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Solenopsis invicta]
 ref|XP_011255299.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Camponotus floridanus]
 ref|XP_011349932.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cerapachys biroi]
 gb|EFN68975.1| Mediator of RNA polymerase II transcription subunit 10 [Camponotus 
floridanus]
 gb|EZA47377.1| Mediator of RNA polymerase II transcription subunit [Cerapachys 
biroi]
Length=131

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVE  112



>ref|XP_011050147.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Acromyrmex echinatior]
 gb|EGI68057.1| Mediator of RNA polymerase II transcription subunit 10 [Acromyrmex 
echinatior]
Length=131

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVHVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVE  112



>ref|XP_005188303.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Musca domestica]
Length=132

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  DI VP EV   ID  KNP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVSGLQEINKLKNQVQDIYVPFEVFDYIDQDKNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   +AKN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCVEKALAKNEEVKGKIDAYRKFKSNMLAE  112



>gb|KHJ40733.1| hypothetical protein D918_09175 [Trichuris suis]
Length=213

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 61/109 (56%), Gaps = 4/109 (4%)
 Frame = +3

Query  204  NLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNL-AKLAEKCDIQV  380
            NL Q   S++  +    QL +  S F A+SQ    Q++ A+   L +L +K ++  D++V
Sbjct  86   NLEQ---SLEALIENTRQLCMVASDFQASSQSVLNQKLQAITSGLQDLDSKKSKFHDVKV  142

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            P+E+L  +D GKNP  +TRD +   +AKN+    K D +K  R  LL E
Sbjct  143  PIELLEYVDSGKNPQLYTRDCIERTVAKNKELNSKIDQYKKFRCMLLSE  191



>ref|XP_004315303.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Tursiops truncatus]
Length=135

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 59/110 (54%), Gaps = 1/110 (1%)
 Frame = +3

Query  201  QNLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQ  377
            +  + +   ++K +  + QL + V  F  +SQ    Q++N +V  L ++ K  ++  DI 
Sbjct  3    EKFDHLEEHLEKFVENIRQLGIIVRDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDIT  62

Query  378  VPMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            VP+EV   ID G+NP  + ++ L   +AKN+  KGK D  K  +  L+ E
Sbjct  63   VPLEVFEYIDQGRNPQLYNKECLERALAKNEQVKGKIDTMKKFKSLLIQE  112



>gb|KFD52471.1| hypothetical protein M513_06668 [Trichuris suis]
 gb|KFD68995.1| hypothetical protein M514_06668 [Trichuris suis]
Length=223

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 61/109 (56%), Gaps = 4/109 (4%)
 Frame = +3

Query  204  NLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNL-AKLAEKCDIQV  380
            NL Q   S++  +    QL +  S F A+SQ    Q++ A+   L +L +K ++  D++V
Sbjct  96   NLEQ---SLEALIENTRQLCMVASDFQASSQSVLNQKLQAITSGLQDLDSKKSKFHDVKV  152

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            P+E+L  +D GKNP  +TRD +   +AKN+    K D +K  R  LL E
Sbjct  153  PIELLEYVDSGKNPQLYTRDCIERTVAKNKELNSKIDQYKKFRCMLLSE  201



>gb|ETN84836.1| hypothetical protein NECAME_06640 [Necator americanus]
Length=234

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +3

Query  258  LYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEK-CDIQVPMEVLSLIDDGKNPDEFT  434
            L +  + F A SQ PF Q+++ LV  L  L ++  +  D++VP+E+L ++D GKNP  +T
Sbjct  123  LGVIATDFGARSQEPFNQKIHTLVSGLQELDQMRNQFADVKVPLELLDVLDQGKNPQLYT  182

Query  435  RDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            ++VL   + KN+   GK + +K     LL E
Sbjct  183  KEVLERTLQKNKEVNGKVETYKKFHAALLKE  213



>ref|XP_005809155.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Xiphophorus maculatus]
Length=134

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAVLNQKLNFMISGLQDIDKCQKQLHDINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISE  112



>ref|XP_009058257.1| hypothetical protein LOTGIDRAFT_233490 [Lottia gigantea]
 gb|ESO90986.1| hypothetical protein LOTGIDRAFT_233490 [Lottia gigantea]
Length=134

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = +3

Query  252  HQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDE  428
             QL + VS F    Q    Q++N +V E+  + K      D+ VP+EV + ID+GKNP+ 
Sbjct  20   RQLGIIVSDFQPQGQNVLNQKINTMVTEMQEIEKFRPLLQDVHVPLEVFNYIDEGKNPNL  79

Query  429  FTRDVLNSCIAKNQITKGKTD---AFKGL  506
            +T+D L   + KN+  KGK D    FKGL
Sbjct  80   YTKDCLEKALDKNENVKGKMDNLKRFKGL  108



>ref|XP_007563794.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Poecilia formosa]
 ref|XP_008419649.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Poecilia reticulata]
Length=134

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAVLNQKLNFMISGLQDIDKCQKQLHDINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISE  112



>ref|XP_007231771.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Astyanax mexicanus]
Length=134

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 56/101 (55%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + Q+ + VS F  +SQ    Q++N ++  L ++ K  ++  DI VP+E    I
Sbjct  12   LEKFIENIRQMGIIVSDFQPSSQTGLNQKLNFMITGLQDVEKCRQQLNDIHVPLEAFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMTKFKSLLITE  112



>ref|XP_001511205.2| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Ornithorhynchus anatinus]
Length=161

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = +3

Query  264  LTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPDEFTRD  440
            L +S F  +SQ    Q++N +V  L ++ K  ++  DI VP+EV   ID G+NP  +T++
Sbjct  50   LLLSDFQPSSQAGLNQKLNFMVTGLQDIDKCRQQLHDISVPLEVFEYIDQGRNPQLYTKE  109

Query  441  VLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             L   +AKN+  KGK D  K  +  L+ E
Sbjct  110  CLERALAKNEQVKGKIDTMKKFKSLLIQE  138



>ref|XP_010733995.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X1 [Larimichthys crocea]
 ref|XP_010733996.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 isoform X2 [Larimichthys crocea]
Length=134

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAGLNQKLNFMISGLQDIEKCRQQLHEINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISE  112



>ref|XP_008302435.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Stegastes partitus]
Length=134

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAGLNQKLNFMISGLQDIEKCRQQLHEINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISE  112



>ref|XP_003707557.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Megachile rotundata]
Length=131

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  LHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLIDDGKNPD  425
            + Q+ + VS F    Q    Q++  LV  L  + KL  +  D+ VP+EV   ID G+NP 
Sbjct  19   VRQIRIIVSDFQPQGQNVLNQKIQGLVNGLQEIDKLKSQVQDVLVPLEVFDYIDQGRNPQ  78

Query  426  EFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
             +T+D +   + KN+  KGK DA++  + ++L E
Sbjct  79   LYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVE  112



>emb|CDW52045.1| UPF0203 and Med10 domain containing protein [Trichuris trichiura]
Length=242

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 61/109 (56%), Gaps = 4/109 (4%)
 Frame = +3

Query  204  NLNQVISSIQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNL-AKLAEKCDIQV  380
            NL Q   S++  +    QL +  S F A+SQ    Q++ A+   L +L +K ++  D++V
Sbjct  115  NLEQ---SLEALIENTRQLCMVASDFQASSQSVLNQKLQAITNGLQDLDSKKSKFHDVKV  171

Query  381  PMEVLSLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            P+E+L  +D GKNP  +TRD +   +AKN+    K D +K  R  LL E
Sbjct  172  PIELLEYVDSGKNPQLYTRDCIERTVAKNKELNSKIDQYKKFRCMLLSE  220



>gb|ACQ57947.1| Mediator of RNA polymerase II transcription subunit 10 [Anoplopoma 
fimbria]
Length=134

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQTGLNQKLNFMISGLQDIEKCRQQLHEINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISE  112



>ref|XP_008329460.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10 [Cynoglossus semilaevis]
Length=137

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+EV   I
Sbjct  15   LEKFIENIRQLGIIVSDFQPSSQTGLNQKLNFMISGLQDIEKCRQQLHEINVPLEVFEYI  74

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ E
Sbjct  75   DQGRNPQLYTKECLERALARNEQVKGKIDTMTKFKSLLISE  115



>ref|XP_003443822.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Oreochromis niloticus]
 ref|XP_004563717.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Maylandia zebra]
 ref|XP_005745529.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Pundamilia nyererei]
 ref|XP_005937339.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Haplochromis burtoni]
 ref|XP_006806718.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
10-like [Neolamprologus brichardi]
Length=134

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+EV   I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQAGLNQKLNFMISGLQDIEKCRQQLHEINVPLEVFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +A+N+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALARNEQVKGKIDTLTKFKSLLVSE  112



>gb|ACM09055.1| Mediator of RNA polymerase II transcription subunit 10 [Salmo 
salar]
Length=134

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 56/101 (55%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + Q+ + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+E    I
Sbjct  12   LEKFVENIRQMGIIVSDFQPSSQTGLNQKLNYMITGLQDIEKCRQQLHEINVPLEAFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMTKFKSPLISE  112



>gb|ACO08870.1| RNA polymerase II mediator complex subunit 10 [Osmerus mordax]
Length=134

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 56/101 (55%), Gaps = 1/101 (1%)
 Frame = +3

Query  228  IQKTLGMLHQLYLTVSSFNAASQLPFLQRMNALVLELDNLAKLAEKC-DIQVPMEVLSLI  404
            ++K +  + QL + VS F  +SQ    Q++N ++  L ++ K  ++  +I VP+E    I
Sbjct  12   LEKFIENIRQLGIIVSDFQPSSQTGLNQKLNFMITGLQDIEKCRQQLHEINVPLEAFEYI  71

Query  405  DDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRKHLLDE  527
            D G+NP  +T++ L   +AKN+  KGK D     +  L+ E
Sbjct  72   DQGRNPQLYTKECLERALAKNEQVKGKIDTMTKFKSLLISE  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400