BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005J09

Length=445
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07384.1|  unnamed protein product                                128   2e-50   Coffea canephora [robusta coffee]
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     127   2e-49   
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                125   1e-48   Erythranthe guttata [common monkey flower]
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     125   2e-47   Nicotiana tomentosiformis
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     125   3e-47   Nicotiana sylvestris
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     125   7e-47   Solanum tuberosum [potatoes]
ref|XP_009596271.1|  PREDICTED: endoplasmin homolog                     125   7e-47   Nicotiana tomentosiformis
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     125   9e-47   Solanum lycopersicum
dbj|BAL42332.1|  Heat shock protein 90                                  125   9e-47   Nicotiana tabacum [American tobacco]
ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     125   9e-47   Nicotiana sylvestris
dbj|BAL42333.1|  Heat shock protein 90                                  125   1e-46   Nicotiana tabacum [American tobacco]
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         124   1e-44   Jatropha curcas
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     127   1e-44   Sesamum indicum [beniseed]
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          127   2e-44   Cicer arietinum [garbanzo]
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          127   3e-44   Cicer arietinum [garbanzo]
gb|KDO84887.1|  hypothetical protein CISIN_1g003458mg                   123   5e-44   Citrus sinensis [apfelsine]
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     118   5e-44   
ref|XP_010109992.1|  Endoplasmin-like protein                           125   6e-44   
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   124   7e-44   Citrus sinensis [apfelsine]
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             124   1e-43   Citrus clementina [clementine]
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     124   1e-43   Citrus sinensis [apfelsine]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   124   1e-43   Citrus sinensis [apfelsine]
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             124   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_003589505.1|  Endoplasmin-like protein                           125   1e-43   Medicago truncatula
gb|KDO84888.1|  hypothetical protein CISIN_1g003458mg                   124   1e-43   Citrus sinensis [apfelsine]
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     124   1e-43   Populus euphratica
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     118   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    118   2e-43   
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     124   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510550.1|  endoplasmin, putative                              120   3e-43   Ricinus communis
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          125   5e-43   
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          125   5e-43   Glycine max [soybeans]
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     125   6e-43   Nelumbo nucifera [Indian lotus]
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          124   8e-43   Glycine max [soybeans]
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          124   8e-43   Glycine max [soybeans]
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     116   1e-42   Fragaria vesca subsp. vesca
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     122   3e-42   Nelumbo nucifera [Indian lotus]
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             119   5e-42   Prunus persica
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     122   6e-42   Eucalyptus grandis [rose gum]
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     119   7e-42   Prunus mume [ume]
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     122   9e-42   Elaeis guineensis
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             125   1e-41   Phaseolus vulgaris [French bean]
gb|AIZ68158.1|  heat shock protein 90                                   122   2e-41   Ornithogalum longebracteatum [sea-onion]
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     122   3e-41   Cucumis melo [Oriental melon]
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     120   4e-41   Elaeis guineensis
gb|EPS69355.1|  hypothetical protein M569_05408                         121   9e-41   Genlisea aurea
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     121   3e-40   Phoenix dactylifera
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     117   5e-39   Phoenix dactylifera
ref|NP_194150.1|  HSP90-like protein GRP94                              126   8e-39   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94659.1|  HSP90-like protein                                     126   8e-39   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB86368.1|  SHEPHERD                                               126   9e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             126   9e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             126   1e-38   Capsella rubella
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     126   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     126   1e-38   Camelina sativa [gold-of-pleasure]
gb|AAX19870.1|  unknown                                                 122   2e-38   Doryanthes excelsa
ref|NP_974606.1|  HSP90-like protein GRP94                              126   4e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDY10992.1|  BnaA03g46510D                                          122   7e-38   Brassica napus [oilseed rape]
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             122   9e-38   Eutrema salsugineum [saltwater cress]
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    125   2e-37   Arabis alpina [alpine rockcress]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     124   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          124   2e-37   Amborella trichopoda
gb|KJB14398.1|  hypothetical protein B456_002G122800                    119   2e-37   Gossypium raimondii
gb|KJB14397.1|  hypothetical protein B456_002G122800                    119   3e-37   Gossypium raimondii
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   108   3e-37   Gossypium raimondii
emb|CDY24830.1|  BnaA08g14800D                                          120   3e-37   Brassica napus [oilseed rape]
emb|CDY03477.1|  BnaC01g16050D                                          123   3e-37   
emb|CDY34264.1|  BnaA01g13670D                                          123   3e-37   Brassica napus [oilseed rape]
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     123   5e-37   Brassica rapa
emb|CDY08910.1|  BnaC08g11400D                                          119   6e-37   Brassica napus [oilseed rape]
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     105   1e-36   Cucumis sativus [cucumbers]
gb|KHG17445.1|  Endoplasmin                                             119   1e-36   Gossypium arboreum [tree cotton]
gb|KJB63271.1|  hypothetical protein B456_010G0030002                   108   2e-36   Gossypium raimondii
emb|CDX92620.1|  BnaC07g38780D                                          122   2e-36   
gb|KJB63272.1|  hypothetical protein B456_010G0030002                   108   2e-36   Gossypium raimondii
gb|KJB63270.1|  hypothetical protein B456_010G0030002                   108   2e-36   Gossypium raimondii
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     120   4e-36   Brachypodium distachyon [annual false brome]
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    105   8e-36   
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    105   9e-36   
tpg|DAA46734.1|  TPA: hypothetical protein ZEAMMB73_851694              121   3e-35   
gb|AFW81541.1|  hypothetical protein ZEAMMB73_624427                    119   3e-35   
tpg|DAA46735.1|  TPA: hypothetical protein ZEAMMB73_851694              121   5e-35   
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    105   2e-32   
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   108   6e-32   Gossypium raimondii
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     129   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_008660989.1|  PREDICTED: endoplasmin homolog                     121   5e-31   
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     126   2e-30   Vitis vinifera
emb|CAN79404.1|  hypothetical protein VITISV_028074                     126   3e-30   Vitis vinifera
gb|KHN44921.1|  Endoplasmin like                                        100   5e-30   Glycine soja [wild soybean]
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                125   5e-30   Erythranthe guttata [common monkey flower]
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     125   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW75766.1|  hypothetical protein ZEAMMB73_790349                    123   1e-29   
gb|AFW75767.1|  endoplasmin                                             124   1e-29   
gb|AAN34791.1|  Grp94                                                   124   1e-29   Xerophyta viscosa
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               124   2e-29   
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     124   2e-29   Setaria italica
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    124   2e-29   
ref|NP_001151475.1|  endoplasmin precursor                              124   2e-29   Zea mays [maize]
ref|XP_008646956.1|  PREDICTED: endoplasmin homolog                     117   2e-29   
ref|NP_001058590.1|  Os06g0716700                                       123   3e-29   
gb|AAL79732.1|AC091774_23  heat shock protein 90                        123   3e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02369.1|  hypothetical protein OsI_24473                          123   3e-29   Oryza sativa Indica Group [Indian rice]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          123   3e-29   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA90487.1|  heat shock protein 90                                  123   3e-29   Oryza sativa [red rice]
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          122   3e-29   
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     122   4e-29   Oryza brachyantha
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    122   6e-29   Catharanthus roseus [chatas]
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     122   6e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|ABV21762.1|  GRP94                                                   120   4e-28   Pinus taeda
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    119   4e-28   Hordeum vulgare [barley]
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             114   5e-28   Selaginella moellendorffii
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             114   5e-28   Selaginella moellendorffii
gb|EMS56078.1|  Endoplasmin-like protein                                119   5e-28   Triticum urartu
gb|ABV82432.1|  Hsp90-like protein                                      119   9e-28   Dactylis glomerata [cocksfoot]
gb|EMT19498.1|  Endoplasmin-like protein                                119   1e-27   
ref|XP_001770511.1|  predicted protein                                  115   1e-26   
ref|XP_001701885.1|  heat shock protein 90B                             110   7e-25   Chlamydomonas reinhardtii
ref|XP_002949693.1|  hypothetical protein VOLCADRAFT_80696              110   7e-25   Volvox carteri f. nagariensis
gb|ACR38010.1|  unknown                                               99.0    2e-23   Zea mays [maize]
gb|AFW81490.1|  hypothetical protein ZEAMMB73_031063                  97.4    8e-23   
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum       102   5e-22   Ostreococcus lucimarinus CCE9901
ref|XP_003083767.1|  heat shock protein 90 (ISS)                        102   7e-22   
ref|XP_001753222.1|  predicted protein                                  101   1e-21   
ref|XP_002508627.1|  predicted protein                                  100   2e-21   Micromonas commoda
ref|XP_007512535.1|  predicted protein                                  100   4e-21   Bathycoccus prasinos
emb|CBN74418.1|  Heat shock protein 90                                99.0    8e-21   Ectocarpus siliculosus
ref|XP_003063917.1|  predicted protein                                98.2    2e-20   Micromonas pusilla CCMP1545
ref|XP_004994487.1|  heat shock protein gp96                          97.8    2e-20   Salpingoeca rosetta
gb|AAT97075.1|  tumor rejection antigen-like protein                  91.7    3e-20   Lymnaea stagnalis
gb|EPS70213.1|  hypothetical protein M569_04546                       95.5    4e-20   Genlisea aurea
ref|XP_005823214.1|  hypothetical protein GUITHDRAFT_160160           97.1    4e-20   Guillardia theta CCMP2712
ref|XP_003617951.1|  Heat-shock protein                               96.7    5e-20   Medicago truncatula
gb|EYU43186.1|  hypothetical protein MIMGU_mgv1a001565mg              96.7    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_011402246.1|  Endoplasmin-like protein                         96.7    6e-20   Auxenochlorella protothecoides
ref|XP_005651682.1|  heat shock protein Hsp90                         95.9    9e-20   Coccomyxa subellipsoidea C-169
ref|XP_004293459.1|  PREDICTED: heat shock protein 90-1               95.5    1e-19   Fragaria vesca subsp. vesca
gb|ADY39524.1|  putative heat shock protein gp-96                     90.1    2e-19   Hottentotta judaicus
ref|XP_006914764.1|  PREDICTED: endoplasmin-like                      89.4    2e-19   
ref|XP_011085393.1|  PREDICTED: heat shock protein 83                 95.1    2e-19   Sesamum indicum [beniseed]
dbj|BAG61085.1|  unnamed protein product                              90.1    2e-19   Homo sapiens [man]
gb|AGX25162.1|  heat shock protein                                    92.0    2e-19   Leptinotarsa decemlineata
ref|XP_002157524.1|  PREDICTED: endoplasmin-like                      95.1    2e-19   Hydra vulgaris
ref|XP_002117847.1|  hypothetical protein TRIADDRAFT_64388            94.0    3e-19   Trichoplax adhaerens
ref|XP_006299404.1|  hypothetical protein CARUB_v10015564mg           94.0    4e-19   Capsella rubella
ref|XP_003401925.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin-...  93.6    5e-19   Bombus terrestris [large earth bumblebee]
ref|XP_008229890.1|  PREDICTED: heat shock protein 90-1               94.0    5e-19   Prunus mume [ume]
ref|XP_010457327.1|  PREDICTED: heat shock protein 90-1-like          93.6    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007214966.1|  hypothetical protein PRUPE_ppa001503mg           93.6    6e-19   Prunus persica
ref|XP_010486347.1|  PREDICTED: heat shock protein 90-1-like          93.6    6e-19   Camelina sativa [gold-of-pleasure]
tpg|DAA34121.1|  TPA: endoplasmic reticulum glucose-regulated pro...  89.7    6e-19   Amblyomma variegatum
ref|XP_010464416.1|  PREDICTED: heat shock protein 90-1-like          93.6    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_011048941.1|  PREDICTED: heat shock protein 83 isoform X3      93.6    6e-19   Populus euphratica
ref|XP_011048939.1|  PREDICTED: heat shock protein 83 isoform X2      93.6    6e-19   Populus euphratica
ref|XP_011048938.1|  PREDICTED: heat shock protein 83 isoform X1      93.6    6e-19   Populus euphratica
ref|XP_002321183.2|  hypothetical protein POPTR_0014s16280g           93.2    7e-19   
ref|XP_011494775.1|  PREDICTED: endoplasmin                           93.2    7e-19   Ceratosolen solmsi marchali
ref|XP_006619420.1|  PREDICTED: endoplasmin-like                      93.2    7e-19   Apis dorsata [rock honeybee]
ref|XP_395614.3|  PREDICTED: endoplasmin-like isoform 1               93.2    8e-19   Apis mellifera [bee]
ref|XP_003493872.1|  PREDICTED: endoplasmin-like                      93.2    8e-19   Bombus impatiens
gb|KFK38234.1|  hypothetical protein AALP_AA3G086500                  93.2    8e-19   Arabis alpina [alpine rockcress]
ref|XP_006849050.1|  hypothetical protein AMTR_s00028p00187760        93.2    8e-19   Amborella trichopoda
gb|KJB10747.1|  hypothetical protein B456_001G220600                  92.8    9e-19   Gossypium raimondii
ref|XP_003694125.1|  PREDICTED: endoplasmin-like                      93.2    9e-19   Apis florea [dwarf honeybee]
gb|KJB10746.1|  hypothetical protein B456_001G220600                  93.2    1e-18   Gossypium raimondii
gb|KJB10745.1|  hypothetical protein B456_001G220600                  93.2    1e-18   Gossypium raimondii
ref|XP_003575983.1|  PREDICTED: heat shock protein 83                 92.8    1e-18   Brachypodium distachyon [annual false brome]
ref|XP_010045864.1|  PREDICTED: heat shock protein 83                 92.8    1e-18   Eucalyptus grandis [rose gum]
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain     92.8    1e-18   Ostreococcus tauri
gb|AFM30925.1|  chloroplast heat shock protein 90                     87.4    1e-18   Prunus persica
ref|XP_004243554.1|  PREDICTED: heat shock protein 83                 92.8    1e-18   Solanum lycopersicum
gb|EMS64316.1|  Heat shock protein 83                                 92.4    1e-18   Triticum urartu
dbj|BAK01596.1|  predicted protein                                    92.8    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT31740.1|  Heat shock protein 83                                 92.4    1e-18   
gb|AAH09195.1|  HSP90B1 protein                                       89.7    1e-18   Homo sapiens [man]
ref|XP_002428463.1|  Hsp90 protein, putative                          92.4    1e-18   Pediculus humanus corporis [human body lice]
gb|AIC62039.1|  HSP90B1                                               89.7    1e-18   synthetic construct
ref|XP_007049300.1|  Heat shock protein 89.1 isoform 2                92.4    1e-18   
ref|XP_008464175.1|  PREDICTED: heat shock protein 81-1               92.4    1e-18   Cucumis melo [Oriental melon]
gb|EAW97723.1|  heat shock protein 90kDa beta (Grp94), member 1, ...  90.1    1e-18   Homo sapiens [man]
gb|EGT36283.1|  hypothetical protein CAEBREN_28043                    92.4    2e-18   Caenorhabditis brenneri
gb|KCW88689.1|  hypothetical protein EUGRSUZ_A01044                   92.4    2e-18   Eucalyptus grandis [rose gum]
ref|XP_004140007.1|  PREDICTED: endoplasmin homolog                   92.0    2e-18   Cucumis sativus [cucumbers]
ref|XP_009124159.1|  PREDICTED: heat shock protein 90-1-like isof...  92.0    2e-18   Brassica rapa
emb|CDY22132.1|  BnaC01g39690D                                        92.0    2e-18   Brassica napus [oilseed rape]
ref|XP_004169550.1|  PREDICTED: endoplasmin homolog                   92.0    2e-18   
ref|XP_002531697.1|  heat shock protein, putative                     92.0    2e-18   Ricinus communis
pdb|2ESA|A  Chain A, Grp94 N-Terminal Domain Bound To Geldanamyci...  88.6    2e-18   Canis lupus familiaris [dogs]
ref|XP_009605137.1|  PREDICTED: heat shock protein 83                 92.0    2e-18   Nicotiana tomentosiformis
ref|XP_009124162.1|  PREDICTED: heat shock protein 90-1-like isof...  92.0    2e-18   Brassica rapa
ref|XP_002999135.1|  heat shock protein 90, putative                  92.0    2e-18   Phytophthora infestans T30-4
pdb|1U2O|A  Chain A, Crystal Structure Of The N-Domain Of Grp94 L...  88.6    2e-18   Canis lupus familiaris [dogs]
ref|XP_010657447.1|  PREDICTED: heat shock protein 83 isoform X1      92.0    2e-18   Vitis vinifera
ref|XP_010657448.1|  PREDICTED: heat shock protein 83 isoform X3      92.0    2e-18   Vitis vinifera
ref|XP_002535115.1|  heat shock protein, putative                     88.2    2e-18   Ricinus communis
ref|XP_002270014.3|  PREDICTED: heat shock protein 83 isoform X2      92.0    2e-18   Vitis vinifera
ref|XP_009365237.1|  PREDICTED: heat shock protein 81-1               92.0    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_002413149.1|  tumor rejection antigen (gp96), putative         91.7    3e-18   Ixodes scapularis [blacklegged tick]
gb|KHN43948.1|  Heat shock protein 90                                 91.7    3e-18   Glycine soja [wild soybean]
ref|XP_008788962.1|  PREDICTED: heat shock protein 83-like            91.7    3e-18   Phoenix dactylifera
ref|XP_971540.1|  PREDICTED: endoplasmin                              91.7    3e-18   Tribolium castaneum [rust-red flour beetle]
ref|XP_003519663.1|  PREDICTED: heat shock protein 83-like            91.7    3e-18   Glycine max [soybeans]
ref|XP_002507383.1|  predicted protein                                91.7    3e-18   Micromonas commoda
pdb|4NH9|A  Chain A, Correlation Between Chemotype-dependent Bind...  88.6    3e-18   Homo sapiens [man]
ref|XP_002882549.1|  hypothetical protein ARALYDRAFT_896948           91.7    3e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_006363008.1|  PREDICTED: endoplasmin homolog                   91.7    3e-18   Solanum tuberosum [potatoes]
ref|XP_009418533.1|  PREDICTED: heat shock protein 83-like            91.3    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010091648.1|  Endoplasmin-like protein                         91.3    3e-18   
dbj|BAF01546.1|  heat shock like protein                              88.6    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407799.1|  hypothetical protein EUTSA_v10020096mg           91.3    3e-18   Eutrema salsugineum [saltwater cress]
gb|KGL81577.1|  Endoplasmin                                           87.8    4e-18   Tinamus guttatus
ref|NP_187434.2|  HEAT SHOCK PROTEIN 89.1                             91.3    4e-18   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00175.1|  putative heat shock protein                          91.3    4e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAF13098.1|AC009176_25  putative heat-shock protein                91.3    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004957103.1|  PREDICTED: endoplasmin homolog                   91.3    4e-18   Setaria italica
ref|XP_010684690.1|  PREDICTED: heat shock protein 83-like            91.3    4e-18   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAF63637.1|  glucose-regulated protein 94                         91.3    4e-18   Crassostrea gigas
pdb|1U0Y|A  Chain A, N-Domain Of Grp94, With The Charged Domain, ...  88.2    4e-18   
ref|XP_010665948.1|  PREDICTED: heat shock protein 83                 91.3    4e-18   Beta vulgaris subsp. vulgaris [field beet]
pdb|1QY5|A  Chain A, Crystal Structure Of The N-Domain Of The Er ...  88.2    4e-18   
ref|XP_008379983.1|  PREDICTED: heat shock protein 90-1-like          91.3    4e-18   
ref|XP_011311739.1|  PREDICTED: endoplasmin                           90.9    5e-18   Fopius arisanus
ref|XP_001746031.1|  hypothetical protein                             90.9    5e-18   Monosiga brevicollis MX1
ref|XP_009065664.1|  hypothetical protein LOTGIDRAFT_197084           90.9    5e-18   Lottia gigantea
emb|CAP26348.2|  Protein CBG06014                                     90.9    5e-18   Caenorhabditis briggsae
gb|AFD53629.1|  90 kDa heat shock protein                             85.9    5e-18   Cryptosporidium muris
gb|EKC38233.1|  Endoplasmin                                           91.3    5e-18   Crassostrea gigas
ref|XP_009798975.1|  PREDICTED: heat shock protein 83                 90.9    5e-18   Nicotiana sylvestris
ref|XP_003107918.1|  hypothetical protein CRE_12564                   90.9    5e-18   Caenorhabditis remanei
gb|ADQ86002.1|  90 kDa heat shock protein                             85.5    5e-18   Cryptosporidium muris
gb|ADQ86000.1|  90 kDa heat shock protein                             85.5    5e-18   Cryptosporidium muris
gb|KDO70251.1|  hypothetical protein CISIN_1g0038271mg                89.0    5e-18   Citrus sinensis [apfelsine]
ref|XP_010528013.1|  PREDICTED: heat shock protein 90-1-like isof...  90.9    5e-18   Tarenaya hassleriana [spider flower]
gb|AGZ62517.1|  90 kDa heat shock protein                             85.9    5e-18   Cryptosporidium muris
ref|XP_010528014.1|  PREDICTED: heat shock protein 90-1-like isof...  90.9    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_003089202.1|  hypothetical protein CRE_23240                   90.9    5e-18   Caenorhabditis remanei
gb|ADQ86003.1|  90 kDa heat shock protein                             85.5    5e-18   Cryptosporidium muris
gb|ADQ86001.1|  90 kDa heat shock protein                             85.9    6e-18   Cryptosporidium muris
gb|KDR24512.1|  Endoplasmin                                           90.9    6e-18   Zootermopsis nevadensis
gb|ADQ85999.1|  90 kDa heat shock protein                             85.9    6e-18   Cryptosporidium muris
ref|XP_010219153.1|  PREDICTED: endoplasmin-like                      87.8    6e-18   Tinamus guttatus
ref|XP_002633285.1|  Hypothetical protein CBG06014                    90.9    6e-18   Caenorhabditis briggsae
ref|NP_001255536.1|  Protein ENPL-1, isoform a                        90.9    6e-18   Caenorhabditis elegans [roundworm]
gb|KDP29908.1|  hypothetical protein JCGZ_18477                       90.9    6e-18   Jatropha curcas
gb|AHG52035.1|  90 kDa heat shock protein                             85.9    6e-18   Cryptosporidium andersoni
ref|XP_001702984.1|  heat shock protein 90C                           90.9    6e-18   Chlamydomonas reinhardtii
gb|ABU45371.1|  Hsp90B                                                90.5    7e-18   Blastocladiella emersonii
ref|XP_003617952.1|  Heat-shock protein                               90.5    7e-18   
ref|XP_001599282.1|  PREDICTED: endoplasmin                           90.5    7e-18   Nasonia vitripennis
gb|KDO70248.1|  hypothetical protein CISIN_1g0038271mg                89.0    7e-18   Citrus sinensis [apfelsine]
ref|XP_008559868.1|  PREDICTED: endoplasmin                           90.5    7e-18   Microplitis demolitor
ref|XP_006664594.1|  PREDICTED: heat shock protein 83-like            90.5    7e-18   
gb|KHN71590.1|  Endoplasmin                                           90.5    7e-18   Toxocara canis
gb|EWM27572.1|  heat shock protein 90                                 90.5    7e-18   Nannochloropsis gaditana
ref|XP_008677634.1|  PREDICTED: uncharacterized protein LOC100383...  90.5    7e-18   
gb|AFD53634.1|  90 kDa heat shock protein                             85.5    7e-18   Cryptosporidium andersoni
gb|AHK14392.1|  90 kDa heat shock protein                             85.5    8e-18   Cryptosporidium andersoni
gb|ADQ85998.1|  90 kDa heat shock protein                             85.5    8e-18   Cryptosporidium andersoni
gb|AFW65129.1|  hypothetical protein ZEAMMB73_326674                  90.5    8e-18   
ref|XP_010927990.1|  PREDICTED: heat shock protein 83-like isofor...  90.1    8e-18   
ref|XP_011330408.1|  PREDICTED: endoplasmin                           90.5    8e-18   Ooceraea biroi
gb|AFD53632.1|  90 kDa heat shock protein                             85.5    8e-18   Cryptosporidium andersoni
ref|XP_010547210.1|  PREDICTED: heat shock protein 83-like isofor...  90.1    9e-18   Tarenaya hassleriana [spider flower]
ref|XP_010547208.1|  PREDICTED: heat shock protein 90-1-like isof...  90.1    9e-18   Tarenaya hassleriana [spider flower]
ref|XP_009394558.1|  PREDICTED: heat shock protein 83-like            90.1    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003701264.1|  PREDICTED: endoplasmin-like                      90.1    9e-18   Megachile rotundata
ref|XP_010905224.1|  PREDICTED: heat shock protein 83-like            90.1    9e-18   Elaeis guineensis
ref|XP_010927989.1|  PREDICTED: heat shock protein 83-like isofor...  90.1    9e-18   Elaeis guineensis
ref|XP_008342195.1|  PREDICTED: heat shock protein 90-1-like          90.1    9e-18   Malus domestica [apple tree]
dbj|BAD92771.1|  tumor rejection antigen (gp96) 1 variant             89.7    9e-18   Homo sapiens [man]
ref|XP_006039346.1|  PREDICTED: endoplasmin-like                      87.8    9e-18   
ref|XP_007438500.1|  PREDICTED: endoplasmin                           90.1    1e-17   Python bivittatus
ref|XP_006740281.1|  PREDICTED: endoplasmin isoform X2                90.1    1e-17   Leptonychotes weddellii
gb|AAH81917.1|  Tra1 protein                                          89.7    1e-17   Rattus norvegicus [brown rat]
ref|XP_004675798.1|  PREDICTED: endoplasmin                           90.1    1e-17   
ref|XP_010252714.1|  PREDICTED: heat shock protein 90-1-like          90.1    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_003405348.1|  PREDICTED: endoplasmin                           90.1    1e-17   Loxodonta africana [African bush elephant]
dbj|BAP28370.1|  heat shock protein 90 kDa beta member 1              89.7    1e-17   Canis lupus familiaris [dogs]
ref|XP_010554255.1|  PREDICTED: heat shock protein 90-1               90.1    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_010943850.1|  PREDICTED: heat shock protein 83-like            90.1    1e-17   Elaeis guineensis
ref|XP_007950582.1|  PREDICTED: endoplasmin                           90.1    1e-17   
ref|XP_002288873.1|  heat shock protein                               90.1    1e-17   
gb|ADQ85997.1|  90 kDa heat shock protein                             85.5    1e-17   
gb|EFX71215.1|  hypothetical protein DAPPUDRAFT_309186                90.1    1e-17   
gb|ACS75351.1|  endoplasmin                                           90.1    1e-17   
ref|XP_006657349.1|  PREDICTED: endoplasmin homolog                   90.1    1e-17   
ref|XP_004700402.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin      90.1    1e-17   
gb|EPY74066.1|  endoplasmin precursor                                 89.7    1e-17   
gb|AIZ68156.1|  heat shock protein 83-like protein                    90.1    1e-17   
ref|XP_006871146.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_004373828.1|  PREDICTED: endoplasmin                           89.7    1e-17   
gb|ADQ85996.1|  90 kDa heat shock protein                             85.5    1e-17   
gb|AAK74072.1|  heat shock protein gp96 precursor                     89.7    1e-17   
ref|XP_006888611.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_007527982.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_010629639.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_007454336.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_004053833.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_005322404.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_004446859.1|  PREDICTED: endoplasmin isoform 1                 89.7    1e-17   
ref|XP_006979926.1|  PREDICTED: endoplasmin                           89.7    1e-17   
gb|ELR54024.1|  Endoplasmin                                           89.7    1e-17   
ref|XP_003907109.1|  PREDICTED: endoplasmin                           89.7    1e-17   
emb|CAI64497.1|  tumor rejection antigen (gp96) 1                     89.7    1e-17   
ref|XP_004269495.1|  PREDICTED: endoplasmin                           89.7    1e-17   
emb|CAA62352.1|  protein kinase                                       89.7    1e-17   
ref|XP_009844916.1|  hypothetical protein H257_17728                  88.6    1e-17   
ref|XP_006193753.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_003783342.1|  PREDICTED: endoplasmin-like                      89.7    1e-17   
ref|NP_003290.1|  endoplasmin precursor                               89.7    1e-17   
ref|XP_005984835.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_004006728.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_006141474.1|  PREDICTED: endoplasmin                           89.7    1e-17   
gb|ELK10318.1|  Endoplasmin                                           89.7    1e-17   
gb|KFB42185.1|  AGAP001424-PA-like protein                            89.7    1e-17   
gb|ACG47228.1|  heat shock protein 83                                 89.0    1e-17   
ref|NP_001233416.1|  endoplasmin precursor                            89.7    1e-17   
ref|XP_004602837.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin      89.7    1e-17   
ref|XP_011385167.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_008002644.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|NP_777125.1|  endoplasmin precursor                               89.7    1e-17   
ref|XP_003929672.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_005358282.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_008841379.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|NP_001012197.2|  endoplasmin precursor                            89.7    1e-17   
ref|XP_007096540.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_003269991.2|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|NP_001182453.1|  heat shock protein 90kDa beta (Grp94), membe...  89.7    1e-17   
ref|XP_007109922.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_004418096.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_004446860.1|  PREDICTED: endoplasmin isoform 2                 89.7    1e-17   
gb|EHA99498.1|  Endoplasmin                                           89.7    1e-17   
ref|XP_321706.5|  AGAP001424-PA                                       89.7    1e-17   
gb|AAQ02595.1|  tumor rejection antigen 1gp96                         89.7    1e-17   
ref|XP_002752963.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_006205953.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_007165840.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_004326676.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_011218345.1|  PREDICTED: endoplasmin isoform X2                89.7    1e-17   
gb|EHH21126.1|  hypothetical protein EGK_04124                        89.7    1e-17   
ref|XP_004879102.1|  PREDICTED: endoplasmin                           89.7    1e-17   
gb|EFB13451.1|  hypothetical protein PANDA_003512                     89.7    1e-17   
ref|XP_002915502.1|  PREDICTED: endoplasmin isoform X1                89.7    1e-17   
ref|XP_004414318.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_007619353.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_005068020.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|NP_035761.1|  endoplasmin precursor                               89.7    1e-17   
ref|XP_003505898.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_008062311.1|  PREDICTED: endoplasmin isoform X1                89.7    1e-17   
ref|XP_006084129.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_011061023.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_004743081.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|NP_001127573.1|  endoplasmin precursor                            89.7    1e-17   
gb|EHH66650.1|  hypothetical protein EGM_03684                        89.7    1e-17   
ref|XP_008142964.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_006769416.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_006934044.1|  PREDICTED: endoplasmin                           89.7    1e-17   
dbj|BAE29874.1|  unnamed protein product                              89.7    1e-17   
ref|XP_011260972.1|  PREDICTED: endoplasmin                           89.7    1e-17   
gb|AAH10445.1|  Heat shock protein 90, beta (Grp94), member 1         89.7    1e-17   
ref|XP_008568503.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|XP_006740280.1|  PREDICTED: endoplasmin isoform X1                89.7    1e-17   
ref|XP_008703910.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|NP_001157345.1|  glucose-regulated protein precursor              89.7    1e-17   
ref|NP_999268.1|  endoplasmin precursor                               89.7    1e-17   
ref|XP_005865309.1|  PREDICTED: endoplasmin                           89.7    1e-17   
ref|NP_001003327.1|  endoplasmin precursor                            89.7    1e-17   
sp|Q29092.3|ENPL_PIG  RecName: Full=Endoplasmin; AltName: Full=94...  89.7    1e-17   
gb|EPQ07146.1|  Endoplasmin                                           89.7    1e-17   
ref|XP_004844893.1|  PREDICTED: endoplasmin isoform X1                89.7    1e-17   
ref|NP_001063456.1|  Os09g0474300                                     89.4    1e-17   
ref|XP_008651357.1|  PREDICTED: hypothetical protein isoform X1       89.4    2e-17   
gb|EEC84746.1|  hypothetical protein OsI_31743                        89.4    2e-17   
ref|XP_002185158.1|  predicted protein                                89.4    2e-17   
tpg|DAA61912.1|  TPA: hypothetical protein ZEAMMB73_416250            89.4    2e-17   
ref|XP_008255217.1|  PREDICTED: endoplasmin                           89.4    2e-17   
ref|XP_011152996.1|  PREDICTED: endoplasmin                           89.4    2e-17   
ref|XP_010112788.1|  Heat shock protein 90                            89.4    2e-17   
ref|XP_004514756.1|  PREDICTED: endoplasmin homolog                   89.4    2e-17   
gb|ELU00023.1|  hypothetical protein CAPTEDRAFT_159587                89.4    2e-17   
gb|KDO58427.1|  hypothetical protein CISIN_1g003713mg                 89.4    2e-17   
ref|XP_004589651.1|  PREDICTED: endoplasmin                           89.4    2e-17   
ref|XP_002444835.1|  hypothetical protein SORBIDRAFT_07g028940        89.4    2e-17   
ref|XP_004973760.1|  PREDICTED: endoplasmin homolog                   89.4    2e-17   
ref|XP_004623907.1|  PREDICTED: endoplasmin                           89.4    2e-17   
ref|XP_004999393.1|  PREDICTED: endoplasmin isoform X2                89.4    2e-17   
gb|KIH66348.1|  Hsp90 protein                                         89.0    2e-17   
dbj|GAM27457.1|  hypothetical protein SAMD00019534_106330             89.4    2e-17   
ref|XP_008800616.1|  PREDICTED: heat shock protein 83                 89.0    2e-17   
ref|XP_005374635.1|  PREDICTED: endoplasmin                           89.0    2e-17   
ref|XP_003461118.1|  PREDICTED: endoplasmin isoform X1                89.0    2e-17   
ref|XP_006447753.1|  hypothetical protein CICLE_v10014316mg           89.0    2e-17   
ref|XP_005680600.1|  PREDICTED: endoplasmin                           89.0    2e-17   
ref|XP_008807013.1|  PREDICTED: heat shock protein 83-like            89.0    2e-17   
ref|XP_004962890.1|  PREDICTED: heat shock protein 83-like isofor...  89.0    2e-17   
gb|EYC44141.1|  hypothetical protein Y032_0471g2056                   89.0    2e-17   
gb|EYC44140.1|  hypothetical protein Y032_0471g2056                   89.0    2e-17   
ref|XP_004650619.1|  PREDICTED: endoplasmin                           89.0    2e-17   
ref|XP_005100278.1|  PREDICTED: mesocentin-like                       89.7    2e-17   
gb|ETN77129.1|  Hsp90 protein                                         89.0    2e-17   
ref|XP_004962889.1|  PREDICTED: heat shock protein 83-like isofor...  89.0    2e-17   
gb|EEE69897.1|  hypothetical protein OsJ_29732                        89.0    2e-17   
gb|KFQ43502.1|  Endoplasmin                                           89.0    3e-17   
ref|XP_011155603.1|  PREDICTED: endoplasmin                           89.0    3e-17   
gb|KFP21894.1|  Endoplasmin                                           89.0    3e-17   
gb|KDO58428.1|  hypothetical protein CISIN_1g003713mg                 89.0    3e-17   
gb|AGC54636.1|  heat shock protein 90                                 89.0    3e-17   
gb|ETE69540.1|  Endoplasmin                                           89.0    3e-17   
ref|XP_009178256.1|  hypothetical protein T265_16367                  82.4    3e-17   
emb|CCA22450.1|  heat shock protein 90 putative                       89.0    3e-17   
ref|XP_008880478.1|  hypothetical protein H310_14401                  89.0    3e-17   
dbj|BAC40172.1|  unnamed protein product                              85.9    3e-17   
ref|XP_009381110.1|  PREDICTED: heat shock protein 83                 88.6    3e-17   
emb|CDY35962.1|  BnaA05g29880D                                        88.6    3e-17   
gb|ACN33229.1|  unknown                                               88.6    3e-17   
ref|XP_008339741.1|  PREDICTED: heat shock protein 83                 88.6    3e-17   
ref|XP_739675.1|  hypothetical protein                                83.2    3e-17   
ref|XP_002443262.1|  hypothetical protein SORBIDRAFT_08g016560        88.6    3e-17   
ref|XP_009355621.1|  PREDICTED: heat shock protein 83                 88.6    3e-17   
ref|XP_009147028.1|  PREDICTED: heat shock protein 90-1-like          88.6    3e-17   
gb|AEE63339.1|  unknown                                               88.6    3e-17   
gb|ELK25961.1|  Endoplasmin                                           89.0    3e-17   
ref|XP_003772640.1|  PREDICTED: endoplasmin-like                      88.6    3e-17   
gb|ENN73291.1|  hypothetical protein YQE_10055                        88.6    3e-17   
gb|ERL91651.1|  hypothetical protein D910_08979                       88.6    3e-17   
ref|XP_008671461.1|  PREDICTED: endoplasmin homolog                   84.0    3e-17   
ref|XP_008674382.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...  88.6    3e-17   
ref|XP_005310776.1|  PREDICTED: endoplasmin                           88.6    3e-17   
emb|CAG08708.1|  unnamed protein product                              88.6    3e-17   
ref|XP_010943343.1|  PREDICTED: heat shock protein 83-like            88.6    3e-17   
ref|XP_008648551.1|  PREDICTED: heat shock protein 83-like isofor...  88.6    3e-17   
gb|KFP37272.1|  Endoplasmin                                           88.6    3e-17   
ref|XP_006437833.1|  hypothetical protein CICLE_v10030743mg           88.6    3e-17   
ref|NP_001039228.1|  heat shock protein 90kDa beta (Grp94), membe...  88.6    3e-17   
gb|AFI80882.1|  SR00034                                               88.6    3e-17   
ref|XP_001899398.1|  Endoplasmin precursor                            88.6    3e-17   
ref|XP_003574676.1|  PREDICTED: heat shock cognate 90 kDa protein...  88.6    3e-17   
gb|KIY96790.1|  molecular chaperone HtpG                              83.6    3e-17   
emb|CEF70962.1|  Glycoprotein 93                                      88.6    3e-17   
ref|XP_006484274.1|  PREDICTED: heat shock protein 83-like            88.6    4e-17   
ref|XP_008648550.1|  PREDICTED: heat shock protein 83-like isofor...  88.2    4e-17   
gb|KEH17540.1|  heat shock protein 81-2                               88.6    4e-17   
gb|KHG08899.1|  Heat shock 83                                         88.6    4e-17   
gb|EPS65742.1|  heat shock protein 90                                 85.1    4e-17   
dbj|BAA94290.2|  glucose-regulated protein 94                         88.2    4e-17   
emb|CAA72515.1|  heat shock protein                                   88.2    4e-17   
ref|XP_007157601.1|  hypothetical protein PHAVU_002G083000g           88.6    4e-17   
sp|Q9NKX1.2|ENPL_DICDI  RecName: Full=Endoplasmin homolog; AltNam...  88.2    4e-17   
gb|EJW87335.1|  glucose-regulated protein 94                          88.6    4e-17   
ref|XP_004297188.1|  PREDICTED: heat shock protein 83                 88.2    4e-17   
ref|XP_641313.1|  heat shock protein Hsp90 family protein             88.2    4e-17   
gb|KFM57735.1|  Endoplasmin                                           88.2    4e-17   
ref|XP_011021135.1|  PREDICTED: heat shock protein 83-like            88.2    4e-17   
ref|XP_002311417.1|  heat shock family protein                        88.2    4e-17   
ref|XP_010681164.1|  PREDICTED: heat shock protein 90-1 isoform X1    88.2    4e-17   
ref|XP_010681165.1|  PREDICTED: heat shock protein 90-1 isoform X2    88.2    4e-17   
ref|XP_009843856.1|  hypothetical protein H257_16935                  88.2    4e-17   
ref|XP_001844128.1|  endoplasmin                                      88.2    4e-17   
ref|XP_006844092.1|  hypothetical protein AMTR_s00006p00252810        88.2    5e-17   
gb|AAW79381.1|  heat-shock protein, hsp 90                            84.0    5e-17   
ref|XP_010261402.1|  PREDICTED: heat shock protein 83-like            88.2    5e-17   
gb|ETN62729.1|  endoplasmin                                           88.2    5e-17   
ref|XP_001637407.1|  predicted protein                                88.2    5e-17   
ref|XP_009114127.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...  88.2    5e-17   
gb|KDO21013.1|  hypothetical protein SPRG_13941                       88.2    5e-17   
ref|XP_009700867.1|  PREDICTED: endoplasmin                           88.2    5e-17   
ref|XP_008620345.1|  heat shock protein 90kDa beta                    88.2    5e-17   
ref|XP_003220951.1|  PREDICTED: endoplasmin                           88.2    5e-17   
ref|XP_001662951.1|  AAEL012827-PA                                    88.2    5e-17   
gb|KFP55508.1|  Endoplasmin                                           88.2    5e-17   
ref|XP_002155110.2|  PREDICTED: heat shock protein HSP 90-alpha       83.6    5e-17   
ref|XP_010270190.1|  PREDICTED: heat shock protein 81-1-like isof...  87.8    5e-17   
ref|NP_001083114.1|  uncharacterized protein LOC398753 precursor      87.8    5e-17   
ref|XP_004023992.1|  hypothetical protein IMG5_201300                 87.8    5e-17   
gb|ESA16930.1|  hypothetical protein GLOINDRAFT_77045                 87.8    5e-17   
emb|CBI27411.3|  unnamed protein product                              87.8    6e-17   
ref|XP_006004184.1|  PREDICTED: endoplasmin isoform X2                87.8    6e-17   
gb|KFP71026.1|  Endoplasmin                                           87.8    6e-17   
ref|XP_008310403.1|  PREDICTED: endoplasmin                           87.8    6e-17   
emb|CEI86384.1|  Putative Heat shock protein 90-1                     84.0    6e-17   
gb|ACF35012.1|  heat shock protein 108                                87.8    6e-17   
ref|XP_003967565.1|  PREDICTED: endoplasmin-like                      87.8    6e-17   
ref|XP_003140246.1|  endoplasmin                                      87.8    6e-17   
ref|XP_006004183.1|  PREDICTED: endoplasmin isoform X1                87.8    6e-17   
ref|XP_010270191.1|  PREDICTED: heat shock protein 81-1-like isof...  87.8    6e-17   
ref|NP_849932.1|  chloroplast heat shock protein 90                   87.8    6e-17   
ref|XP_008243784.1|  PREDICTED: heat shock protein 90-1               87.8    6e-17   
emb|CBJ27906.1|  Heat shock protein 90                                87.8    6e-17   
dbj|GAA49076.1|  endoplasmin                                          88.2    6e-17   
ref|XP_003518802.1|  PREDICTED: heat shock protein 83-like            87.8    6e-17   
gb|AAM19795.1|  At2g04030/F3C11.14                                    87.8    6e-17   
gb|EOA99107.1|  Endoplasmin                                           87.4    6e-17   
ref|XP_009509252.1|  PREDICTED: endoplasmin                           87.8    6e-17   
dbj|BAI23208.1|  heat shock protein 90kDa beta (Grp94), member 1      87.8    6e-17   
gb|EXX59912.1|  Hsp90 family chaperone HSC82                          87.8    6e-17   
ref|XP_001365625.1|  PREDICTED: endoplasmin                           87.8    6e-17   
ref|XP_006138079.1|  PREDICTED: endoplasmin                           87.8    6e-17   
ref|NP_178487.1|  chloroplast heat shock protein 90                   87.8    6e-17   
gb|AAA48827.1|  108K heat shock protein                               87.8    7e-17   
ref|XP_010409181.1|  PREDICTED: endoplasmin                           87.8    7e-17   
gb|EMC80264.1|  Endoplasmin                                           87.8    7e-17   



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   128 bits (322),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 65/68 (96%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS+RTLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESMSRRTLRATAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  123  SLTDKEIL  130


 Score = 97.1 bits (240),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW VPAVLFLLCLLFLLPDQGRKIHANAEVD+DAPVDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTVPAVLFLLCLLFLLPDQGRKIHANAEVDADAPVDPPKVEEKIGAVPNGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   127 bits (319),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS+RTLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESMSRRTLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  123  ALTDKEVL  130


 Score = 95.1 bits (235),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDAP+DPPKVEEKIGGVP+GLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAPLDPPKVEEKIGGVPNGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   125 bits (315),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS++TLRA A+KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESMSRKTLRASAQKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 94.0 bits (232),  Expect(2) = 1e-48, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VLFLLCLLFLLPDQGRKIHANAE DSD P+DPPKVEEKIG VPHGLSTD +V
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIHANAEADSDVPLDPPKVEEKIGAVPHGLSTDSEV  60

Query  237  AKGKLSPCQR  266
             K +     R
Sbjct  61   VKREAESMSR  70



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   125 bits (314),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 90.9 bits (224),  Expect(2) = 2e-47, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKLGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   125 bits (314),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 90.1 bits (222),  Expect(2) = 3e-47, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKFGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   125 bits (313),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS++TLRA AEKFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  123  ALTDKEVL  130


 Score = 89.4 bits (220),  Expect(2) = 7e-47, Method: Composition-based stats.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P VLFLLCL+FL+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWTIPFVLFLLCLIFLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  237  AKGKLSPCQR  266
            AK +     R
Sbjct  61   AKREAESMSR  70



>ref|XP_009596271.1| PREDICTED: endoplasmin homolog, partial [Nicotiana tomentosiformis]
Length=644

 Score =   125 bits (313),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 89.0 bits (219),  Expect(2) = 7e-47, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   125 bits (313),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS++TLRA AEKFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  123  ALTDKEVL  130


 Score = 88.6 bits (218),  Expect(2) = 9e-47, Method: Composition-based stats.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P VLFLLCL++L+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWKIPFVLFLLCLIYLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  237  AKGKLSPCQR  266
            AK +     R
Sbjct  61   AKREAESMSR  70



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   125 bits (314),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 88.2 bits (217),  Expect(2) = 9e-47, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   125 bits (314),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 88.2 bits (217),  Expect(2) = 9e-47, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   125 bits (313),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 88.2 bits (217),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   124 bits (310),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  123  ALTDKEVL  130


 Score = 82.8 bits (203),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LLCLL ++ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSVISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   127 bits (319),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS+RTLRA AE+FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   REAESMSRRTLRANAERFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  122  SLTDKEVL  129


 Score = 79.3 bits (194),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 50/70 (71%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW + +VLFLLCLLFL PDQGRKIH NA+ DSDA VDPPKVEEKIG VP+GLSTD +V
Sbjct  1    MRKWTI-SVLFLLCLLFLFPDQGRKIHVNAKGDSDASVDPPKVEEKIGAVPNGLSTDSNV  59

Query  237  AKGKLSPCQR  266
            AK +     R
Sbjct  60   AKREAESMSR  69



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   127 bits (319),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDKDIL
Sbjct  123  SLTDKDIL  130


 Score = 78.2 bits (191),  Expect(2) = 2e-44, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   127 bits (318),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDKDIL
Sbjct  123  SLTDKDIL  130


 Score = 78.2 bits (191),  Expect(2) = 3e-44, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>gb|KDO84887.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=584

 Score =   123 bits (309),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 80.9 bits (198),  Expect(2) = 5e-44, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   118 bits (295),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  123  ALTDKDVL  130


 Score = 86.3 bits (212),  Expect(2) = 5e-44, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE DSD  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEADSDELVDPPKVEEKIGAVPSGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   125 bits (313),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDA+DKIRFL
Sbjct  63   REAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAIDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  123  SLTDKEIL  130


 Score = 79.0 bits (193),  Expect(2) = 6e-44, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ LFLLCLLFLLPDQGRK+ ANAE  SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALFLLCLLFLLPDQGRKLQANAEGSSDDLVDPPKVEEKIGAVPNGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   124 bits (310),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 80.1 bits (196),  Expect(2) = 7e-44, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   124 bits (310),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 79.7 bits (195),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   124 bits (310),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 79.7 bits (195),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P++L LL LL L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLLALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   124 bits (310),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 79.7 bits (195),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   124 bits (310),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SKRTLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 79.3 bits (194),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   125 bits (315),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDKDIL
Sbjct  123  SLTDKDIL  130


 Score = 77.4 bits (189),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LL LL LL DQG+K  ANAE +SD  VDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSTLLLLSLLLLLADQGQKFQANAEGNSDEIVDPPKVEEKLGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>gb|KDO84888.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=507

 Score =   124 bits (310),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 79.3 bits (194),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   124 bits (310),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SKRTLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 79.3 bits (194),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   118 bits (295),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  123  ALTDKDVL  130


 Score = 84.3 bits (207),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   118 bits (296),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  123  ALTDKDVL  130


 Score = 84.0 bits (206),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   124 bits (312),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  65   REAESISRKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  124

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  125  ALTDKDVL  132


 Score = 77.4 bits (189),  Expect(2) = 3e-43, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  230
            MRKWA+P+ L LL LL  +PD+GR +HANAE   DSD  VDPPKVEEK+G VP+GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTVPDRGRNLHANAEDSGDSDELVDPPKVEEKLGAVPNGLSTDA  60

Query  231  DVAKGKLSPCQR  266
            +VAK +     R
Sbjct  61   EVAKREAESISR  72



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   120 bits (302),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SKR+LR+ AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISKRSLRSDAEKFQFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  123  ALTDKEVL  130


 Score = 80.9 bits (198),  Expect(2) = 3e-43, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LLCLL L+ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   125 bits (314),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDKD+L
Sbjct  123  SLTDKDVL  130


 Score = 75.5 bits (184),  Expect(2) = 5e-43, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   125 bits (314),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDKD+L
Sbjct  123  SLTDKDVL  130


 Score = 75.5 bits (184),  Expect(2) = 5e-43, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   125 bits (314),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   REAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  122  SLTDKEIL  129


 Score = 75.5 bits (184),  Expect(2) = 6e-43, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LL LL LLPDQG K+HA+AE +S+  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLLLLSLLPDQGHKLHASAE-ESEELVDPPKVEEKIGAVPNGLSTDSDV  59

Query  237  AK  242
            AK
Sbjct  60   AK  61



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   124 bits (312),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 75.5 bits (184),  Expect(2) = 8e-43, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   124 bits (312),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 75.5 bits (184),  Expect(2) = 8e-43, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   116 bits (290),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 2/68 (3%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMSKR  R  A++FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESMSKR--RGNAQQFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFL  120

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  121  SLTDKEIL  128


 Score = 84.0 bits (206),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   122 bits (305),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AEKFEFQAEVSRLMDI++NSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   REAESISKRSLRSNAEKFEFQAEVSRLMDILVNSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            SLT+K+IL
Sbjct  122  SLTNKEIL  129


 Score = 76.3 bits (186),  Expect(2) = 3e-42, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LL LL LLPDQG KIHANAE +S+  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWMIPSALLLLLLLSLLPDQGHKIHANAE-ESEDLVDPPKVEEKIGAVPKGLSTDSDV  59

Query  237  AK  242
            A+
Sbjct  60   AR  61



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   119 bits (298),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AE+F+FQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  123  ALTDKEVL  130


 Score = 78.6 bits (192),  Expect(2) = 5e-42, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEDSSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   122 bits (305),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SKR+LR  AEKFEFQAEVSRLMDI++NSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISKRSLRNSAEKFEFQAEVSRLMDILVNSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDKDIL
Sbjct  123  ALTDKDIL  130


 Score = 75.5 bits (184),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            M KW +P+VL +LCLL  LPDQGRK+ ANAE DS+  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MGKWTIPSVLLVLCLLCALPDQGRKLRANAEGDSEELVDPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   119 bits (298),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AE+F+FQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  123  ALTDKEVL  130


 Score = 78.2 bits (191),  Expect(2) = 7e-42, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEGGSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  237  AK  242
            AK
Sbjct  61   AK  62



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   122 bits (307),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRL+DIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  65   REAESISRKTLRSNAEKFEFQAEVSRLLDIIINSLYSNKDIFLRELISNASDALDKIRFL  124

Query  422  SLTDKDIL  445
            SLT+KDIL
Sbjct  125  SLTNKDIL  132


 Score = 73.9 bits (180),  Expect(2) = 9e-42, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  230
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTDP
Sbjct  1    MRKWALPSALLLLLLLSFLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDP  60

Query  231  DVAKGKLSPCQR  266
            DVAK +     R
Sbjct  61   DVAKREAESISR  72



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   125 bits (313),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRSLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 71.2 bits (173),  Expect(2) = 1e-41, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW V +VL LL LLFL  DQGRK  ANA  DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASVLLLLSLLFLFADQGRKFQANAAGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   122 bits (305),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S+++LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  64   REAESISRKSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  123

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  124  SLTDKEIL  131


 Score = 73.9 bits (180),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAE-VDSDAPVDPPKVEEKIGGVPHGLSTDPD  233
            MRKWA+P+VL LL LL  LPDQGRKIHANAE  D D  VDPPKVEEKIG VP GLSTD D
Sbjct  1    MRKWALPSVLLLLVLLSTLPDQGRKIHANAEESDGDELVDPPKVEEKIGAVPSGLSTDSD  60

Query  234  VAKGKLSPCQR  266
            VAK +     R
Sbjct  61   VAKREAESISR  71



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   122 bits (307),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SKR+LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISKRSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  123  SLTDKEIL  130


 Score = 72.4 bits (176),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW + + L LLC+L L+PD+G + HA A+ D+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADGDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   120 bits (300),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TL + AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  86   REAESISRKTLGSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  145

Query  422  SLTDKDIL  445
            SLT+K+IL
Sbjct  146  SLTNKEIL  153


 Score = 74.7 bits (182),  Expect(2) = 4e-41, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = +3

Query  51   VTMRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLST  224
            + MRKWA+P+ L LL LL   PDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLST
Sbjct  20   IAMRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLST  79

Query  225  DPDVAKGKLSPCQR  266
            D DVAK +     R
Sbjct  80   DSDVAKREAESISR  93



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   121 bits (304),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S R LRA AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISGRNLRAEAEKFQFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 71.6 bits (174),  Expect(2) = 9e-41, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW V ++L LLC+L +LPDQGRK   NAE + DA   PPKVEEKIGG+P GLSTD +V
Sbjct  1    MRKWTVTSILLLLCILLVLPDQGRKARVNAESEKDAATGPPKVEEKIGGIPSGLSTDSEV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   121 bits (303),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  65   REAESISRKTLRSNAEKFDFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  124

Query  422  SLTDKDIL  445
            SLT+K+IL
Sbjct  125  SLTNKEIL  132


 Score = 70.5 bits (171),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  230
            MRKWA+P+ L LL LL   PDQGRK+HANAE   D+D   DPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDADELADPPKVEEKLGAVPGGLSTDS  60

Query  231  DVAKGKLSPCQR  266
            DVAK +     R
Sbjct  61   DVAKREAESISR  72



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   117 bits (292),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++++R+  EKFEFQAEVSRL+DIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  65   REAESISRKSMRSDGEKFEFQAEVSRLLDIIINSLYSNKDIFLRELISNASDALDKIRFL  124

Query  422  SLTDKDIL  445
            SLT+K+IL
Sbjct  125  SLTNKEIL  132


 Score = 70.9 bits (172),  Expect(2) = 5e-39, Method: Composition-based stats.
 Identities = 48/72 (67%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  230
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDS  60

Query  231  DVAKGKLSPCQR  266
            DVAK +     R
Sbjct  61   DVAKREAESISR  72



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   126 bits (317),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESMSKKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 60.5 bits (145),  Expect(2) = 8e-39, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDV  59



>dbj|BAD94659.1| HSP90-like protein [Arabidopsis thaliana]
Length=328

 Score =   126 bits (316),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESMSKKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 60.8 bits (146),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDV  59



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   126 bits (317),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESMSKKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 60.5 bits (145),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDV  59



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   126 bits (316),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESMSKKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 60.5 bits (145),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDV  59



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   126 bits (316),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESMSKKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 60.5 bits (145),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDV  59



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   126 bits (316),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESMSKKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 60.5 bits (145),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDV  59



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   126 bits (316),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESMSKKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 60.5 bits (145),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDV  59



>gb|AAX19870.1| unknown, partial [Doryanthes excelsa]
Length=289

 Score =   122 bits (307),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  64   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  123

Query  422  SLTDKDIL  445
            +LTDK+IL
Sbjct  124  ALTDKEIL  131


 Score = 62.8 bits (151),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query  117  DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQR  266
            DQGRK+ ANAE +S+  VDPPKVEEK+G VP GLSTD DVAK +     R
Sbjct  23   DQGRKLQANAE-ESEELVDPPKVEEKLGAVPGGLSTDSDVAKREAESISR  71



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   126 bits (317),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESMSKKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 57.8 bits (138),  Expect(2) = 4e-38, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQG K+HANAE  SD   DPPKVEEKIGG   GLSTD DV
Sbjct  20   PDQGTKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDV  59



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   122 bits (307),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 61.2 bits (147),  Expect(2) = 7e-38, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKLGG-HSGLSTDSDV  59



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   122 bits (307),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 60.5 bits (145),  Expect(2) = 9e-38, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRK  + +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKRTIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEEKLGG-HGGLSTDSDV  59



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   125 bits (313),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESMSKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 57.4 bits (137),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRK  + +VLFL+CL+FLLPDQGRK+HANAE  ++   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKKTIVSVLFLVCLVFLLPDQGRKLHANAEGSTEEYSDPPKVEEKLGG-HGGLSTDSDV  59



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   124 bits (311),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SK+TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESISKKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 58.2 bits (139),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEE IGG   GLSTD DV
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEPIGG-HGGLSTDSDV  59



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   124 bits (312),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS+++LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  65   REAESMSRKSLRGNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  124

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  125  SLTDKEIL  132


 Score = 57.8 bits (138),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAP--VDPPKVEEKIGGVPHGLSTDP  230
            MRK A+ + +FL+ LL LLP QGR + ANAE ++ A   VDPPKVEEKIG +P  LSTD 
Sbjct  1    MRKGAMTSAIFLVFLLALLPYQGRHLQANAEENNGAEGLVDPPKVEEKIGAIPDALSTDS  60

Query  231  DVAKGKLSPCQR  266
            DVAK +     R
Sbjct  61   DVAKREAESMSR  72



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   119 bits (297),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  60   RESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  119

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  120  SLTDKEVL  127


 Score = 63.2 bits (152),  Expect(2) = 2e-37, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  237  AK  242
             K
Sbjct  58   VK  59



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   119 bits (297),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  60   RESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  119

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  120  SLTDKEVL  127


 Score = 62.8 bits (151),  Expect(2) = 3e-37, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  237  AK  242
             K
Sbjct  58   VK  59



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   108 bits (271),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++L
Sbjct  89   LRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVL  146


 Score = 72.8 bits (177),  Expect(2) = 3e-37, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +3

Query  54   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  233
            TMRKWA+P+ L LLCLL LL D GRK+ ANAE   +  VDPPKVEEKIG VPHGL TD D
Sbjct  19   TMRKWAIPSALVLLCLLSLLSDHGRKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSD  75

Query  234  VAK  242
            V K
Sbjct  76   VVK  78



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   120 bits (302),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 69/76 (91%), Gaps = 6/76 (8%)
 Frame = +2

Query  218  IHRS*CG*REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD  397
            +HRS      +ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD
Sbjct  60   VHRS------SESISKKSLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD  113

Query  398  ALDKIRFLSLTDKDIL  445
            ALDKIRFL+LTDKD+L
Sbjct  114  ALDKIRFLALTDKDVL  129


 Score = 60.8 bits (146),  Expect(2) = 3e-37, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRK  + +V+FL  LLFLLP+QGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKKTIVSVMFLFSLLFLLPEQGRKLHANAEESSDDVTDPPKVEEKLGG-HGGLSTDSDV  59



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   123 bits (308),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 58.5 bits (140),  Expect(2) = 3e-37, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG-HGGLSTDSDV  59



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   123 bits (308),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 58.5 bits (140),  Expect(2) = 3e-37, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG-HGGLSTDSDV  59



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   123 bits (308),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 57.8 bits (138),  Expect(2) = 5e-37, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG-HGGLSTDSDV  59



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   119 bits (299),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            E+ES+SK++LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+
Sbjct  64   ESESISKKSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLA  123

Query  425  LTDKDIL  445
            LTDKD+L
Sbjct  124  LTDKDVL  130


 Score = 61.2 bits (147),  Expect(2) = 6e-37, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRK A+ +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVE+K+GG   GLSTD DV
Sbjct  1    MRKRAIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEKKLGG-HGGLSTDSDV  59

Query  237  AK  242
             +
Sbjct  60   VR  61



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   105 bits (261),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+IL
Sbjct  77   GEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEIL  130


 Score = 75.1 bits (183),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW + + L LLC+L L+PD+G + HA A+VD+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADVDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  237  AK  242
             K
Sbjct  61   VK  62



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   119 bits (297),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  60   RESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  119

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  120  SLTDKEVL  127


 Score = 61.2 bits (147),  Expect(2) = 1e-36, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            M  W +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGNWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  237  AK  242
             K
Sbjct  58   VK  59



>gb|KJB63271.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=264

 Score =   108 bits (269),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++L
Sbjct  70   LRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVL  127


 Score = 70.9 bits (172),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 3/62 (5%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  237  AK  242
            AK
Sbjct  58   AK  59



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   122 bits (307),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   RESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDKD+L
Sbjct  122  ALTDKDVL  129


 Score = 56.2 bits (134),  Expect(2) = 2e-36, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            PDQGRK+HA+AE  +D   DPPKVEEK+GG   GLSTD DV
Sbjct  20   PDQGRKLHASAEDSTDEVTDPPKVEEKLGG-HGGLSTDSDV  59



>gb|KJB63272.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=303

 Score =   108 bits (270),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++L
Sbjct  70   LRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVL  127


 Score = 70.9 bits (172),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 3/62 (5%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  237  AK  242
            AK
Sbjct  58   AK  59



>gb|KJB63270.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=260

 Score =   108 bits (269),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++L
Sbjct  70   LRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVL  127


 Score = 70.9 bits (172),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 3/62 (5%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  237  AK  242
            AK
Sbjct  58   AK  59



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   120 bits (301),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  64   RESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  123

Query  422  SLTDKDIL  445
             LTDK++L
Sbjct  124  GLTDKEVL  131


 Score = 57.8 bits (138),  Expect(2) = 4e-36, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfl-lPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  233
            MRKWA+ + L L+ LL    PD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +
Sbjct  1    MRKWALSSALLLVFLLATLSPDPAKRLQVNAEESSDELADLPKVEEKLGAVPHGLSTDSE  60

Query  234  VAK  242
            V K
Sbjct  61   VVK  63



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   105 bits (262),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++L
Sbjct  74   AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVL  127


 Score = 71.2 bits (173),  Expect(2) = 8e-36, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 3/62 (5%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  237  AK  242
             K
Sbjct  58   VK  59



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   105 bits (263),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++L
Sbjct  74   AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVL  127


 Score = 71.2 bits (173),  Expect(2) = 9e-36, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 3/62 (5%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  237  AK  242
             K
Sbjct  58   VK  59



>tpg|DAA46734.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=377

 Score =   121 bits (304),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            EAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLS
Sbjct  178  EAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLS  237

Query  425  LTDKDIL  445
            LTDK++L
Sbjct  238  LTDKEVL  244


 Score = 53.5 bits (127),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  126  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQR  266
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ +     R
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISR  184



>gb|AFW81541.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
 gb|AFW81542.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
Length=411

 Score =   119 bits (298),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            EAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLY+NKDIF RELISNASDALDKIRFLS
Sbjct  286  EAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYNNKDIFPRELISNASDALDKIRFLS  345

Query  425  LTDKDIL  445
            LTDK++L
Sbjct  346  LTDKEVL  352


 Score = 56.2 bits (134),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  120  QGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQR  266
            Q  K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+ +     R
Sbjct  244  QANKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQSEAESISR  292



>tpg|DAA46735.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=411

 Score =   121 bits (303),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            EAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLS
Sbjct  178  EAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLS  237

Query  425  LTDKDIL  445
            LTDK++L
Sbjct  238  LTDKEVL  244


 Score = 53.5 bits (127),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  126  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQR  266
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ +     R
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISR  184



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   105 bits (263),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/54 (96%), Positives = 54/54 (100%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++L
Sbjct  66   AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVL  119


 Score = 60.1 bits (144),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = +3

Query  117  DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAK  242
            DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV K
Sbjct  13   DQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDVVK  51



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   108 bits (271),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++L
Sbjct  47   LRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVL  104


 Score = 55.1 bits (131),  Expect(2) = 6e-32, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +3

Query  126  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAK  242
            RK+ ANAE   +  VDPPKVEEKIG VPHGL TD DV K
Sbjct  1    RKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSDVVK  36



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSKRTLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESMSKRTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDKD+L
Sbjct  123  SLTDKDVL  130


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+VLF +CL+FLLPDQGRK+HANA+  SD  VDPPKVEEK+GG+  GLSTD DV
Sbjct  1    MRKWTIPSVLFFVCLIFLLPDQGRKLHANADGSSDEVVDPPKVEEKVGGIHGGLSTDSDV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
                     R    + +R L S
Sbjct  61   V-------HRESESMSKRTLRS  75



>ref|XP_008660989.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=209

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  28   REAESISRKTLRSSIEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  87

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  88   SLTDKEVL  95



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR LRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  123  SLTDKEIL  130


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            AK       R    + +RNL +
Sbjct  61   AK-------REAESISKRNLRA  75



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+SKR LRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  328  REAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  387

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  388  SLTDKEIL  395


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  266  MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  325

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            AK       R    + +RNL +
Sbjct  326  AK-------REAESISKRNLRA  340



>gb|KHN44921.1| Endoplasmin like [Glycine soja]
Length=283

 Score =   100 bits (250),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            +++  EKFEFQAEVS LMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+++
Sbjct  130  IKSNVEKFEFQAEVSWLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVV  187


 Score = 56.6 bits (135),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  123  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQ  263
            GRK  ANAE DSD  VDPPKV++KI  VPHGL TD +V K  +   +
Sbjct  92   GRKFQANAEGDSDELVDPPKVKDKISDVPHGLLTDSNVIKSNVEKFE  138



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS+R LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  133  REAESMSRRNLRTNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  192

Query  422  SLTDKDIL  445
            SLTDK+IL
Sbjct  193  SLTDKEIL  200


 Score = 95.5 bits (236),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 59/83 (71%), Positives = 64/83 (77%), Gaps = 7/83 (8%)
 Frame = +3

Query  54   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  233
            TMRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDA VDPPKVEEK+G VPHGLSTD D
Sbjct  70   TMRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAAVDPPKVEEKLGAVPHGLSTDSD  129

Query  234  VAKGKLSPCQRGHSELVRRNLSS  302
            V K       R    + RRNL +
Sbjct  130  VVK-------REAESMSRRNLRT  145



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S+RTLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  65   REAESISRRTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  124

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  125  SLTDKEVL  132


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 58/84 (69%), Gaps = 9/84 (11%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLSTDP  230
            MRKWA+P+ L LL LL  +PD+GRK+HANAE   DSD  VDPPKVE+K+G VPHGLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTIPDRGRKLHANAEDSGDSDELVDPPKVEDKLGAVPHGLSTDS  60

Query  231  DVAKGKLSPCQRGHSELVRRNLSS  302
            +VAK       R    + RR L S
Sbjct  61   EVAK-------REAESISRRTLRS  77



>gb|AFW75766.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=710

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            A       QR    + R+ L S
Sbjct  61   A-------QREAESISRKTLRS  75



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 41/82 (50%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            A       QR    + R+ L S
Sbjct  61   A-------QREAESISRKTLRS  75



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS++ LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  67   REAESMSRKNLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  126

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  127  SLTDKEVL  134


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 54/86 (63%), Gaps = 11/86 (13%)
 Frame = +3

Query  57   MRKWAVP--AVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLST  224
            MR W++P   VL LL  L  +PD GRK+HANAE   D+D  VDPPKVEEKI GV  GLST
Sbjct  1    MRNWSIPPALVLLLLISLSAIPDGGRKLHANAEESRDADELVDPPKVEEKIAGVHGGLST  60

Query  225  DPDVAKGKLSPCQRGHSELVRRNLSS  302
            D DVAK       R    + R+NL S
Sbjct  61   DADVAK-------REAESMSRKNLRS  79



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            A       QR    + R+ L S
Sbjct  61   A-------QREAESISRKTLRS  75



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDAEV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            A       QR    + R+ L S
Sbjct  61   A-------QREAESISRKTLRS  75



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  256  REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  315

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  316  SLTDKEVL  323


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 7/60 (12%)
 Frame = +3

Query  123  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQRGHSELVRRNLSS  302
             +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA       QR    + R+ L S
Sbjct  216  AKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVA-------QREAESISRKTLRS  268



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            A       QR    + R+ L S
Sbjct  61   A-------QREAESISRKTLRS  75



>ref|XP_008646956.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=215

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+  EKFEFQAEVSRLMDIIINSLY+ KDIFLRE ISNASDALDKIRFL
Sbjct  91   REAESISRKTLRSSTEKFEFQAEVSRLMDIIINSLYNKKDIFLREPISNASDALDKIRFL  150

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  151  SLTDKEVL  158



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  122  ALTDKEVL  129


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 8/82 (10%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+ +   LL LL  LPD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWAL-SSALLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
                    QR    + R+ L S
Sbjct  60   V-------QREAESISRKTLRS  74



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  64   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  123

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  124  ALTDKEVL  131


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 7/63 (11%)
 Frame = +3

Query  114  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQRGHSELVRRN  293
            PD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V        QR    + R+ 
Sbjct  21   PDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVV-------QREAESISRKT  73

Query  294  LSS  302
            L S
Sbjct  74   LRS  76



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  89   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  148

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  149  ALTDKEVL  156


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = +3

Query  123  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQRGHSELVRRNLSS  302
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V        QR    + R+ L S
Sbjct  49   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVV-------QREAESISRKTLRS  101



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  90   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  149

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  150  ALTDKEVL  157


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 7/60 (12%)
 Frame = +3

Query  123  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQRGHSELVRRNLSS  302
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V        QR    + R+ L S
Sbjct  50   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVV-------QREAESISRKTLRS  102



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  62   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  121

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  122  ALTDKEVL  129


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 8/82 (10%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+ +   LL LL  LPD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWAL-SSALLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
                    QR    + R+ L S
Sbjct  60   V-------QREAESISRKTLRS  74



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDI+LRELISNASDALDKIRFL
Sbjct  63   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIYLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            SLTDK++L
Sbjct  123  SLTDKEVL  130


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSDV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            A       QR    + R+ L S
Sbjct  61   A-------QREAESISRKTLRS  75



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  123  ALTDKEVL  130


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 52/82 (63%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+ + L LL LL  LPD  +K+  NA+  +D  VDPPKVEE+IG VPHGLSTD +V
Sbjct  1    MRKWALASALLLLFLLTTLPDPAKKLQVNADDSADELVDPPKVEERIGAVPHGLSTDSEV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            A       QR    + R+ L S
Sbjct  61   A-------QREAESISRKTLRS  75



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            REAESMS R LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   REAESMSMRNLRSDAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK+IL
Sbjct  123  ALTDKEIL  130


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 57/82 (70%), Gaps = 7/82 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKW VP+VLFLLC       QGRKIHANAE DSDAPVDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTVPSVLFLLCPSLSSSCQGRKIHANAEADSDAPVDPPKVEDKIGAVPNGLSTDSDV  60

Query  237  AKGKLSPCQRGHSELVRRNLSS  302
            AK       R    +  RNL S
Sbjct  61   AK-------REAESMSMRNLRS  75



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESMSK+TLR  A+KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESMSKKTLRNSAQKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  123  ALTDKEVL  130


 Score = 72.8 bits (177),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 4/86 (5%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            M+KW + + +FLLC+LFL PDQGR+IHANAE DSD   +PPKVEEK+G VP+GLSTD DV
Sbjct  1    MKKWTLTSAIFLLCILFLFPDQGRRIHANAEGDSDEIANPPKVEEKLGAVPNGLSTDSDV  60

Query  237  AKGKLSPCQRGHSELVRRNLSSRLRF  314
             K +        S+   RN + +  F
Sbjct  61   VKRE----SESMSKKTLRNSAQKFEF  82



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 67/68 (99%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+S++TLRA A+KFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDKIRF+
Sbjct  65   RESESISRKTLRANAQKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDKIRFM  124

Query  422  SLTDKDIL  445
            +LTDK++L
Sbjct  125  ALTDKNVL  132


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 48/84 (57%), Gaps = 9/84 (11%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVD-SDAPVDPPKVEEKIGG-VPHGLSTDP  230
            MRKWAVP  LFLL +L  +P Q   + ANAE   +D    PPKVEE IGG +P  LSTD 
Sbjct  1    MRKWAVPTALFLLIILTFVPHQSPHLRANAEASPADENASPPKVEEGIGGAIPDALSTDA  60

Query  231  DVAKGKLSPCQRGHSELVRRNLSS  302
            DVA       QR    + R+ L +
Sbjct  61   DVA-------QRESESISRKTLRA  77



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LTDK+++
Sbjct  123  ALTDKEVM  130


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 47/80 (59%), Gaps = 7/80 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MRKWA+   L L+ LL  LPD  +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPAKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEV  60

Query  237  AKGKLSPCQRGHSELVRRNL  296
                    QR    + R+ L
Sbjct  61   V-------QRESESISRKTL  73



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   114 bits (284),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+ ++TLRA A++F FQAEVSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  67   RESESVGQKTLRAHAQRFTFQAEVSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFL  126

Query  422  SLTDKDIL  445
            SLTDK  L
Sbjct  127  SLTDKSQL  134


 Score = 37.0 bits (84),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 27/47 (57%), Gaps = 4/47 (9%)
 Frame = +3

Query  114  PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAK  242
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVE  66



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   114 bits (284),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+ ++TLRA A++F FQAEVSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  67   RESESVGQKTLRAHAQRFTFQAEVSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFL  126

Query  422  SLTDKDIL  445
            SLTDK  L
Sbjct  127  SLTDKSQL  134


 Score = 37.0 bits (84),  Expect(2) = 5e-28, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 27/47 (57%), Gaps = 4/47 (9%)
 Frame = +3

Query  114  PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAK  242
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVE  66



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  132  RESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  191

Query  422  SLTDKDIL  445
            +LTDK+++
Sbjct  192  ALTDKEVM  199


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 7/58 (12%)
 Frame = +3

Query  123  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQRGHSELVRRNL  296
             +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V        QR    + R+ L
Sbjct  92   AKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEVV-------QRESESISRKTL  142



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  63   RESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  122

Query  422  SLTDKDIL  445
            +LT+K++L
Sbjct  123  ALTEKEVL  130


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 7/80 (9%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  236
            MR+WA+ + L L+ LL  LPD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRRWALSSALLLVLLLTTLPDPAKRLQVNAEESSDELTDLPKVEEKLGAVPHGLSTDSEV  60

Query  237  AKGKLSPCQRGHSELVRRNL  296
                    QR    + R+ L
Sbjct  61   V-------QRESESISRKTL  73



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL
Sbjct  73   RESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  132

Query  422  SLTDKDIL  445
            +LTDK+ L
Sbjct  133  TLTDKEAL  140


 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 48/90 (53%), Gaps = 17/90 (19%)
 Frame = +3

Query  57   MRKWAVPAVlfllcllfllPDQGR----------KIHANAEVDSDAPVDPPKVEEKIGGV  206
            MRKWA+   L L+ LL  LPD G+          K+  NAE  SD   D PKVEEK+G V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPGKPPQSLPLNTKKLQVNAEESSDEVGDFPKVEEKLGAV  60

Query  207  PHGLSTDPDVAKGKLSPCQRGHSELVRRNL  296
            PHGLSTD +V        QR    + R+ L
Sbjct  61   PHGLSTDSEVV-------QRESESISRKTL  83



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE+ESM+ + LR+ AEKFEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIRFL
Sbjct  73   RESESMTSKNLRSNAEKFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFL  132

Query  422  SLTDKDIL  445
            SLTD  +L
Sbjct  133  SLTDSSVL  140



>ref|XP_001701885.1| heat shock protein 90B [Chlamydomonas reinhardtii]
 gb|EDP06860.1| heat shock protein 90B, partial [Chlamydomonas reinhardtii]
Length=768

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE E+MSK+ +R   E+F FQAEV+RLMDIII+SLYSNKDIFLRELISNASDALDKIRFL
Sbjct  31   REKEAMSKQRVRDSGEQFAFQAEVTRLMDIIIHSLYSNKDIFLRELISNASDALDKIRFL  90

Query  422  SLTDKDIL  445
            SLTDK IL
Sbjct  91   SLTDKSIL  98



>ref|XP_002949693.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
 gb|EFJ49245.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
Length=808

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 60/67 (90%), Gaps = 2/67 (3%)
 Frame = +2

Query  242  REAESMSKRT--LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  415
            RE ESMS     LR+GAE+F FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  55   REKESMSNTANRLRSGAEQFAFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  114

Query  416  FLSLTDK  436
            FLSLTDK
Sbjct  115  FLSLTDK  121



>gb|ACR38010.1| unknown [Zea mays]
Length=104

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDA  400
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDA
Sbjct  51   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDA  103


 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 7/59 (12%)
 Frame = +3

Query  126  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQRGHSELVRRNLSS  302
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA       QR    + R+ L S
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVA-------QREAESISRKTLRS  63



>gb|AFW81490.1| hypothetical protein ZEAMMB73_031063, partial [Zea mays]
Length=102

 Score = 97.4 bits (241),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD  397
            REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD
Sbjct  51   REAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD  102


 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 7/59 (12%)
 Frame = +3

Query  126  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKGKLSPCQRGHSELVRRNLSS  302
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA       QR    + R+ L S
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVA-------QREAESISRKTLRS  63



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRF+SLTDK+ L
Sbjct  52   PGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFMSLTDKEQL  107



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +2

Query  281  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            G+EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ L
Sbjct  51   GSEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQL  105



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  242  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  421
            RE ++++ +  R G E FEFQAEVSRLMDIIINSLYSNKDIFLREL+SNASDALDKIRFL
Sbjct  4    RERDTLAPKERRNG-ESFEFQAEVSRLMDIIINSLYSNKDIFLRELVSNASDALDKIRFL  62

Query  422  SLTDKDIL  445
            SL DK +L
Sbjct  63   SLMDKTLL  70



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            +T ++GAE  EFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFLSLTD+ +L
Sbjct  33   KTFKSGAEVSEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLSLTDESVL  92



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  269  TLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTD  433
            T +AGAE  EFQAEVSRLMDIIINSLYSNKDIFLRELISN SDALDKIRFLSLTD
Sbjct  461  TFKAGAEVNEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFLSLTD  515



>emb|CBN74418.1| Heat shock protein 90 [Ectocarpus siliculosus]
Length=767

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            L+ GAE FEFQAEV+RLMDIIINSLY NKDIFLRELISNASDALDKIRFLS++D D L
Sbjct  50   LKDGAEAFEFQAEVNRLMDIIINSLYKNKDIFLRELISNASDALDKIRFLSVSDPDKL  107



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            +  + GAE+ EFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFL+LTD+ +L
Sbjct  41   KAFKEGAEQHEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLALTDESLL  100



>ref|XP_004994487.1| heat shock protein gp96 [Salpingoeca rosetta]
 gb|EGD72664.1| heat shock protein gp96 [Salpingoeca rosetta]
Length=850

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  A+ FEFQAEV+R+M +IINSLY NKDIFLRELISNASDALDKIRFLSLTDKD+L
Sbjct  82   LREKADTFEFQAEVNRMMKLIINSLYKNKDIFLRELISNASDALDKIRFLSLTDKDVL  139



>gb|AAT97075.1| tumor rejection antigen-like protein [Lymnaea stagnalis]
Length=141

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  +EKF+FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTD + L
Sbjct  69   KELRDKSEKFQFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDPNAL  128



>gb|EPS70213.1| hypothetical protein M569_04546, partial [Genlisea aurea]
Length=459

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFE+QAEVSRLMD+I+NSLYSNKD+FLRELISNASDALDK+RFLS+T+  +L
Sbjct  81   AEKFEYQAEVSRLMDLIVNSLYSNKDVFLRELISNASDALDKLRFLSVTEPQLL  134



>ref|XP_005823214.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
 gb|EKX36234.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
Length=839

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  263  KRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            K+ L  G +K EFQAEV RLMDIIINSLYS K+IFLRELISNASDALDKIRFLSLTD  +
Sbjct  63   KKALEQGGQKQEFQAEVGRLMDIIINSLYSKKEIFLRELISNASDALDKIRFLSLTDPKV  122

Query  443  L  445
            L
Sbjct  123  L  123



>ref|XP_003617951.1| Heat-shock protein [Medicago truncatula]
 gb|AET00910.1| heat shock protein 81-2 [Medicago truncatula]
Length=792

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  260  SKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKD  439
            S  T    AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T+ D
Sbjct  81   SNATSSPPAEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPD  140

Query  440  IL  445
            ++
Sbjct  141  LM  142



>gb|EYU43186.1| hypothetical protein MIMGU_mgv1a001565mg [Erythranthe guttata]
Length=794

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFE+QAEVSRLMD+I+NSLYSNKD+FLRELISNASDALDK+RFLS+TD  +L
Sbjct  86   AEKFEYQAEVSRLMDLIVNSLYSNKDVFLRELISNASDALDKLRFLSVTDPQLL  139



>ref|XP_011402246.1| Endoplasmin-like protein [Auxenochlorella protothecoides]
 gb|KFM29193.1| Endoplasmin-like protein [Auxenochlorella protothecoides]
Length=1046

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 47/58 (81%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             R GAE  +FQAEV+RLMDI+INSLYSNKDIFLRELISNA+DALDKIRFL+LTDK  L
Sbjct  30   FRKGAETMQFQAEVNRLMDILINSLYSNKDIFLRELISNAADALDKIRFLALTDKSQL  87



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  275  RAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + GAEKF FQAEV+RLMDI+I+SLYSNK+IFLRELISNA+DALDKIRFLSLTDK  L
Sbjct  49   KEGAEKFTFQAEVNRLMDILIHSLYSNKEIFLRELISNAADALDKIRFLSLTDKGQL  105



>ref|XP_004293459.1| PREDICTED: heat shock protein 90-1 [Fragaria vesca subsp. vesca]
Length=799

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  287  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD D+L
Sbjct  95   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDPDLL  147



>gb|ADY39524.1| putative heat shock protein gp-96 [Hottentotta judaicus]
Length=171

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + +R  AEKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTDK  L
Sbjct  68   KEMREKAEKFAFQAEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRVLSLTDKAAL  127



>ref|XP_006914764.1| PREDICTED: endoplasmin-like [Pteropus alecto]
Length=140

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            R LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  67   RELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  126



>ref|XP_011085393.1| PREDICTED: heat shock protein 83 [Sesamum indicum]
Length=796

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  287  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            EKFE+QAEVSRLMD+I+NSLYSNKD+FLRELISNASDALDK+RFLS+TD  +L
Sbjct  88   EKFEYQAEVSRLMDLIVNSLYSNKDVFLRELISNASDALDKLRFLSVTDPQLL  140



>dbj|BAG61085.1| unnamed protein product [Homo sapiens]
Length=163

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            R LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  67   RELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  126



>gb|AGX25162.1| heat shock protein, partial [Leptinotarsa decemlineata]
Length=291

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            R LR  +EKF FQ EV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTDK++L
Sbjct  69   RELREKSEKFAFQTEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRMLSLTDKEVL  128



>ref|XP_002157524.1| PREDICTED: endoplasmin-like [Hydra vulgaris]
Length=825

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEK  FQAEVSR+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTDK +L
Sbjct  73   KQLRESAEKHAFQAEVSRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDKSVL  132



>ref|XP_002117847.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
 gb|EDV19690.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
Length=669

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR   EK EFQAEVSR+M +IINSLY NK+IFLRELISN+SDALDKIRF+SLTDK++L
Sbjct  51   KELREKGEKSEFQAEVSRMMKLIINSLYRNKEIFLRELISNSSDALDKIRFMSLTDKEVL  110



>ref|XP_006299404.1| hypothetical protein CARUB_v10015564mg [Capsella rubella]
 gb|EOA32302.1| hypothetical protein CARUB_v10015564mg [Capsella rubella]
Length=799

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+TD +I
Sbjct  94   AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDSEI  146



>ref|XP_003401925.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin-like [Bombus terrestris]
Length=798

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQ EV+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  67   KELREKAEKFTFQTEVNRMMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  126



>ref|XP_008229890.1| PREDICTED: heat shock protein 90-1 [Prunus mume]
Length=813

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AE+FE+QAEV+RLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T+ D+L
Sbjct  91   AERFEYQAEVNRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPDLL  144



>ref|XP_010457327.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=800

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  278  AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
              AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+TD +I
Sbjct  93   PPAEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDSEI  147



>ref|XP_007214966.1| hypothetical protein PRUPE_ppa001503mg [Prunus persica]
 gb|EMJ16165.1| hypothetical protein PRUPE_ppa001503mg [Prunus persica]
Length=813

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AE+FE+QAEV+RLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T+ D+L
Sbjct  91   AERFEYQAEVNRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPDLL  144



>ref|XP_010486347.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=800

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  278  AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
              AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+TD +I
Sbjct  93   PPAEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDSEI  147



>tpg|DAA34121.1| TPA_exp: endoplasmic reticulum glucose-regulated protein [Amblyomma 
variegatum]
Length=207

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + +R  AEK  FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLT+ D+L
Sbjct  67   KEMREKAEKHAFQAEVTRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTNPDVL  126



>ref|XP_010464416.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=800

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  278  AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
              AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+TD +I
Sbjct  93   PPAEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDSEI  147



>ref|XP_011048941.1| PREDICTED: heat shock protein 83 isoform X3 [Populus euphratica]
Length=793

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD ++L
Sbjct  90   GEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELL  143



>ref|XP_011048939.1| PREDICTED: heat shock protein 83 isoform X2 [Populus euphratica]
Length=794

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD ++L
Sbjct  90   GEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELL  143



>ref|XP_011048938.1| PREDICTED: heat shock protein 83 isoform X1 [Populus euphratica]
Length=795

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD ++L
Sbjct  90   GEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELL  143



>ref|XP_002321183.2| hypothetical protein POPTR_0014s16280g [Populus trichocarpa]
 gb|EEE99498.2| hypothetical protein POPTR_0014s16280g [Populus trichocarpa]
Length=723

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD ++L
Sbjct  90   GEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSELL  143



>ref|XP_011494775.1| PREDICTED: endoplasmin [Ceratosolen solmsi marchali]
Length=786

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 8/76 (11%)
 Frame = +2

Query  242  REAESMS--------KRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASD  397
            REAE+++         + LR  AEKF+FQ EV+R+M +IINSLY NK+IFLRELISNASD
Sbjct  51   REAEAINIDGLNVSQVKELRDKAEKFQFQTEVNRMMKLIINSLYRNKEIFLRELISNASD  110

Query  398  ALDKIRFLSLTDKDIL  445
            ALDKIR LSLTDK+IL
Sbjct  111  ALDKIRLLSLTDKNIL  126



>ref|XP_006619420.1| PREDICTED: endoplasmin-like [Apis dorsata]
Length=798

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQ EV+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  67   KELREKAEKFTFQTEVNRIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  126



>ref|XP_395614.3| PREDICTED: endoplasmin-like isoform 1 [Apis mellifera]
Length=798

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQ EV+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  67   KELREKAEKFTFQTEVNRIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  126



>ref|XP_003493872.1| PREDICTED: endoplasmin-like [Bombus impatiens]
Length=798

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQ EV+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  67   KELREKAEKFTFQTEVNRMMRLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  126



>gb|KFK38234.1| hypothetical protein AALP_AA3G086500 [Arabis alpina]
Length=801

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+TD ++
Sbjct  94   AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDPEL  146



>ref|XP_006849050.1| hypothetical protein AMTR_s00028p00187760 [Amborella trichopoda]
 gb|ERN10631.1| hypothetical protein AMTR_s00028p00187760 [Amborella trichopoda]
Length=799

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            EA   +  T    AEKFE+QAEVSRLMD+I++SLYSNK++FLREL+SNASDALDK+RFLS
Sbjct  82   EATVAATDTSNPTAEKFEYQAEVSRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRFLS  141

Query  425  LTDKDIL  445
            +T+ ++L
Sbjct  142  VTEPELL  148



>gb|KJB10747.1| hypothetical protein B456_001G220600 [Gossypium raimondii]
Length=718

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  AESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSL  427
            A S S       AEK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+
Sbjct  83   AASDSGNPPPPPAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSV  142

Query  428  TDKDI  442
            TD  +
Sbjct  143  TDPQL  147



>ref|XP_003694125.1| PREDICTED: endoplasmin-like [Apis florea]
Length=831

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQ EV+R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  100  KELREKAEKFTFQTEVNRIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  159



>gb|KJB10746.1| hypothetical protein B456_001G220600 [Gossypium raimondii]
Length=796

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  AESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSL  427
            A S S       AEK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+
Sbjct  83   AASDSGNPPPPPAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSV  142

Query  428  TDKDI  442
            TD  +
Sbjct  143  TDPQL  147



>gb|KJB10745.1| hypothetical protein B456_001G220600 [Gossypium raimondii]
Length=797

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  AESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSL  427
            A S S       AEK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+
Sbjct  83   AASDSGNPPPPPAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSV  142

Query  428  TDKDI  442
            TD  +
Sbjct  143  TDPQL  147



>ref|XP_003575983.1| PREDICTED: heat shock protein 83 [Brachypodium distachyon]
Length=813

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFE+QAEV+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD D+L
Sbjct  106  AEKFEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLL  159



>ref|XP_010045864.1| PREDICTED: heat shock protein 83 [Eucalyptus grandis]
 gb|KCW88688.1| hypothetical protein EUGRSUZ_A01044 [Eucalyptus grandis]
Length=794

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T+  +L
Sbjct  89   AEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPQLL  142



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 2/55 (4%)
 Frame = +2

Query  281  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            G+EKFEFQAEVSRL  IIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ L
Sbjct  54   GSEKFEFQAEVSRL--IIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQL  106



>gb|AFM30925.1| chloroplast heat shock protein 90, partial [Prunus persica]
Length=134

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
             EKFE+QAEV+RLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +
Sbjct  82   GEKFEYQAEVTRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSL  134



>ref|XP_004243554.1| PREDICTED: heat shock protein 83 [Solanum lycopersicum]
Length=794

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            E+ + +  T  + +EKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFL 
Sbjct  77   ESTAAASDTSDSPSEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLG  136

Query  425  LTDKDIL  445
            +T+ ++L
Sbjct  137  VTEPELL  143



>gb|EMS64316.1| Heat shock protein 83 [Triticum urartu]
Length=768

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFE+QAEV+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD D+L
Sbjct  62   AEKFEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLL  115



>dbj|BAK01596.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFE+QAEV+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD D+L
Sbjct  108  AEKFEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLL  161



>gb|EMT31740.1| Heat shock protein 83 [Aegilops tauschii]
Length=792

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFE+QAEV+RLMD+I++SLYSNK++FLREL+SNASDALDK+R+LS+TD D+L
Sbjct  107  AEKFEYQAEVNRLMDLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLL  160



>gb|AAH09195.1| HSP90B1 protein [Homo sapiens]
Length=315

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            R LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  67   RELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  126



>ref|XP_002428463.1| Hsp90 protein, putative [Pediculus humanus corporis]
 gb|EEB15725.1| Hsp90 protein, putative [Pediculus humanus corporis]
Length=778

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQAEV+R+M +IINSLY NK+IFLRELISNA+DALDKIR LSLTDK +L
Sbjct  72   KELREKAEKFHFQAEVNRMMKLIINSLYRNKEIFLRELISNAADALDKIRLLSLTDKSVL  131



>gb|AIC62039.1| HSP90B1, partial [synthetic construct]
Length=315

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            R LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  67   RELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  126



>ref|XP_007049300.1| Heat shock protein 89.1 isoform 2 [Theobroma cacao]
 ref|XP_007049301.1| Heat shock protein 89.1 isoform 2 [Theobroma cacao]
 gb|EOX93457.1| Heat shock protein 89.1 isoform 2 [Theobroma cacao]
 gb|EOX93458.1| Heat shock protein 89.1 isoform 2 [Theobroma cacao]
Length=796

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  AESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSL  427
            A S S       AEK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+
Sbjct  82   AASDSANQPPPPAEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSV  141

Query  428  TDKDIL  445
            T+  +L
Sbjct  142  TEPQLL  147



>ref|XP_008464175.1| PREDICTED: heat shock protein 81-1 [Cucumis melo]
Length=790

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  287  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD  +L
Sbjct  95   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDPGLL  147



>gb|EAW97723.1| heat shock protein 90kDa beta (Grp94), member 1, isoform CRA_a, 
partial [Homo sapiens]
Length=367

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            R LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  95   RELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  154



>gb|EGT36283.1| hypothetical protein CAEBREN_28043 [Caenorhabditis brenneri]
Length=761

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR+ AEK EFQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTD D L
Sbjct  56   KELRSKAEKHEFQAEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDPDQL  115



>gb|KCW88689.1| hypothetical protein EUGRSUZ_A01044 [Eucalyptus grandis]
Length=752

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T+  +L
Sbjct  89   AEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTEPQLL  142



>ref|XP_004140007.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN46596.1| hypothetical protein Csa_6G111370 [Cucumis sativus]
Length=791

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  287  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD  +L
Sbjct  95   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSGLL  147



>ref|XP_009124159.1| PREDICTED: heat shock protein 90-1-like isoform X1 [Brassica 
rapa]
Length=802

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  287  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+TD D+
Sbjct  99   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDPDL  150



>emb|CDY22132.1| BnaC01g39690D [Brassica napus]
Length=804

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  287  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+TD D+
Sbjct  99   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDPDL  150



>ref|XP_004169550.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
Length=791

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +2

Query  287  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+TD  +L
Sbjct  95   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVTDSGLL  147



>ref|XP_002531697.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30688.1| heat shock protein, putative [Ricinus communis]
Length=799

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  AESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSL  427
            AES +        EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFL +
Sbjct  81   AESDASSPPPPVGEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLGV  140

Query  428  TDKDIL  445
            T+ ++L
Sbjct  141  TEPELL  146



>pdb|2ESA|A Chain A, Grp94 N-Terminal Domain Bound To Geldanamycin: Effects 
Of Mutants 168- 169 Ks-Aa
Length=236

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  5    LREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  62



>ref|XP_009605137.1| PREDICTED: heat shock protein 83 [Nicotiana tomentosiformis]
Length=791

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            +EKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFL +T  +IL
Sbjct  87   SEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLGVTQPEIL  140



>ref|XP_009124162.1| PREDICTED: heat shock protein 90-1-like isoform X2 [Brassica 
rapa]
Length=799

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  287  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+TD D+
Sbjct  96   EKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTDPDL  147



>ref|XP_002999135.1| heat shock protein 90, putative [Phytophthora infestans T30-4]
 gb|EEY69281.1| heat shock protein 90, putative [Phytophthora infestans T30-4]
Length=823

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             G EKFEFQAEVSRLMDI+INSLY  K+IFLRELISNASDALDKIRFL+L++ ++L
Sbjct  57   TGGEKFEFQAEVSRLMDILINSLYRTKEIFLRELISNASDALDKIRFLALSNNELL  112



>pdb|1U2O|A Chain A, Crystal Structure Of The N-Domain Of Grp94 Lacking The 
Charged Domain In Complex With Neca
 pdb|1U2O|B Chain B, Crystal Structure Of The N-Domain Of Grp94 Lacking The 
Charged Domain In Complex With Neca
 pdb|1TBW|A Chain A, Ligand Induced Conformational Shift In The N-Terminal 
Domain Of Grp94, Open Conformation
 pdb|1TBW|B Chain B, Ligand Induced Conformational Shift In The N-Terminal 
Domain Of Grp94, Open Conformation
 pdb|1TC0|A Chain A, Ligand Induced Conformational Shifts In The N-Terminal 
Domain Of Grp94, Open Conformation Complexed With The Physiological 
Partner Atp
 pdb|1TC0|B Chain B, Ligand Induced Conformational Shifts In The N-Terminal 
Domain Of Grp94, Open Conformation Complexed With The Physiological 
Partner Atp
 pdb|1TC6|A Chain A, Ligand Induced Conformational Shift In The N-Terminal 
Domain Of Grp94, Open Conformation Adp-Complex
 pdb|1TC6|B Chain B, Ligand Induced Conformational Shift In The N-Terminal 
Domain Of Grp94, Open Conformation Adp-Complex
 pdb|1U0Z|A Chain A, N-Domain Of Grp94 Lacking The Charged Domain In Complex 
With Radicicol
 pdb|1U0Z|B Chain B, N-Domain Of Grp94 Lacking The Charged Domain In Complex 
With Radicicol
 pdb|1YSZ|A Chain A, Crystal Structure Of The Unliganded Form Of Grp94, The 
Er Hsp90: Basis For Nucleotide-Induced Conformational Change, 
Grp94n(Delta)41 Apo Crystal Soaked With Neca
 pdb|1YT0|A Chain A, Crystal Structure Of The Unliganded Form Of Grp94, The 
Er Hsp90: Basis For Nucleotide-Induced Conformational Change, 
Grp94n(Delta)41 Apo Crystal Soaked With Adp
 pdb|1YT1|A Chain A, Crystal Structure Of The Unliganded Form Of Grp94, The 
Er Hsp90: Basis For Nucleotide-Induced Conformational Change, 
Grp94n(Delta)41 Apo Crystal
 pdb|1YT1|B Chain B, Crystal Structure Of The Unliganded Form Of Grp94, The 
Er Hsp90: Basis For Nucleotide-Induced Conformational Change, 
Grp94n(Delta)41 Apo Crystal
 pdb|2EXL|A Chain A, Grp94 N-Terminal Domain Bound To Geldanamycin
 pdb|2EXL|B Chain B, Grp94 N-Terminal Domain Bound To Geldanamycin
 pdb|2FYP|A Chain A, Grp94 In Complex With The Novel Hsp90 Inhibitor Radester 
Amine
 pdb|2FYP|B Chain B, Grp94 In Complex With The Novel Hsp90 Inhibitor Radester 
Amine
 pdb|2GFD|A Chain A, Grp94 In Complex With The Novel Hsp90 Inhibitor Radamide
 pdb|2GFD|B Chain B, Grp94 In Complex With The Novel Hsp90 Inhibitor Radamide
 pdb|2GQP|A Chain A, N-Domain Of Grp94 In Complex With The Novel Ligand N-Propyl 
Carboxyamido Adenosine
 pdb|2GQP|B Chain B, N-Domain Of Grp94 In Complex With The Novel Ligand N-Propyl 
Carboxyamido Adenosine
 pdb|2HCH|A Chain A, N-Domain Of Grp94 In Complex With The Novel Ligand N-(2- 
Amino)ethyl Carboxyamido Adenosine
 pdb|2HCH|B Chain B, N-Domain Of Grp94 In Complex With The Novel Ligand N-(2- 
Amino)ethyl Carboxyamido Adenosine
 pdb|2H8M|A Chain A, N-Domain Of Grp94 In Complex With The 2-Iodo-Neca
 pdb|2H8M|B Chain B, N-Domain Of Grp94 In Complex With The 2-Iodo-Neca
 pdb|2HG1|A Chain A, N-Domain Of Grp94 In Complex With The Novel Ligand N-(2- 
Hydroxyl)ethyl Carboxyamido Adenosine
 pdb|2HG1|B Chain B, N-Domain Of Grp94 In Complex With The Novel Ligand N-(2- 
Hydroxyl)ethyl Carboxyamido Adenosine
 pdb|3O2F|A Chain A, Structure Of The N-domain Of Grp94 Bound To The Hsp90 
Inhibitor Pu-h54
 pdb|3O2F|B Chain B, Structure Of The N-domain Of Grp94 Bound To The Hsp90 
Inhibitor Pu-h54
Length=236

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  5    LREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  62



>ref|XP_010657447.1| PREDICTED: heat shock protein 83 isoform X1 [Vitis vinifera]
Length=842

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFE+QAEVSRLMD+I++SLYSNK++FLRELISNASDALDK+RFLS+T+  +L
Sbjct  137  AEKFEYQAEVSRLMDLIVHSLYSNKEVFLRELISNASDALDKLRFLSVTEPQLL  190



>ref|XP_010657448.1| PREDICTED: heat shock protein 83 isoform X3 [Vitis vinifera]
Length=839

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFE+QAEVSRLMD+I++SLYSNK++FLRELISNASDALDK+RFLS+T+  +L
Sbjct  134  AEKFEYQAEVSRLMDLIVHSLYSNKEVFLRELISNASDALDKLRFLSVTEPQLL  187



>ref|XP_002535115.1| heat shock protein, putative [Ricinus communis]
 gb|EEF27267.1| heat shock protein, putative, partial [Ricinus communis]
Length=220

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 66/101 (65%), Gaps = 15/101 (15%)
 Frame = +2

Query  173  SSQG*RKDWWCSA--W--------FIHRS*CG*REAESMSKRTLRAGAEKFEFQAEVSRL  322
            ++ G RK + CS   W        F  R  C   EA    K       EKFE+QAEVSRL
Sbjct  44   NNNGLRKGFSCSGLKWKLDKRNNRFAVR--C---EAAVAEKEASDTSGEKFEYQAEVSRL  98

Query  323  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            +D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L
Sbjct  99   LDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL  139



>ref|XP_002270014.3| PREDICTED: heat shock protein 83 isoform X2 [Vitis vinifera]
Length=841

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            AEKFE+QAEVSRLMD+I++SLYSNK++FLRELISNASDALDK+RFLS+T+  +L
Sbjct  137  AEKFEYQAEVSRLMDLIVHSLYSNKEVFLRELISNASDALDKLRFLSVTEPQLL  190



>ref|XP_009365237.1| PREDICTED: heat shock protein 81-1, partial [Pyrus x bretschneideri]
Length=878

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  251  ESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLT  430
            ES +  +    AE +E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T
Sbjct  146  ESTAAASDAPPAETYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVT  205

Query  431  DKDIL  445
              ++L
Sbjct  206  QPELL  210



>ref|XP_002413149.1| tumor rejection antigen (gp96), putative [Ixodes scapularis]
 gb|EEC16457.1| tumor rejection antigen (gp96), putative, partial [Ixodes scapularis]
Length=789

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEK  FQAEVSR+M +IINSLY NK+IFLRELISNASDALDKIR LSLTD D+L
Sbjct  62   KELREKAEKHVFQAEVSRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDPDVL  121



>gb|KHN43948.1| Heat shock protein 90 [Glycine soja]
Length=788

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  G*REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  415
            G R   + +  +    AE++E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R
Sbjct  71   GKRYESTTAAESSSPPAERYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  130

Query  416  FLSLTDKDIL  445
            FLS+T+  +L
Sbjct  131  FLSVTESGLL  140



>ref|XP_008788962.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=796

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            EA    K    A  EKFE+QAEVSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS
Sbjct  69   EAAVADKEAEEASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLS  128

Query  425  LTDKDIL  445
            +TD  +L
Sbjct  129  VTDPSLL  135



>ref|XP_971540.1| PREDICTED: endoplasmin [Tribolium castaneum]
 gb|EFA10013.1| hypothetical protein TcasGA2_TC012185 [Tribolium castaneum]
 gb|AHF20221.1| heat shock protein 90 [Tribolium castaneum]
Length=782

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQ EV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTDK++L
Sbjct  68   KELRDKAEKFTFQTEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDKNVL  127



>ref|XP_003519663.1| PREDICTED: heat shock protein 83-like [Glycine max]
Length=791

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  236  G*REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  415
            G R   + +  +    AE++E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R
Sbjct  71   GKRYESTTAAESSSPPAERYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  130

Query  416  FLSLTDKDIL  445
            FLS+T+  +L
Sbjct  131  FLSVTESGLL  140



>ref|XP_002507383.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68641.1| predicted protein [Micromonas sp. RCC299]
Length=782

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  AESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSL  427
            AE+ ++    +G E +E+QAEV+RL+D+I+NSLYSN+D+FLREL+SNASDALDK+RF S+
Sbjct  51   AEAATEEKPASGGETYEYQAEVNRLLDLIVNSLYSNRDVFLRELVSNASDALDKLRFTSV  110

Query  428  TDKDIL  445
            ++ D++
Sbjct  111  SNPDVM  116



>pdb|4NH9|A Chain A, Correlation Between Chemotype-dependent Binding Conformations 
Of Hsp90 Alpha/beta And Isoform Selectivity
Length=273

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  5    LREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  62



>ref|XP_002882549.1| hypothetical protein ARALYDRAFT_896948 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58808.1| hypothetical protein ARALYDRAFT_896948 [Arabidopsis lyrata subsp. 
lyrata]
Length=799

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+T+ ++
Sbjct  94   AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPEL  146



>ref|XP_006363008.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=794

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            +EKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFL +T+ ++L
Sbjct  90   SEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLGVTEPELL  143



>ref|XP_009418533.1| PREDICTED: heat shock protein 83-like [Musa acuminata subsp. 
malaccensis]
Length=796

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            EA    K +  A  EKFE+QAEVSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS
Sbjct  70   EAAVAEKESEEASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLS  129

Query  425  LTDKDIL  445
            +TD  +L
Sbjct  130  VTDSSLL  136



>ref|XP_010091648.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXB44914.1| Endoplasmin-like protein [Morus notabilis]
Length=809

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  245  EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            EA    K    A  EKFE+QAEVSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS
Sbjct  70   EATVAEKEAADASGEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLS  129

Query  425  LTDKDIL  445
            +T+  +L
Sbjct  130  VTEPSLL  136



>dbj|BAF01546.1| heat shock like protein [Arabidopsis thaliana]
Length=313

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +2

Query  263  KRTLRAG-AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKD  439
            K T   G  EKFE+QAEVSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  
Sbjct  68   KETTEEGSGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPS  127

Query  440  IL  445
            +L
Sbjct  128  LL  129



>ref|XP_006407799.1| hypothetical protein EUTSA_v10020096mg [Eutrema salsugineum]
 gb|ESQ49252.1| hypothetical protein EUTSA_v10020096mg [Eutrema salsugineum]
Length=799

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+T+ ++
Sbjct  95   AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPEL  147



>gb|KGL81577.1| Endoplasmin, partial [Tinamus guttatus]
Length=216

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + +R  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  4    KEIREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  63



>ref|NP_187434.2| HEAT SHOCK PROTEIN 89.1 [Arabidopsis thaliana]
 gb|AEE74602.1| HEAT SHOCK PROTEIN 89.1 [Arabidopsis thaliana]
Length=799

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+T+ ++
Sbjct  94   AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPEL  146



>dbj|BAF00175.1| putative heat shock protein [Arabidopsis thaliana]
Length=799

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+T+ ++
Sbjct  94   AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPEL  146



>gb|AAF13098.1|AC009176_25 putative heat-shock protein [Arabidopsis thaliana]
 gb|AAF21187.1|AC013483_11 putative heat-shock protein [Arabidopsis thaliana]
Length=803

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            AEKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R+LS+T+ ++
Sbjct  94   AEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRYLSVTNPEL  146



>ref|XP_004957103.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=784

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             EKFE+QAEVSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+TD  +L
Sbjct  72   GEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTDPSVL  125



>ref|XP_010684690.1| PREDICTED: heat shock protein 83-like [Beta vulgaris subsp. vulgaris]
Length=766

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 2/69 (3%)
 Frame = +2

Query  242  REAESMSKRTLRAGA--EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  415
            R  ES +  +  +GA  EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R
Sbjct  68   RRYESTAAASDSSGAPVEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  127

Query  416  FLSLTDKDI  442
            FLS+T  ++
Sbjct  128  FLSVTQPEL  136



>dbj|BAF63637.1| glucose-regulated protein 94 [Crassostrea gigas]
Length=797

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEK  FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTDK  L
Sbjct  67   KELREKAEKHVFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDKSAL  126



>pdb|1U0Y|A Chain A, N-Domain Of Grp94, With The Charged Domain, In Complex 
With The Novel Ligand N-Propyl Carboxyamido Adenosine
 pdb|1YT2|A Chain A, Crystal Structure Of The Unliganded Form Of Grp94, The 
Er Hsp90: Basis For Nucleotide-Induced Conformational Change, 
Grp94n Apo Crystal
Length=273

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  5    LREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  62



>ref|XP_010665948.1| PREDICTED: heat shock protein 83 [Beta vulgaris subsp. vulgaris]
Length=787

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 2/69 (3%)
 Frame = +2

Query  242  REAESMSKRTLRAGA--EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  415
            R  ES +  +  +GA  EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+R
Sbjct  68   RRYESTAAASDSSGAPVEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLR  127

Query  416  FLSLTDKDI  442
            FLS+T  ++
Sbjct  128  FLSVTQPEL  136



>pdb|1QY5|A Chain A, Crystal Structure Of The N-Domain Of The Er Hsp90 Chaperone 
Grp94 In Complex With The Specific Ligand Neca
 pdb|1QY8|A Chain A, Crystal Structure Of The N-domain Of The Er Hsp90 Chaperone 
Grp94 In Complex With Radicicol
 pdb|1QYE|A Chain A, Crystal Structure Of The N-domain Of The Er Hsp90 Chaperone 
Grp94 In Complex With 2-chlorodideoxyadenosine
Length=269

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            LR  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  1    LREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  58



>ref|XP_008379983.1| PREDICTED: heat shock protein 90-1-like [Malus domestica]
Length=809

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  251  ESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLT  430
            ES +  +    AE +E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS+T
Sbjct  77   ESTAAASDAPPAETYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLSVT  136

Query  431  DKDIL  445
              ++L
Sbjct  137  QPELL  141



>ref|XP_011311739.1| PREDICTED: endoplasmin [Fopius arisanus]
Length=794

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQ EV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTDK++L
Sbjct  69   QELRNRAEKFTFQTEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDKNVL  128



>ref|XP_001746031.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ88926.1| predicted protein [Monosiga brevicollis MX1]
Length=744

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            A+KFEFQAEVSR+M +II+SLY NKDIFLRE+ISNASDALDKIR LSLTDK +L
Sbjct  13   ADKFEFQAEVSRMMKLIIHSLYKNKDIFLREIISNASDALDKIRLLSLTDKSVL  66



>ref|XP_009065664.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
 gb|ESO83635.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
Length=792

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF F+AEV+R+M +IINSLY NK+IFLRELISNASDALDKIRF+SLTDK  +
Sbjct  70   KELREKAEKFAFEAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFVSLTDKSAM  129



>emb|CAP26348.2| Protein CBG06014 [Caenorhabditis briggsae]
Length=776

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR+ AEK EFQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTD + L
Sbjct  56   KELRSKAEKHEFQAEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDPEQL  115



>gb|AFD53629.1| 90 kDa heat shock protein, partial [Cryptosporidium muris]
 gb|AFD53630.1| 90 kDa heat shock protein, partial [Cryptosporidium muris]
 gb|AFD53631.1| 90 kDa heat shock protein, partial [Cryptosporidium muris]
Length=146

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            ++  +E +EFQAEVSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L
Sbjct  61   IQKSSESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL  118



>gb|EKC38233.1| Endoplasmin [Crassostrea gigas]
Length=1082

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEK  FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTDK  L
Sbjct  352  KELREKAEKHVFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDKSAL  411



>ref|XP_009798975.1| PREDICTED: heat shock protein 83 [Nicotiana sylvestris]
Length=791

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            +EKFE+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFL +T  ++L
Sbjct  87   SEKFEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLGVTQPELL  140



>ref|XP_003107918.1| hypothetical protein CRE_12564 [Caenorhabditis remanei]
 gb|EFO93817.1| hypothetical protein CRE_12564 [Caenorhabditis remanei]
Length=761

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR+ AEK EFQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTD + L
Sbjct  56   KELRSKAEKHEFQAEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDPEQL  115



>gb|ADQ86002.1| 90 kDa heat shock protein [Cryptosporidium muris]
Length=139

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            ++  +E +EFQAEVSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L
Sbjct  64   IQKSSESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL  121



>gb|ADQ86000.1| 90 kDa heat shock protein [Cryptosporidium muris]
Length=139

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            ++  +E +EFQAEVSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L
Sbjct  64   IQKSSESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL  121



>gb|KDO70251.1| hypothetical protein CISIN_1g0038271mg, partial [Citrus sinensis]
Length=398

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             EKFE+QAEVSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L
Sbjct  80   GEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL  133



>ref|XP_010528013.1| PREDICTED: heat shock protein 90-1-like isoform X1 [Tarenaya 
hassleriana]
Length=799

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  263  KRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            K T  A  EKFE+QAEVSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +
Sbjct  75   KETAGASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSL  134

Query  443  L  445
            L
Sbjct  135  L  135



>gb|AGZ62517.1| 90 kDa heat shock protein, partial [Cryptosporidium muris]
Length=149

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            ++  +E +EFQAEVSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L
Sbjct  61   IQKSSESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL  118



>ref|XP_010528014.1| PREDICTED: heat shock protein 90-1-like isoform X2 [Tarenaya 
hassleriana]
Length=798

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +2

Query  263  KRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  442
            K T  A  EKFE+QAEVSRL+D+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +
Sbjct  75   KETAGASGEKFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSL  134

Query  443  L  445
            L
Sbjct  135  L  135



>ref|XP_003089202.1| hypothetical protein CRE_23240 [Caenorhabditis remanei]
 gb|EFO85601.1| hypothetical protein CRE_23240 [Caenorhabditis remanei]
Length=761

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR+ AEK EFQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTD + L
Sbjct  56   KELRSKAEKHEFQAEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDPEQL  115



>gb|ADQ86003.1| 90 kDa heat shock protein [Cryptosporidium muris]
Length=137

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            ++  +E +EFQAEVSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L
Sbjct  64   IQKSSESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL  121



>gb|ADQ86001.1| 90 kDa heat shock protein [Cryptosporidium muris]
Length=153

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            ++  +E +EFQAEVSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L
Sbjct  65   IQKSSESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL  122



>gb|KDR24512.1| Endoplasmin [Zootermopsis nevadensis]
Length=801

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQAEV+R+M +IINSLY NK+I+LRELISNASDALDKIR LSLTDK +L
Sbjct  68   KELRDKAEKFAFQAEVNRMMKLIINSLYRNKEIYLRELISNASDALDKIRILSLTDKSVL  127



>gb|ADQ85999.1| 90 kDa heat shock protein [Cryptosporidium muris]
Length=156

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            ++  +E +EFQAEVSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L
Sbjct  68   IQKSSENYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL  125



>ref|XP_010219153.1| PREDICTED: endoplasmin-like, partial [Tinamus guttatus]
Length=312

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + +R  +EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  94   KEIREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  153



>ref|XP_002633285.1| Hypothetical protein CBG06014 [Caenorhabditis briggsae]
Length=760

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR+ AEK EFQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTD + L
Sbjct  56   KELRSKAEKHEFQAEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDPEQL  115



>ref|NP_001255536.1| Protein ENPL-1, isoform a [Caenorhabditis elegans]
 sp|Q22235.1|ENPL1_CAEEL RecName: Full=Endoplasmin homolog; Flags: Precursor [Caenorhabditis 
elegans]
 emb|CAA92973.1| ENPL-1, isoform a [Caenorhabditis elegans]
Length=760

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR+ AEK EFQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTD + L
Sbjct  55   KELRSKAEKHEFQAEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDPEQL  114



>gb|KDP29908.1| hypothetical protein JCGZ_18477 [Jatropha curcas]
Length=805

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  AESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSL  427
            AES +        EK+E+QAEVSRLMD+I+NSLYSNK++FLRELISNASDALDK+RFL +
Sbjct  85   AESDASSYPPPVGEKYEYQAEVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLGV  144

Query  428  TDKDIL  445
            T+  +L
Sbjct  145  TEPGLL  150



>gb|AHG52035.1| 90 kDa heat shock protein, partial [Cryptosporidium andersoni]
Length=152

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  272  LRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            ++  +E +EFQAEVSRLMDIIINSLYS KD+FLREL+SN++DAL+K RF S+TDK  L
Sbjct  63   IQKSSESYEFQAEVSRLMDIIINSLYSQKDVFLRELLSNSADALEKARFTSVTDKSFL  120



>ref|XP_001702984.1| heat shock protein 90C [Chlamydomonas reinhardtii]
 gb|AAU10511.1| heat shock protein 90C [Chlamydomonas reinhardtii]
 gb|EDO96722.1| heat shock protein 90C [Chlamydomonas reinhardtii]
Length=810

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  AGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            +G+E F +QAEV RLMD+I+NSLYSN+++FLRELISNASDALDK RFLSLTD  +L
Sbjct  78   SGSETFTYQAEVDRLMDMIVNSLYSNREVFLRELISNASDALDKARFLSLTDPSVL  133



>gb|ABU45371.1| Hsp90B [Blastocladiella emersonii]
Length=785

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +2

Query  248  AESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSL  427
            A  +      AGAE+F FQ EVSR+M+IIINSLY  K+IFLRELISNASDA+DK+RFL +
Sbjct  32   ASDVPPPATEAGAEEFAFQTEVSRVMNIIINSLYKTKEIFLRELISNASDAVDKVRFLGI  91

Query  428  TDKDIL  445
            TDK +L
Sbjct  92   TDKAVL  97



>ref|XP_003617952.1| Heat-shock protein [Medicago truncatula]
Length=797

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 5/67 (7%)
 Frame = +2

Query  260  SKRTLRAGAEKFEFQAEV-----SRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLS  424
            S  T    AEKFE+QAEV     SRLMD+I+NSLYSNK++FLRELISNASDALDK+RFLS
Sbjct  81   SNATSSPPAEKFEYQAEVLPSFVSRLMDLIVNSLYSNKEVFLRELISNASDALDKLRFLS  140

Query  425  LTDKDIL  445
            +T+ D++
Sbjct  141  VTEPDLM  147



>ref|XP_001599282.1| PREDICTED: endoplasmin [Nasonia vitripennis]
Length=790

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF FQ EV+R+M +IINSLY NK+IFLRELISNASDA+DKIR LSLTDK++L
Sbjct  68   KELRDKAEKFNFQTEVNRMMKLIINSLYRNKEIFLRELISNASDAIDKIRLLSLTDKNVL  127



>gb|KDO70248.1| hypothetical protein CISIN_1g0038271mg, partial [Citrus sinensis]
 gb|KDO70249.1| hypothetical protein CISIN_1g0038271mg, partial [Citrus sinensis]
 gb|KDO70250.1| hypothetical protein CISIN_1g0038271mg, partial [Citrus sinensis]
Length=425

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  284  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
             EKFE+QAEVSRLMD+I++SLYS+K++FLREL+SNASDALDK+RFLS+T+  +L
Sbjct  80   GEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFLSVTEPSLL  133



>ref|XP_008559868.1| PREDICTED: endoplasmin [Microplitis demolitor]
Length=787

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  266  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  445
            + LR  AEKF F+ EV+R+M +IINSLY NK+IFLRELISN SDALDKIRFLSLTDK +L
Sbjct  67   QELRERAEKFTFETEVNRMMKLIINSLYKNKEIFLRELISNGSDALDKIRFLSLTDKSVL  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880