BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005G13

Length=519
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004251694.1|  PREDICTED: uncharacterized protein LOC101250962    228   1e-66   Solanum lycopersicum
ref|XP_006345262.1|  PREDICTED: uncharacterized protein LOC102582049    224   1e-65   Solanum tuberosum [potatoes]
ref|XP_006342396.1|  PREDICTED: poly [ADP-ribose] polymerase 4-like     224   2e-65   Solanum tuberosum [potatoes]
ref|XP_009777936.1|  PREDICTED: uncharacterized protein LOC104227395    222   1e-64   Nicotiana sylvestris
ref|XP_009624355.1|  PREDICTED: uncharacterized protein LOC104115430    221   4e-64   Nicotiana tomentosiformis
ref|XP_009796968.1|  PREDICTED: uncharacterized protein LOC104243478    219   1e-63   Nicotiana sylvestris
ref|XP_009597215.1|  PREDICTED: uncharacterized protein LOC104093199    218   3e-63   Nicotiana tomentosiformis
gb|EYU25841.1|  hypothetical protein MIMGU_mgv1a001817mg                213   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_008450941.1|  PREDICTED: uncharacterized protein LOC103492379    213   3e-61   Cucumis melo [Oriental melon]
emb|CDP03063.1|  unnamed protein product                                211   1e-60   Coffea canephora [robusta coffee]
ref|XP_010261798.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    209   5e-60   Nelumbo nucifera [Indian lotus]
ref|XP_004144038.1|  PREDICTED: uncharacterized protein LOC101210279    207   4e-59   Cucumis sativus [cucumbers]
ref|XP_011078106.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    203   9e-58   Sesamum indicum [beniseed]
ref|XP_011093845.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    203   1e-57   Sesamum indicum [beniseed]
ref|XP_011093846.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    203   1e-57   Sesamum indicum [beniseed]
gb|EPS65940.1|  hypothetical protein M569_08838                         201   1e-57   Genlisea aurea
ref|XP_010273856.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    201   2e-57   Nelumbo nucifera [Indian lotus]
ref|XP_002277641.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    202   3e-57   Vitis vinifera
ref|XP_011007767.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    201   4e-57   Populus euphratica
ref|XP_010273854.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    201   5e-57   Nelumbo nucifera [Indian lotus]
ref|XP_002324729.2|  inter-alpha-trypsin inhibitor heavy chain-re...    201   5e-57   
ref|XP_010273855.1|  PREDICTED: uncharacterized protein LOC104609...    200   8e-57   Nelumbo nucifera [Indian lotus]
ref|XP_009110301.1|  PREDICTED: uncharacterized protein LOC103835866    201   8e-57   Brassica rapa
ref|XP_010273853.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    200   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009149386.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    200   1e-56   Brassica rapa
emb|CDY26699.1|  BnaA06g13230D                                          200   1e-56   Brassica napus [oilseed rape]
ref|XP_002516254.1|  inter-alpha-trypsin inhibitor heavy chain, p...    199   2e-56   Ricinus communis
ref|XP_010531895.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    199   2e-56   Tarenaya hassleriana [spider flower]
emb|CDX81914.1|  BnaC08g36870D                                          199   3e-56   
emb|CDY41019.1|  BnaC05g14770D                                          199   4e-56   Brassica napus [oilseed rape]
emb|CDX83787.1|  BnaC08g18580D                                          197   1e-55   
gb|KJB65319.1|  hypothetical protein B456_010G089800                    196   1e-55   Gossypium raimondii
gb|KJB65320.1|  hypothetical protein B456_010G089800                    196   1e-55   Gossypium raimondii
emb|CDY21682.1|  BnaA09g44330D                                          197   2e-55   Brassica napus [oilseed rape]
emb|CDX96680.1|  BnaA08g22230D                                          197   2e-55   
ref|XP_003551107.1|  PREDICTED: von Willebrand factor A domain-co...    196   3e-55   Glycine max [soybeans]
gb|KFK44049.1|  hypothetical protein AALP_AA1G209400                    196   4e-55   Arabis alpina [alpine rockcress]
ref|XP_006416537.1|  hypothetical protein EUTSA_v10006890mg             196   4e-55   Eutrema salsugineum [saltwater cress]
gb|KHG11270.1|  von Willebrand factor A domain-containing               195   9e-55   Gossypium arboreum [tree cotton]
gb|KDP33933.1|  hypothetical protein JCGZ_07504                         195   9e-55   Jatropha curcas
gb|KJB65322.1|  hypothetical protein B456_010G089800                    194   1e-54   Gossypium raimondii
gb|KJB65318.1|  hypothetical protein B456_010G089800                    194   1e-54   Gossypium raimondii
ref|XP_004508009.1|  PREDICTED: uncharacterized protein LOC101514299    193   3e-54   Cicer arietinum [garbanzo]
ref|XP_007012610.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    193   4e-54   
ref|XP_007012611.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    193   4e-54   
ref|XP_010100827.1|  hypothetical protein L484_000119                   180   4e-54   
ref|XP_009117566.1|  PREDICTED: uncharacterized protein LOC103842665    192   6e-54   Brassica rapa
gb|KHN17734.1|  von Willebrand factor A domain-containing protein       192   6e-54   Glycine soja [wild soybean]
gb|KEH32427.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...    190   9e-54   Medicago truncatula
gb|KDO73865.1|  hypothetical protein CISIN_1g004349mg                   190   1e-53   Citrus sinensis [apfelsine]
gb|AES92187.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...    191   2e-53   Medicago truncatula
ref|XP_006452826.1|  hypothetical protein CICLE_v10007546mg             189   2e-53   
ref|XP_002890318.1|  hypothetical protein ARALYDRAFT_472131             191   3e-53   
ref|XP_010497257.1|  PREDICTED: uncharacterized protein LOC104774321    185   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_004287649.1|  PREDICTED: uncharacterized protein LOC101300180    190   5e-53   Fragaria vesca subsp. vesca
ref|XP_003609990.1|  von Willebrand factor A domain-containing pr...    190   5e-53   
gb|KDO73864.1|  hypothetical protein CISIN_1g004349mg                   190   6e-53   Citrus sinensis [apfelsine]
ref|XP_008782726.1|  PREDICTED: LOW QUALITY PROTEIN: inter alpha-...    189   6e-53   
ref|XP_006452827.1|  hypothetical protein CICLE_v10007546mg             189   8e-53   Citrus clementina [clementine]
ref|XP_006474710.1|  PREDICTED: uncharacterized protein LOC102609180    188   2e-52   Citrus sinensis [apfelsine]
ref|XP_010477113.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    187   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010459567.1|  PREDICTED: uncharacterized protein LOC104740606    187   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010498320.1|  PREDICTED: uncharacterized protein LOC104776024    187   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010537665.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    187   4e-52   Tarenaya hassleriana [spider flower]
ref|NP_173345.2|  inter-alpha-trypsin inhibitor heavy chain-like ...    187   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008388928.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    187   4e-52   
gb|AAF79294.1|AC068602_17  F14D16.26                                    187   5e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010537666.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    187   5e-52   Tarenaya hassleriana [spider flower]
ref|XP_010537667.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    187   5e-52   Tarenaya hassleriana [spider flower]
ref|XP_006306812.1|  hypothetical protein CARUB_v10008355mg             187   6e-52   
ref|XP_007204639.1|  hypothetical protein PRUPE_ppa001864mg             187   7e-52   Prunus persica
ref|XP_010537668.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    186   7e-52   Tarenaya hassleriana [spider flower]
ref|XP_008337841.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    186   8e-52   Malus domestica [apple tree]
ref|XP_008242259.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    186   9e-52   Prunus mume [ume]
ref|XP_003542365.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    186   1e-51   Glycine max [soybeans]
ref|XP_010937323.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    186   1e-51   Elaeis guineensis
ref|XP_009359719.1|  PREDICTED: uncharacterized protein LOC103950254    185   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_004488095.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    184   4e-51   Cicer arietinum [garbanzo]
ref|XP_010242255.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    184   5e-51   Nelumbo nucifera [Indian lotus]
ref|XP_007154569.1|  hypothetical protein PHAVU_003G129800g             183   1e-50   Phaseolus vulgaris [French bean]
ref|XP_010666845.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    183   1e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003595328.1|  Inter-alpha-trypsin inhibitor heavy chain H3       182   3e-50   Medicago truncatula
ref|XP_007138646.1|  hypothetical protein PHAVU_009G226200g             182   3e-50   Phaseolus vulgaris [French bean]
ref|XP_002271630.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    182   3e-50   Vitis vinifera
ref|XP_010654417.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    182   4e-50   Vitis vinifera
ref|XP_009404352.1|  PREDICTED: uncharacterized protein LOC103987694    179   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB07322.1|  hypothetical protein B456_001G016000                    177   1e-48   Gossypium raimondii
gb|KJB07324.1|  hypothetical protein B456_001G016000                    176   2e-48   Gossypium raimondii
gb|KJB07323.1|  hypothetical protein B456_001G016000                    177   2e-48   Gossypium raimondii
gb|KJB07327.1|  hypothetical protein B456_001G016000                    176   3e-48   Gossypium raimondii
gb|KCW79380.1|  hypothetical protein EUGRSUZ_C00792                     175   4e-48   Eucalyptus grandis [rose gum]
ref|XP_009389548.1|  PREDICTED: uncharacterized protein LOC103976087    176   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG29331.1|  von Willebrand factor A domain-containing               176   6e-48   Gossypium arboreum [tree cotton]
ref|XP_010047465.1|  PREDICTED: uncharacterized protein LOC104436401    175   7e-48   Eucalyptus grandis [rose gum]
gb|KJB82978.1|  hypothetical protein B456_013G222900                    172   9e-47   Gossypium raimondii
ref|XP_009625881.1|  PREDICTED: von Willebrand factor A domain-co...    169   8e-46   Nicotiana tomentosiformis
ref|XP_009625882.1|  PREDICTED: von Willebrand factor A domain-co...    169   9e-46   Nicotiana tomentosiformis
emb|CDO97834.1|  unnamed protein product                                168   3e-45   Coffea canephora [robusta coffee]
ref|XP_010318476.1|  PREDICTED: von Willebrand factor A domain-co...    167   3e-45   Solanum lycopersicum
ref|XP_009764208.1|  PREDICTED: uncharacterized protein LOC104215...    166   1e-44   Nicotiana sylvestris
ref|XP_009764209.1|  PREDICTED: uncharacterized protein LOC104215...    166   1e-44   Nicotiana sylvestris
gb|KCW71314.1|  hypothetical protein EUGRSUZ_F04397                     165   1e-44   Eucalyptus grandis [rose gum]
ref|XP_006587053.1|  PREDICTED: uncharacterized protein LOC100820133    166   1e-44   Glycine max [soybeans]
ref|XP_010318475.1|  PREDICTED: uncharacterized protein LOC101253...    166   2e-44   Solanum lycopersicum
gb|KCW71313.1|  hypothetical protein EUGRSUZ_F04397                     165   2e-44   Eucalyptus grandis [rose gum]
ref|XP_004235553.1|  PREDICTED: uncharacterized protein LOC101253...    166   2e-44   Solanum lycopersicum
ref|XP_010318474.1|  PREDICTED: uncharacterized protein LOC101253...    166   2e-44   Solanum lycopersicum
gb|EYU21307.1|  hypothetical protein MIMGU_mgv1a001939mg                165   3e-44   Erythranthe guttata [common monkey flower]
gb|KCW71310.1|  hypothetical protein EUGRSUZ_F04397                     164   4e-44   Eucalyptus grandis [rose gum]
ref|XP_007216978.1|  hypothetical protein PRUPE_ppa002885mg             164   4e-44   
ref|XP_010064019.1|  PREDICTED: uncharacterized protein LOC104450974    164   5e-44   Eucalyptus grandis [rose gum]
ref|XP_009414823.1|  PREDICTED: uncharacterized protein LOC103995...    162   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008228173.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    162   5e-43   Prunus mume [ume]
gb|KJB35007.1|  hypothetical protein B456_006G094900                    162   6e-43   Gossypium raimondii
ref|XP_008373868.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    161   7e-43   Malus domestica [apple tree]
gb|KJB35006.1|  hypothetical protein B456_006G094900                    162   7e-43   Gossypium raimondii
ref|XP_004141711.1|  PREDICTED: uncharacterized protein LOC101206287    161   8e-43   Cucumis sativus [cucumbers]
ref|XP_008462286.1|  PREDICTED: uncharacterized protein LOC103500...    161   1e-42   Cucumis melo [Oriental melon]
ref|XP_009414822.1|  PREDICTED: uncharacterized protein LOC103995...    161   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO64973.1|  hypothetical protein CISIN_1g004469mg                   159   1e-42   Citrus sinensis [apfelsine]
gb|KDO64974.1|  hypothetical protein CISIN_1g004469mg                   159   1e-42   Citrus sinensis [apfelsine]
ref|XP_008462285.1|  PREDICTED: uncharacterized protein LOC103500...    160   2e-42   Cucumis melo [Oriental melon]
gb|KEH18486.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...    159   2e-42   Medicago truncatula
gb|KEH18485.1|  inter-alpha-trypsin inhibitor heavy chain-like pr...    159   2e-42   Medicago truncatula
ref|XP_004510514.1|  PREDICTED: uncharacterized protein LOC101499440    159   6e-42   Cicer arietinum [garbanzo]
gb|AET01809.2|  inter-alpha-trypsin inhibitor heavy chain-like pr...    159   7e-42   Medicago truncatula
gb|KDO64972.1|  hypothetical protein CISIN_1g004469mg                   159   8e-42   Citrus sinensis [apfelsine]
ref|XP_006465891.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    159   8e-42   Citrus sinensis [apfelsine]
ref|XP_006342928.1|  PREDICTED: uncharacterized protein LOC102599336    158   9e-42   Solanum tuberosum [potatoes]
ref|XP_006426697.1|  hypothetical protein CICLE_v10024980mg             158   1e-41   
ref|XP_007135424.1|  hypothetical protein PHAVU_010G128200g             157   2e-41   Phaseolus vulgaris [French bean]
ref|XP_011072601.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    157   2e-41   Sesamum indicum [beniseed]
ref|XP_006583165.1|  PREDICTED: uncharacterized protein LOC100807...    156   4e-41   Glycine max [soybeans]
ref|XP_003528576.1|  PREDICTED: uncharacterized protein LOC100807...    157   5e-41   Glycine max [soybeans]
ref|XP_010111991.1|  von Willebrand factor A domain-containing pr...    156   7e-41   
ref|XP_007135423.1|  hypothetical protein PHAVU_010G128200g             155   1e-40   Phaseolus vulgaris [French bean]
ref|XP_007024661.1|  Inter-alpha-trypsin inhibitor heavy chain-re...    154   3e-40   
ref|XP_009344471.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    154   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_010685291.1|  PREDICTED: uncharacterized protein LOC104899734    154   5e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004303707.1|  PREDICTED: von Willebrand factor A domain-co...    154   5e-40   Fragaria vesca subsp. vesca
ref|XP_008342579.1|  PREDICTED: uncharacterized protein LOC103405374    154   5e-40   Malus domestica [apple tree]
ref|XP_002532724.1|  inter-alpha-trypsin inhibitor heavy chain, p...    151   3e-39   Ricinus communis
gb|KDP40680.1|  hypothetical protein JCGZ_24679                         150   9e-39   Jatropha curcas
gb|KFK41669.1|  hypothetical protein AALP_AA2G157400                    150   1e-38   Arabis alpina [alpine rockcress]
gb|KHN01425.1|  Inter-alpha-trypsin inhibitor heavy chain H3            149   2e-38   Glycine soja [wild soybean]
ref|XP_009337232.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    149   4e-38   
emb|CDX72920.1|  BnaC06g33680D                                          148   8e-38   
ref|XP_009105911.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    147   8e-38   Brassica rapa
ref|XP_011035746.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    146   1e-37   Populus euphratica
gb|KHG04434.1|  von Willebrand factor A domain-containing               146   2e-37   Gossypium arboreum [tree cotton]
ref|XP_011035745.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    145   3e-37   Populus euphratica
ref|XP_010428136.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    145   1e-36   
ref|XP_011035743.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    144   2e-36   Populus euphratica
ref|XP_011035744.1|  PREDICTED: uncharacterized protein LOC105133...    144   2e-36   Populus euphratica
ref|XP_002888881.1|  hypothetical protein ARALYDRAFT_476383             143   5e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_010471276.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    141   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006385519.1|  hypothetical protein POPTR_0003s06600g             139   2e-35   
ref|XP_006385520.1|  hypothetical protein POPTR_0003s06600g             139   3e-35   
ref|XP_010416000.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    140   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006385522.1|  hypothetical protein POPTR_0003s06600g             139   6e-35   
ref|XP_006301970.1|  hypothetical protein CARUB_v10022450mg             139   7e-35   Capsella rubella
ref|XP_011036461.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    138   1e-34   Populus euphratica
ref|XP_006390650.1|  hypothetical protein EUTSA_v10018177mg             139   1e-34   Eutrema salsugineum [saltwater cress]
ref|XP_006385521.1|  hypothetical protein POPTR_0003s06600g             138   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002304123.1|  hypothetical protein POPTR_0003s06600g             138   3e-34   
ref|NP_177394.2|  uncharacterized protein                               137   6e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52586.1|AC016529_17  hypothetical protein; 14673-17893            137   7e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036459.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    136   1e-33   Populus euphratica
ref|XP_011036458.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...    136   1e-33   Populus euphratica
ref|XP_006836596.1|  hypothetical protein AMTR_s00131p00098870          134   8e-33   Amborella trichopoda
ref|XP_003627333.1|  hypothetical protein MTR_8g021230                  129   1e-32   
ref|XP_010537629.1|  PREDICTED: uncharacterized protein LOC104812256    130   9e-32   Tarenaya hassleriana [spider flower]
dbj|BAJ95100.1|  predicted protein                                      129   5e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN39616.1|  Inter-alpha-trypsin inhibitor heavy chain H5            128   9e-31   Glycine soja [wild soybean]
tpg|DAA41434.1|  TPA: hypothetical protein ZEAMMB73_769800              126   4e-30   
tpg|DAA41433.1|  TPA: hypothetical protein ZEAMMB73_769800              127   5e-30   
ref|XP_010235662.1|  PREDICTED: uncharacterized protein LOC100843408    125   8e-30   Brachypodium distachyon [annual false brome]
ref|XP_002461009.1|  hypothetical protein SORBIDRAFT_02g039160          124   1e-29   Sorghum bicolor [broomcorn]
gb|ABF96529.1|  von Willebrand factor type A domain containing pr...    122   6e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABF96530.1|  von Willebrand factor type A domain containing pr...    122   7e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAU89244.1|  von Willebrand factor type A domain containing pr...    122   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010242206.1|  PREDICTED: uncharacterized protein LOC104586618    113   2e-28   Nelumbo nucifera [Indian lotus]
gb|ABF96527.1|  von Willebrand factor type A domain containing pr...    121   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650182.1|  PREDICTED: uncharacterized protein LOC102717967    121   2e-28   Oryza brachyantha
ref|XP_003557739.1|  PREDICTED: uncharacterized protein LOC100836064    120   3e-28   Brachypodium distachyon [annual false brome]
gb|EEE67586.1|  hypothetical protein OsJ_25118                          120   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958289.1|  PREDICTED: uncharacterized protein LOC101756562    120   5e-28   
tpg|DAA63586.1|  TPA: hypothetical protein ZEAMMB73_270893              119   9e-28   
gb|EEC82439.1|  hypothetical protein OsI_26857                          119   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_002465153.1|  hypothetical protein SORBIDRAFT_01g032840          117   7e-27   Sorghum bicolor [broomcorn]
ref|XP_006658810.1|  PREDICTED: inter alpha-trypsin inhibitor, he...    114   5e-26   
ref|XP_008667805.1|  PREDICTED: hypothetical protein isoform X1         108   6e-24   
gb|EEE59232.1|  hypothetical protein OsJ_11214                          106   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984064.1|  PREDICTED: uncharacterized protein LOC101774...    106   3e-23   Setaria italica
ref|XP_006593107.1|  PREDICTED: palmitoyl-protein thioesterase 1-...  94.7    4e-20   
ref|XP_002446722.1|  hypothetical protein SORBIDRAFT_06g021180        67.4    3e-11   
ref|XP_001768544.1|  predicted protein                                68.6    3e-10   
gb|KHN07890.1|  von Willebrand factor A domain-containing protein     68.2    4e-10   Glycine soja [wild soybean]
ref|XP_001770617.1|  predicted protein                                66.6    1e-09   
ref|XP_010253846.1|  PREDICTED: protein TIME FOR COFFEE-like          65.5    2e-09   
gb|EEE51525.1|  hypothetical protein OsJ_32720                        57.8    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67542.1|  hypothetical protein OsI_34867                        55.5    2e-07   Oryza sativa Indica Group [Indian rice]
gb|KJB83726.1|  hypothetical protein B456_013G261400                  57.8    1e-06   Gossypium raimondii
ref|XP_006598837.1|  PREDICTED: inter-alpha-trypsin inhibitor hea...  55.5    4e-06   Glycine max [soybeans]
ref|XP_011458408.1|  PREDICTED: calcium-dependent protein kinase ...  53.1    2e-05   Fragaria vesca subsp. vesca



>ref|XP_004251694.1| PREDICTED: uncharacterized protein LOC101250962 [Solanum lycopersicum]
Length=753

 Score =   228 bits (580),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  345
            EF  +VEDGLRLSK+I FGKDRAVAPP+ MTAMEKTA SY P++PM+YAVIENPA VDNP
Sbjct  6    EFVKSVEDGLRLSKQIYFGKDRAVAPPKQMTAMEKTAESYFPTSPMMYAVIENPAFVDNP  65

Query  346  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            D+PSYQPHVHGRCDPPALIPLQMN +S+AA+CY DTAF+TVTGSWR+HCVM SRSCDC
Sbjct  66   DIPSYQPHVHGRCDPPALIPLQMNGVSIAADCYFDTAFITVTGSWRLHCVMSSRSCDC  123



>ref|XP_006345262.1| PREDICTED: uncharacterized protein LOC102582049 [Solanum tuberosum]
Length=754

 Score =   224 bits (572),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 95/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  345
            EF  +VEDGLRLSKRI FGKDRAVAPP+ MTAMEKTA SY P++PM+YAVIENPA VDNP
Sbjct  6    EFVKSVEDGLRLSKRIYFGKDRAVAPPKQMTAMEKTAESYFPTSPMMYAVIENPASVDNP  65

Query  346  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            D+PSYQPHVHGRCDPPALIPLQMN +S+AA+CY DTAF+TV GSWR+HCVM  RSCDC
Sbjct  66   DIPSYQPHVHGRCDPPALIPLQMNGVSIAADCYFDTAFITVKGSWRLHCVMSCRSCDC  123



>ref|XP_006342396.1| PREDICTED: poly [ADP-ribose] polymerase 4-like [Solanum tuberosum]
Length=752

 Score =   224 bits (572),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M GEF  +VEDG+ L+KRI FGKDRAVAPP+ MTAMEK + SYLP +PMLYAVI +PA+V
Sbjct  1    MEGEFVKSVEDGVHLAKRIYFGKDRAVAPPKPMTAMEKASLSYLPESPMLYAVIGDPAIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGRCDPPALIPLQMN IS+ A+CYLDTAF+TVTGSWRVHCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNGISLEADCYLDTAFITVTGSWRVHCVMGSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_009777936.1| PREDICTED: uncharacterized protein LOC104227395 [Nicotiana sylvestris]
Length=757

 Score =   222 bits (566),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  345
            EF   VEDG+RLSKRI FGKDRAVAPP+ MTAM+K A SYLP++PM+YAVIENPA+VDNP
Sbjct  6    EFVKCVEDGIRLSKRIYFGKDRAVAPPKPMTAMDKAAQSYLPTSPMMYAVIENPAIVDNP  65

Query  346  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            D+PSYQPHVHGRCDPPALIPLQMN ISV A+CY DTA VTVTGSWR+HCVM SRSCDC
Sbjct  66   DIPSYQPHVHGRCDPPALIPLQMNGISVVADCYYDTAVVTVTGSWRLHCVMSSRSCDC  123



>ref|XP_009624355.1| PREDICTED: uncharacterized protein LOC104115430 [Nicotiana tomentosiformis]
Length=757

 Score =   221 bits (562),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  345
            EF   VEDG+RLSKRI FGKDRAVAPP+ M AM+K A SYLP++PM+YAVIENPA+VDNP
Sbjct  6    EFVKCVEDGIRLSKRIYFGKDRAVAPPKPMAAMDKAAQSYLPTSPMMYAVIENPAIVDNP  65

Query  346  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            D+PSYQPHVHGRCDPPALIPLQMN +SVAA+CY DTA +TVTGSWR+HCVM SRSCDC
Sbjct  66   DIPSYQPHVHGRCDPPALIPLQMNGVSVAADCYFDTAVITVTGSWRLHCVMSSRSCDC  123



>ref|XP_009796968.1| PREDICTED: uncharacterized protein LOC104243478 [Nicotiana sylvestris]
Length=753

 Score =   219 bits (558),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  AVEDG+ LSKRI FGKDRAVAPP+ MTAMEK + SYLP +PMLYAVI +PA+V
Sbjct  1    MAEEFVKAVEDGVHLSKRIYFGKDRAVAPPKPMTAMEKASQSYLPESPMLYAVINDPAIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDT-AFVTVTGSWRVHCVMGSRSC  513
            DNPD+PSYQPHVHGRCDPPALIPLQMN IS+ A+CYLD  AF+TVTGSWRVHCVMGSRSC
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNGISLEADCYLDNMAFITVTGSWRVHCVMGSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_009597215.1| PREDICTED: uncharacterized protein LOC104093199 [Nicotiana tomentosiformis]
Length=753

 Score =   218 bits (556),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  AVEDG+ LSKRI FGKDRAVAPP+ MTAMEK + SYLP +PMLYAVI +PA+V
Sbjct  1    MAEEFVKAVEDGVHLSKRIYFGKDRAVAPPKPMTAMEKASQSYLPESPMLYAVINDPAIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDT-AFVTVTGSWRVHCVMGSRSC  513
            DNPD+PSYQPHVHGRCDPPALIPLQMN IS+ A+CYLD  AF+TVTGSWRVHCVMGSRSC
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNGISLEADCYLDNMAFITVTGSWRVHCVMGSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>gb|EYU25841.1| hypothetical protein MIMGU_mgv1a001817mg [Erythranthe guttata]
Length=755

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA-HSYLPSAPMLYAVIENPAV  333
            MA +F AAVEDGLRLSKR+ FGKDRAVAPP+  TAME+ A +SYLP++PM+YAVI +PA+
Sbjct  1    MAEDFEAAVEDGLRLSKRVYFGKDRAVAPPKPPTAMERAAGYSYLPNSPMVYAVISDPAI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDPPALIPLQMN +S+  +CYLDTAFVTVTG+WRVHCVMGSRSC
Sbjct  61   VDNPDMPSYQPHVHGRCDPPALIPLQMNGVSLEVDCYLDTAFVTVTGTWRVHCVMGSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_008450941.1| PREDICTED: uncharacterized protein LOC103492379 [Cucumis melo]
Length=755

 Score =   213 bits (541),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 90/121 (74%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA AV+DGLRLSKR+ FGKDRAVAPPR+   M++  HS+LP+APM+YAVI +P +V
Sbjct  1    MAEDFAKAVDDGLRLSKRLYFGKDRAVAPPRSFPTMDRMDHSFLPTAPMVYAVIHDPGIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGRCDPPALIPLQMN+I + A+CYLDTA + +TGSWRVHCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNAIELQADCYLDTAIIRITGSWRVHCVMGSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>emb|CDP03063.1| unnamed protein product [Coffea canephora]
Length=748

 Score =   211 bits (537),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS-YLPSAPMLYAVIENPAV  333
            MA EFA AVEDGLRLSKRI FGKDRAVAPP+ +T M+KT    YLP+A M+YAVI +PA+
Sbjct  1    MAEEFARAVEDGLRLSKRIYFGKDRAVAPPKPITPMDKTPQQMYLPTAVMIYAVIGDPAI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPDVPSYQPHVHGRCDPPALIPLQMN +S+  +C+LDTAFVTV+GSWRVHCVMGSR+C
Sbjct  61   VDNPDVPSYQPHVHGRCDPPALIPLQMNGVSLEVDCFLDTAFVTVSGSWRVHCVMGSRAC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_010261798.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=753

 Score =   209 bits (533),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 91/121 (75%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +F  +VEDGL+L+KRI FG DR+V+PPR + AMEK++H+ LP++PMLYAVI +PA+V
Sbjct  1    MAQQFVKSVEDGLKLAKRIYFGNDRSVSPPRPV-AMEKSSHTLLPTSPMLYAVISDPAIV  59

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGRCDPPALIPLQMN+ISV  +CYLDTAFVTV GSWRVHCV GSRSCD
Sbjct  60   DNPDIPSYQPHVHGRCDPPALIPLQMNAISVEVDCYLDTAFVTVNGSWRVHCVKGSRSCD  119

Query  517  C  519
            C
Sbjct  120  C  120



>ref|XP_004144038.1| PREDICTED: uncharacterized protein LOC101210279 [Cucumis sativus]
 ref|XP_004170362.1| PREDICTED: uncharacterized protein LOC101231061 [Cucumis sativus]
 gb|KGN66313.1| hypothetical protein Csa_1G597110 [Cucumis sativus]
Length=755

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA AV+DGLRLSKR+ FGKDRAVAPPR+   M++  HS+LP+APM+YAVI +P +V
Sbjct  1    MAEDFAKAVDDGLRLSKRLYFGKDRAVAPPRSFPTMDRMDHSFLPTAPMVYAVIHDPGIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGRCDPPALIPLQMN++ + A+CYLD A + +TGSWRVHCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNAVELQADCYLDKAIIRITGSWRVHCVMGSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_011078106.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Sesamum indicum]
Length=764

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 109/122 (89%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA-HSYLPSAPMLYAVIENPAV  333
            MA +F AAVEDGLRLSKRI FGKDRAVAPP+  T M++++ H +LP++PM+YAVI NP++
Sbjct  1    MAEDFQAAVEDGLRLSKRIYFGKDRAVAPPKPPTEMDRSSEHPFLPTSPMVYAVISNPSI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHG+CDPPAL+PLQMN IS+  ECY+DTAF+TV GSWRVHCVMGSRSC
Sbjct  61   VDNPDMPSYQPYVHGKCDPPALMPLQMNGISMEVECYMDTAFITVNGSWRVHCVMGSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_011093845.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Sesamum indicum]
Length=758

 Score =   203 bits (516),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  333
            MA +F AAVE+GL LSKR+ FGKDRAVAPP+ +TAM++ T  SYLP++PMLYAVI +PA+
Sbjct  1    MAEDFEAAVEEGLNLSKRVYFGKDRAVAPPKPLTAMDRATGCSYLPTSPMLYAVISDPAI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD PSYQPHVHGRC+PPALIPLQMN +S+  +C LDTAFVTVTG+WR+HCVM SRSC
Sbjct  61   VDNPDRPSYQPHVHGRCEPPALIPLQMNGVSLEVDCSLDTAFVTVTGTWRLHCVMSSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_011093846.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Sesamum indicum]
Length=756

 Score =   203 bits (516),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  333
            MA +F AAVE+GL LSKR+ FGKDRAVAPP+ +TAM++ T  SYLP++PMLYAVI +PA+
Sbjct  1    MAEDFEAAVEEGLNLSKRVYFGKDRAVAPPKPLTAMDRATGCSYLPTSPMLYAVISDPAI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD PSYQPHVHGRC+PPALIPLQMN +S+  +C LDTAFVTVTG+WR+HCVM SRSC
Sbjct  61   VDNPDRPSYQPHVHGRCEPPALIPLQMNGVSLEVDCSLDTAFVTVTGTWRLHCVMSSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>gb|EPS65940.1| hypothetical protein M569_08838, partial [Genlisea aurea]
Length=637

 Score =   201 bits (512),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            MA +F +AVEDGLRLSKRI +GKDRAVAPP+   +M + A  SYLP++PM+YAVI +P+V
Sbjct  1    MAEDFESAVEDGLRLSKRIYYGKDRAVAPPKTSMSMGRDARFSYLPTSPMMYAVISDPSV  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGR DPPAL+PLQMN IS+  +CY+DTAFVT TGSWRVHCVMGS+ C
Sbjct  61   VDNPDMPSYQPHVHGRLDPPALLPLQMNGISLDVDCYIDTAFVTATGSWRVHCVMGSKFC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_010273856.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Nelumbo nucifera]
Length=614

 Score =   201 bits (510),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            M   F  +VEDGLRLSKRI FGKDR+V+PPR   +M+K+ H +YLP+APM+YAV+ +PA+
Sbjct  5    MVDYFVESVEDGLRLSKRIYFGKDRSVSPPRP-ASMDKSLHQTYLPTAPMVYAVVSDPAI  63

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHG+CDPPALIPLQMN I+V A+CYL TAFVTV+GSWRVHC+MGSR+C
Sbjct  64   VDNPDLPSYQPYVHGKCDPPALIPLQMNGIAVEADCYLGTAFVTVSGSWRVHCIMGSRNC  123

Query  514  DC  519
            DC
Sbjct  124  DC  125



>ref|XP_002277641.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Vitis 
vinifera]
 emb|CBI27786.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   202 bits (513),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +F  +VEDGL+L+KRI FGKDR+V PP+ ++ M+K++ SYLP+APM+YAV+ +PA+V
Sbjct  1    MADDFTKSVEDGLKLAKRIYFGKDRSVTPPKPVS-MDKSSKSYLPTAPMVYAVVFDPAIV  59

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHV+GRCDP ALIPLQMN I++  +CYLDTAFVT+TGSWRVHCVMGSRSCD
Sbjct  60   DNPDIPSYQPHVYGRCDPAALIPLQMNGIALEVDCYLDTAFVTLTGSWRVHCVMGSRSCD  119

Query  517  C  519
            C
Sbjct  120  C  120



>ref|XP_011007767.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Populus 
euphratica]
Length=756

 Score =   201 bits (512),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  +V+DGL+LSKRI  GKDRAV PP+  + M+K+  +YLP+APM+YAVI NP +V
Sbjct  1    MAEEFGRSVQDGLKLSKRIYLGKDRAVTPPKPPSHMDKSPVAYLPTAPMVYAVISNPGIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGRCDPPALIPLQMN I + A+ YLDTAFV + GSWRVHCVMGS SCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMNRIELEADSYLDTAFVKINGSWRVHCVMGSESCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_010273854.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Nelumbo nucifera]
Length=696

 Score =   201 bits (510),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            M   F  +VEDGLRLSKRI FGKDR+V+PPR   +M+K+ H +YLP+APM+YAV+ +PA+
Sbjct  5    MVDYFVESVEDGLRLSKRIYFGKDRSVSPPRP-ASMDKSLHQTYLPTAPMVYAVVSDPAI  63

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHG+CDPPALIPLQMN I+V A+CYL TAFVTV+GSWRVHC+MGSR+C
Sbjct  64   VDNPDLPSYQPYVHGKCDPPALIPLQMNGIAVEADCYLGTAFVTVSGSWRVHCIMGSRNC  123

Query  514  DC  519
            DC
Sbjct  124  DC  125



>ref|XP_002324729.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
 gb|EEF03294.2| inter-alpha-trypsin inhibitor heavy chain-related family protein 
[Populus trichocarpa]
Length=752

 Score =   201 bits (511),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  +V+DGL+LSKRI  GKDRAV PP+  + M+K+  +YLP+APM+YAVI NPA+V
Sbjct  1    MAEEFGRSVQDGLKLSKRIYLGKDRAVTPPKPPSHMDKSPVAYLPTAPMVYAVISNPAIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGRCDPPALIPLQM  I + A+ YLDTAFV ++GSWRVHCVMGS SCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMTRIELEADSYLDTAFVKISGSWRVHCVMGSESCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_010273855.1| PREDICTED: uncharacterized protein LOC104609280 isoform X3 [Nelumbo 
nucifera]
Length=663

 Score =   200 bits (508),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            M   F  +VEDGLRLSKRI FGKDR+V+PPR   +M+K+ H +YLP+APM+YAV+ +PA+
Sbjct  5    MVDYFVESVEDGLRLSKRIYFGKDRSVSPPRP-ASMDKSLHQTYLPTAPMVYAVVSDPAI  63

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHG+CDPPALIPLQMN I+V A+CYL TAFVTV+GSWRVHC+MGSR+C
Sbjct  64   VDNPDLPSYQPYVHGKCDPPALIPLQMNGIAVEADCYLGTAFVTVSGSWRVHCIMGSRNC  123

Query  514  DC  519
            DC
Sbjct  124  DC  125



>ref|XP_009110301.1| PREDICTED: uncharacterized protein LOC103835866 [Brassica rapa]
Length=757

 Score =   201 bits (510),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 88/123 (72%), Positives = 104/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  330
            MA +FA AVEDGL+L+KRI  G DRAVA PR    ME+T+  H+YLPS+PM+YAVI +P 
Sbjct  1    MAEDFARAVEDGLKLAKRIYLGNDRAVAAPRLAAPMERTSTVHAYLPSSPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTG+WRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGTWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010273853.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Nelumbo nucifera]
Length=753

 Score =   200 bits (509),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            M   F  +VEDGLRLSKRI FGKDR+V+PPR   +M+K+ H +YLP+APM+YAV+ +PA+
Sbjct  5    MVDYFVESVEDGLRLSKRIYFGKDRSVSPPRP-ASMDKSLHQTYLPTAPMVYAVVSDPAI  63

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHG+CDPPALIPLQMN I+V A+CYL TAFVTV+GSWRVHC+MGSR+C
Sbjct  64   VDNPDLPSYQPYVHGKCDPPALIPLQMNGIAVEADCYLGTAFVTVSGSWRVHCIMGSRNC  123

Query  514  DC  519
            DC
Sbjct  124  DC  125



>ref|XP_009149386.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Brassica rapa]
Length=757

 Score =   200 bits (509),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA---HSYLPSAPMLYAVIENP  327
            MA +FA AVEDGL+L+KRI FG DRAVA PR  + ME+ A   H++LP+APM+YAVI  P
Sbjct  1    MAEDFARAVEDGLKLAKRIYFGNDRAVAAPRLASPMERAASAAHAHLPTAPMVYAVIHEP  60

Query  328  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  507
             +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTGSWRVHCVMGS+
Sbjct  61   GIVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGSWRVHCVMGSK  120

Query  508  SCDC  519
             CDC
Sbjct  121  RCDC  124



>emb|CDY26699.1| BnaA06g13230D [Brassica napus]
Length=757

 Score =   200 bits (508),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA---HSYLPSAPMLYAVIENP  327
            MA +FA AVEDGL+L+KRI FG DRAVA PR  + ME+ A   H++LP+APM+YAVI  P
Sbjct  1    MAEDFARAVEDGLKLAKRIYFGNDRAVAAPRLASPMERAASAAHAHLPTAPMVYAVIHEP  60

Query  328  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  507
             +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTGSWRVHCVMGS+
Sbjct  61   GIVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGSWRVHCVMGSK  120

Query  508  SCDC  519
             CDC
Sbjct  121  RCDC  124



>ref|XP_002516254.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF46256.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=755

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  +VEDGL+LSKR+ +GKDRAVAPPR +  MEK+A +YLP+APM+YAVI +P++V
Sbjct  1    MAEEFGNSVEDGLKLSKRLYYGKDRAVAPPRPVVHMEKSAEAYLPTAPMIYAVISDPSIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGRCDPPALIPLQMN I + A+ +LD+A V V GSWRVHCVMGS+SCD
Sbjct  61   DNPDMPSYQPHVHGRCDPPALIPLQMNRIELEADSFLDSAIVRVNGSWRVHCVMGSKSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_010531895.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Tarenaya hassleriana]
Length=756

 Score =   199 bits (506),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 89/123 (72%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVA-PPRAMTAMEKTA-HSYLPSAPMLYAVIENPA  330
            MA +FA AVEDGL+ +KR+  GKDRAVA PPR   AME+++  +YLP+APMLYAVI +PA
Sbjct  1    MADDFAKAVEDGLKFAKRVYLGKDRAVAAPPRPSPAMERSSSQAYLPTAPMLYAVISDPA  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +C+LDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELEVDCFLDTALIRVTGSWRVHCVMGSRS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>emb|CDX81914.1| BnaC08g36870D [Brassica napus]
Length=754

 Score =   199 bits (505),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FG DRAVA PR    ME+  T+ ++LPSAPM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGHDRAVAAPRLTAPMERSSTSQAHLPSAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELHVDCYLDTALVTVTGSWRVHCVMGSKK  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>emb|CDY41019.1| BnaC05g14770D [Brassica napus]
Length=757

 Score =   199 bits (505),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA---HSYLPSAPMLYAVIENP  327
            MA +FA AVEDGL+L+KRI FG DRAVA PR  + ME+ A   H++LP+APM+YAVI  P
Sbjct  1    MAEDFARAVEDGLKLAKRIYFGNDRAVAAPRLASPMERAASAAHAHLPTAPMVYAVIHEP  60

Query  328  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  507
             +VDNPD+PSYQPHVHGRCDPPALIPLQ+N+I +  +CYLDTA VTVTGSWRVHCVMGS+
Sbjct  61   GIVDNPDLPSYQPHVHGRCDPPALIPLQLNAIELDVDCYLDTALVTVTGSWRVHCVMGSK  120

Query  508  SCDC  519
             CDC
Sbjct  121  RCDC  124



>emb|CDX83787.1| BnaC08g18580D [Brassica napus]
Length=756

 Score =   197 bits (501),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 87/123 (71%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  330
            MA +FA AVEDGL+L+KRI  G DRAVA PR    ME+T  A +YLPS+PM+YAVI +P 
Sbjct  1    MAEDFARAVEDGLKLAKRIYLGNDRAVAAPRLAAPMERTSTAQAYLPSSPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTG+WRVHCVMG + 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGTWRVHCVMGRKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>gb|KJB65319.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=646

 Score =   196 bits (499),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>gb|KJB65320.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=606

 Score =   196 bits (497),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>emb|CDY21682.1| BnaA09g44330D [Brassica napus]
Length=754

 Score =   197 bits (500),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FG DRAVA PR    ME+  T+ ++LPSAPM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGHDRAVAAPRLTAPMERSSTSQAHLPSAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VT TGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELHVDCYLDTALVTATGSWRVHCVMGSKK  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>emb|CDX96680.1| BnaA08g22230D [Brassica napus]
Length=768

 Score =   197 bits (500),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 87/123 (71%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  330
            MA +FA AVEDGL+L+KRI  G DRAVA PR    ME+T+  H+YLPS+PM+YAVI +P 
Sbjct  1    MAEDFARAVEDGLKLAKRIYLGNDRAVAAPRLAPPMERTSTVHAYLPSSPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRC PPALIPLQMN+I +  +CYLDTA VTVTG+WRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCYPPALIPLQMNAIELNVDCYLDTALVTVTGTWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_003551107.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028-like [Glycine max]
Length=754

 Score =   196 bits (498),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +F+ AV+DGL+LSKRI FGKDRAVAPP+    M ++A ++LPSAPM+YAVI +P +V
Sbjct  1    MAQDFSKAVDDGLKLSKRIYFGKDRAVAPPKPPPPMTRSATAFLPSAPMVYAVISDPGIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHV+GRCDPPALIPLQMN+I + A+CY +TAF+TV+G+WR+HCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVYGRCDPPALIPLQMNAIQMEADCYHETAFITVSGTWRLHCVMGSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>gb|KFK44049.1| hypothetical protein AALP_AA1G209400 [Arabis alpina]
Length=761

 Score =   196 bits (497),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 8/129 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--------HSYLPSAPMLYA  312
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    M++++         +YLPSAPM+YA
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPQLTMDRSSTTTSTATTQAYLPSAPMVYA  60

Query  313  VIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHC  492
            VI +P +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTGSWRVHC
Sbjct  61   VIPDPGIVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELEVDCYLDTALVTVTGSWRVHC  120

Query  493  VMGSRSCDC  519
            VMGS+ CDC
Sbjct  121  VMGSKRCDC  129



>ref|XP_006416537.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
 gb|ESQ34890.1| hypothetical protein EUTSA_v10006890mg [Eutrema salsugineum]
Length=755

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FG DRAVA PR    ME++  A +YLPSAPM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGNDRAVAAPRLAAPMERSSPAQAYLPSAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN+I +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>gb|KHG11270.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=754

 Score =   195 bits (495),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>gb|KDP33933.1| hypothetical protein JCGZ_07504 [Jatropha curcas]
Length=756

 Score =   195 bits (495),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  AVEDGLRL+KR+ FGKDRAVAPP+ + +ME++   YLP APM+YAVI +PA+V
Sbjct  1    MADEFGKAVEDGLRLAKRLYFGKDRAVAPPKPLLSMERSVDDYLPKAPMVYAVIFDPAIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQPHVHGRCDPPALIPLQMN I + A+ YLD+  V ++GSWRVHCVMGS+S D
Sbjct  61   DNPDMASYQPHVHGRCDPPALIPLQMNRIELEADSYLDSVIVRLSGSWRVHCVMGSKSSD  120

Query  517  C  519
            C
Sbjct  121  C  121



>gb|KJB65322.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=728

 Score =   194 bits (494),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>gb|KJB65318.1| hypothetical protein B456_010G089800 [Gossypium raimondii]
Length=754

 Score =   194 bits (494),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA AVEDGL+L KRI  GKDRAV PP+ +  ME++ H YLPSAPM+YAVI +P +V
Sbjct  1    MAEDFARAVEDGLKLGKRIYMGKDRAVQPPKPLPLMERSMHFYLPSAPMVYAVISDPRIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGR DPPALIPLQMN +++  +CY D+AFV V+G WRVHCVM SRSCD
Sbjct  61   DNPDIPSYQPHVHGRLDPPALIPLQMNGVNLDVDCYGDSAFVQVSGMWRVHCVMRSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_004508009.1| PREDICTED: uncharacterized protein LOC101514299 [Cicer arietinum]
Length=751

 Score =   193 bits (491),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 82/121 (68%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF+ AVEDGL+LSKRI FGKDRAVAPP+   +M +++++ LP APM+YAVI +P +V
Sbjct  1    MAEEFSRAVEDGLKLSKRIYFGKDRAVAPPKPPPSMARSSNALLPKAPMVYAVIYDPGMV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHV+GRCDPPALIPLQM+ I +  +CYLDTAF+TV+ +WR+HCV  SRSCD
Sbjct  61   DNPDIPSYQPHVYGRCDPPALIPLQMSGIEMDIDCYLDTAFITVSATWRLHCVTASRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_007012610.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
 gb|EOY30229.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 1 [Theobroma 
cacao]
Length=758

 Score =   193 bits (490),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDR-AVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  333
            MA +FA AVEDGL+L+KRI  GKDR AV PP+    ME++ + YLPSAPM+YAVI +P +
Sbjct  1    MAEDFAQAVEDGLKLAKRIYLGKDRGAVGPPKPPPPMERSPYRYLPSAPMVYAVISDPRI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDPPALIPLQMN + +  +CY DTAF+ V+GSWRVHCVMGSRSC
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLQMNGVDLDVDCYADTAFIQVSGSWRVHCVMGSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_007012611.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
 gb|EOY30230.1| Inter-alpha-trypsin inhibitor heavy chain-related isoform 2 [Theobroma 
cacao]
Length=759

 Score =   193 bits (490),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDR-AVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  333
            MA +FA AVEDGL+L+KRI  GKDR AV PP+    ME++ + YLPSAPM+YAVI +P +
Sbjct  1    MAEDFAQAVEDGLKLAKRIYLGKDRGAVGPPKPPPPMERSPYRYLPSAPMVYAVISDPRI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDPPALIPLQMN + +  +CY DTAF+ V+GSWRVHCVMGSRSC
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLQMNGVDLDVDCYADTAFIQVSGSWRVHCVMGSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_010100827.1| hypothetical protein L484_000119 [Morus notabilis]
 gb|EXC45032.1| hypothetical protein L484_000119 [Morus notabilis]
Length=160

 Score =   180 bits (457),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTA-MEKT-AHSYLPSAPMLYAVIENPA  330
            MA +FA AV+DGLRLSKR+ FGKDR  AP R   A ME++ + S LP+APM+YAVI +PA
Sbjct  1    MADDFAQAVDDGLRLSKRLYFGKDREAAPRRPSPAVMERSPSRSLLPTAPMVYAVIYDPA  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCD PALIPLQM+ + + A+CYLDTAFV V+GSWRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPHVHGRCDTPALIPLQMHGVELEADCYLDTAFVRVSGSWRVHCVMGSKS  120

Query  511  CDC  519
            C C
Sbjct  121  CGC  123



>ref|XP_009117566.1| PREDICTED: uncharacterized protein LOC103842665 [Brassica rapa]
Length=754

 Score =   192 bits (489),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 86/123 (70%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FG DRAVA PR    ME+  T+ ++LPSAPM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGHDRAVAAPRLTAPMERSSTSQAHLPSAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGR DPPALIPLQMN+I +  +CYLDTA VT TGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRGDPPALIPLQMNAIELHVDCYLDTALVTATGSWRVHCVMGSKK  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>gb|KHN17734.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=754

 Score =   192 bits (489),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 81/121 (67%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +F+ AV+DGL+LSKRI FGKDRAV+  +  + M +   ++LPSAPM+YAVI +P +V
Sbjct  1    MAQDFSKAVDDGLKLSKRIYFGKDRAVSLSKHPSPMARLTTTFLPSAPMVYAVISDPGIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHV+GRCDPPALIPLQMN+I + A+CY +TAF+TV+G+WR+HCVMGSRSCD
Sbjct  61   DNPDIPSYQPHVYGRCDPPALIPLQMNAIQMEADCYHETAFITVSGTWRLHCVMGSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>gb|KEH32427.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=585

 Score =   190 bits (483),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  AV+DG++LSKRI FGKDRAVAPP+  T M K++ S LP APM+YAVI +P +V
Sbjct  1    MAEEFCRAVDDGMKLSKRIYFGKDRAVAPPKVPT-MSKSSTSLLPKAPMVYAVIHDPGIV  59

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQPHV+GRCDPPALIPLQMN+I +  +CYLDTAFVTV+G+WRVHCV GS + D
Sbjct  60   DNPDIASYQPHVYGRCDPPALIPLQMNAIEMEIDCYLDTAFVTVSGTWRVHCVTGSSTTD  119

Query  517  C  519
            C
Sbjct  120  C  120



>gb|KDO73865.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=613

 Score =   190 bits (483),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  330
            MA +F  AVEDGL+LSKR+ FGKDR V PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPVTPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>gb|AES92187.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=752

 Score =   191 bits (485),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  AV+DG++LSKRI FGKDRAVAPP+  T M K++ S LP APM+YAVI +P +V
Sbjct  1    MAEEFCRAVDDGMKLSKRIYFGKDRAVAPPKVPT-MSKSSTSLLPKAPMVYAVIHDPGIV  59

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQPHV+GRCDPPALIPLQMN+I +  +CYLDTAFVTV+G+WRVHCV GS + D
Sbjct  60   DNPDIASYQPHVYGRCDPPALIPLQMNAIEMEIDCYLDTAFVTVSGTWRVHCVTGSSTTD  119

Query  517  C  519
            C
Sbjct  120  C  120



>ref|XP_006452826.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66066.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=613

 Score =   189 bits (481),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  330
            MA +F  AVEDGL+LSKR+ FGKDR V PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPVTPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_002890318.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66577.1| hypothetical protein ARALYDRAFT_472131 [Arabidopsis lyrata subsp. 
lyrata]
Length=755

 Score =   191 bits (484),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME+  T  SYLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSSTTQSYLPTAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010497257.1| PREDICTED: uncharacterized protein LOC104774321, partial [Camelina 
sativa]
Length=413

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS--YLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME++A +  YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSATTQPYLPTAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_004287649.1| PREDICTED: uncharacterized protein LOC101300180 [Fragaria vesca 
subsp. vesca]
Length=752

 Score =   190 bits (482),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  330
            MA EF+ AV+DGLRLSKR+ FGKDR+V+PP+   AM K+    +YLP++PM+YAVI +P 
Sbjct  1    MAEEFSKAVDDGLRLSKRLYFGKDRSVSPPKPPPAMHKSVAGRTYLPTSPMVYAVISDPT  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPL MN + +  +C++DTAF+ VTGSWRVHCV  SRS
Sbjct  61   IVDNPDIPSYQPHVHGRCDPPALIPLPMNRVDLEVDCFMDTAFIRVTGSWRVHCVKSSRS  120

Query  511  CDC  519
            C C
Sbjct  121  CGC  123



>ref|XP_003609990.1| von Willebrand factor A domain-containing protein [Medicago truncatula]
Length=844

 Score =   190 bits (483),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  AV+DG++LSKRI FGKDRAVAPP+  T M K++ S LP APM+YAVI +P +V
Sbjct  1    MAEEFCRAVDDGMKLSKRIYFGKDRAVAPPKVPT-MSKSSTSLLPKAPMVYAVIHDPGIV  59

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQPHV+GRCDPPALIPLQMN+I +  +CYLDTAFVTV+G+WRVHCV GS + D
Sbjct  60   DNPDIASYQPHVYGRCDPPALIPLQMNAIEMEIDCYLDTAFVTVSGTWRVHCVTGSSTTD  119

Query  517  C  519
            C
Sbjct  120  C  120



>gb|KDO73864.1| hypothetical protein CISIN_1g004349mg [Citrus sinensis]
Length=759

 Score =   190 bits (482),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  330
            MA +F  AVEDGL+LSKR+ FGKDR V PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPVTPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_008782726.1| PREDICTED: LOW QUALITY PROTEIN: inter alpha-trypsin inhibitor, 
heavy chain 4-like [Phoenix dactylifera]
Length=746

 Score =   189 bits (481),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  345
            EFA AVEDGL+L+KRI  GKDR   PPR +  ME++  S LP+APM+YAV+++P +VDNP
Sbjct  5    EFAKAVEDGLKLAKRIYAGKDRHFGPPRPVGGMERSLASLLPAAPMVYAVVDDPGIVDNP  64

Query  346  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            D+PSYQPHV+G CDPPALIPLQMN I+V A+C+LDTAFV + G WRVHC+M +RSCDC
Sbjct  65   DIPSYQPHVYGHCDPPALIPLQMNEIAVEADCFLDTAFVAIRGRWRVHCIMRNRSCDC  122



>ref|XP_006452827.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
 gb|ESR66067.1| hypothetical protein CICLE_v10007546mg [Citrus clementina]
Length=758

 Score =   189 bits (481),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  330
            MA +F  AVEDGL+LSKR+ FGKDR V PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPVTPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_006474710.1| PREDICTED: uncharacterized protein LOC102609180 [Citrus sinensis]
Length=759

 Score =   188 bits (477),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 79/123 (64%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  330
            MA +F  AVEDGL+LSKR+ FGKDR   PP+  ++M+K+      LP +PM+YAVI +P 
Sbjct  1    MADDFVKAVEDGLKLSKRLYFGKDRPATPPKVPSSMDKSGAVDMLLPKSPMVYAVITDPK  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQP+VHGRCDPP+LIPLQMN++ +  +CYLDTAFV V+G+WRVHCVMGS+S
Sbjct  61   IVDNPDIPSYQPYVHGRCDPPSLIPLQMNAVELDVDCYLDTAFVRVSGTWRVHCVMGSKS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010477113.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H4-like 
[Camelina sativa]
Length=755

 Score =   187 bits (476),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS--YLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME++A +  YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSATTQPYLPTAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010459567.1| PREDICTED: uncharacterized protein LOC104740606 [Camelina sativa]
Length=754

 Score =   187 bits (476),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS--YLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME++A +  YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSATTQPYLPTAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTAIVTVTGSWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010498320.1| PREDICTED: uncharacterized protein LOC104776024 [Camelina sativa]
Length=754

 Score =   187 bits (476),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS--YLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    ME++A +  YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMERSATTQPYLPTAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTAIVTVTGSWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010537665.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Tarenaya hassleriana]
Length=760

 Score =   187 bits (476),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAP-PRAMTAMEKTAHS-YLPSAPMLYAVIENPA  330
            MA +F  AVEDGL+L+KR+  G DR VA  P     ME+++ + YLP+APM+YAVI +PA
Sbjct  1    MAEDFTKAVEDGLKLAKRVYLGNDRLVAAAPLPSPVMERSSSTAYLPTAPMVYAVISDPA  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN++ +  +CYLDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAVELEVDCYLDTALIRVTGSWRVHCVMGSRS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|NP_173345.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
 gb|AAM97055.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15507.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29803.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Arabidopsis 
thaliana]
Length=754

 Score =   187 bits (475),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    M++  T   YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMDRSSTTQPYLPTAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_008388928.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Malus 
domestica]
Length=755

 Score =   187 bits (475),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 78/122 (64%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  333
            MA +F+ AV+DGL+ SKR+ FGKDRAV+PP+   +M+K T+ ++LP+APM+YAVI +P +
Sbjct  1    MAEDFSKAVDDGLKFSKRLYFGKDRAVSPPKQPPSMDKATSCAFLPTAPMVYAVISDPGI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDPPALIPL MN + +  +CY+DTAF+ V+GSWRVHC+ GS+SC
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLTMNRVELQVDCYMDTAFIRVSGSWRVHCIKGSKSC  120

Query  514  DC  519
             C
Sbjct  121  GC  122



>gb|AAF79294.1|AC068602_17 F14D16.26 [Arabidopsis thaliana]
Length=736

 Score =   187 bits (474),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  330
            MA +FA AV+DGL+L+KRI FGKDRAVA PR    M++  T   YLP+APM+YAVI +P 
Sbjct  1    MAEDFARAVDDGLKLAKRIYFGKDRAVAAPRPPAPMDRSSTTQPYLPTAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010537666.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Tarenaya hassleriana]
Length=756

 Score =   187 bits (474),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAP-PRAMTAMEKTAHS-YLPSAPMLYAVIENPA  330
            MA +F  AVEDGL+L+KR+  G DR VA  P     ME+++ + YLP+APM+YAVI +PA
Sbjct  1    MAEDFTKAVEDGLKLAKRVYLGNDRLVAAAPLPSPVMERSSSTAYLPTAPMVYAVISDPA  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN++ +  +CYLDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAVELEVDCYLDTALIRVTGSWRVHCVMGSRS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010537667.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Tarenaya hassleriana]
Length=756

 Score =   187 bits (474),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAP-PRAMTAMEKTAHS-YLPSAPMLYAVIENPA  330
            MA +F  AVEDGL+L+KR+  G DR VA  P     ME+++ + YLP+APM+YAVI +PA
Sbjct  1    MAEDFTKAVEDGLKLAKRVYLGNDRLVAAAPLPSPVMERSSSTAYLPTAPMVYAVISDPA  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN++ +  +CYLDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAVELEVDCYLDTALIRVTGSWRVHCVMGSRS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_006306812.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
 gb|EOA39710.1| hypothetical protein CARUB_v10008355mg [Capsella rubella]
Length=780

 Score =   187 bits (475),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 89/123 (72%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK--TAHSYLPSAPMLYAVIENPA  330
            MA +F+ AV+DG++LSKRI FGKDRAVA PR    ME+  T   YLP+APM+YAVI +P 
Sbjct  1    MAEDFSRAVDDGIKLSKRIYFGKDRAVAAPRPPAPMERSSTTQPYLPTAPMVYAVIPDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMNSI +  +CYLDTA VTVTGSWRVHCVMGS+ 
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNSIELDVDCYLDTALVTVTGSWRVHCVMGSKR  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_007204639.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
 gb|EMJ05838.1| hypothetical protein PRUPE_ppa001864mg [Prunus persica]
Length=753

 Score =   187 bits (474),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT-AHSYLPSAPMLYAVIENPAV  333
            MA EF+ AV+DGL+LSKR+ FGKDRAV+PP+   +M+KT + ++LP+APM+YAVI +PA+
Sbjct  1    MAEEFSKAVDDGLKLSKRLYFGKDRAVSPPKPPPSMDKTTSGAFLPTAPMVYAVIFDPAI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDP ALIPL MN + +  +CY+DTAFV VTGSWRVHCV G++SC
Sbjct  61   VDNPDIPSYQPHVHGRCDPAALIPLPMNRVELEVDCYMDTAFVRVTGSWRVHCVKGNKSC  120

Query  514  DC  519
             C
Sbjct  121  GC  122



>ref|XP_010537668.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Tarenaya hassleriana]
Length=752

 Score =   186 bits (473),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAP-PRAMTAMEKTAHS-YLPSAPMLYAVIENPA  330
            MA +F  AVEDGL+L+KR+  G DR VA  P     ME+++ + YLP+APM+YAVI +PA
Sbjct  1    MAEDFTKAVEDGLKLAKRVYLGNDRLVAAAPLPSPVMERSSSTAYLPTAPMVYAVISDPA  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPD+PSYQPHVHGRCDPPALIPLQMN++ +  +CYLDTA + VTGSWRVHCVMGSRS
Sbjct  61   IVDNPDLPSYQPHVHGRCDPPALIPLQMNAVELEVDCYLDTALIRVTGSWRVHCVMGSRS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_008337841.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Malus domestica]
Length=751

 Score =   186 bits (473),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  333
            MA +F+ AV+DGL+LSKR+ FGKDRAV+PP+   +M+K T+ ++LP APM+YAVI +PA+
Sbjct  1    MAEDFSKAVDDGLKLSKRLYFGKDRAVSPPKPPPSMDKATSCAFLPKAPMVYAVISDPAI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDPPALIPL MN + +  +CY+DTAF+ V+GSWRVHCV  S+SC
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLTMNRVELEVDCYMDTAFIRVSGSWRVHCVKASKSC  120

Query  514  DC  519
             C
Sbjct  121  GC  122



>ref|XP_008242259.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Prunus mume]
Length=753

 Score =   186 bits (473),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT-AHSYLPSAPMLYAVIENPAV  333
            MA EF+ AV+DGL+LSKR+ FGKDRAV+PP+   +M+KT + ++LP+APM+YAVI +PA+
Sbjct  1    MAEEFSKAVDDGLKLSKRLYFGKDRAVSPPKPPPSMDKTTSGAFLPTAPMVYAVIFDPAI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDP ALIPL MN + +  +CY+DTAFV VTGSWRVHCV G++SC
Sbjct  61   VDNPDIPSYQPHVHGRCDPAALIPLPMNRVELEVDCYMDTAFVRVTGSWRVHCVKGNKSC  120

Query  514  DC  519
             C
Sbjct  121  GC  122



>ref|XP_003542365.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Glycine max]
Length=754

 Score =   186 bits (473),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 83/121 (69%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +F+ AV+DGL+LSKRI F KDRAV+PP+    M + A ++LPSAPM+YAVI +P +V
Sbjct  1    MAVDFSKAVDDGLKLSKRIYFVKDRAVSPPKPPPPMARWATAFLPSAPMVYAVISDPGIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQPHV+GRCDPPALIPLQMN+I + A+CY +TAFVTV+G+WR+HCVMGSRSCD
Sbjct  61   DNPDISSYQPHVYGRCDPPALIPLQMNAIEMEADCYHETAFVTVSGTWRLHCVMGSRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_010937323.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Elaeis 
guineensis]
Length=747

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  345
            EFA AVEDGL+L+KRI  GKDR  APPR +  ME++  S LP+APM+YAV+++P +VDNP
Sbjct  5    EFAKAVEDGLKLAKRIYAGKDRHFAPPRPVGGMERSPVSLLPAAPMVYAVVDDPGIVDNP  64

Query  346  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            D+PSYQPHV+GRCDPPALIPLQMN I++ A+C+LDTAFV + G WRVHC+M +RSCDC
Sbjct  65   DIPSYQPHVYGRCDPPALIPLQMNEIALEADCFLDTAFVAIRGRWRVHCIMRNRSCDC  122



>ref|XP_009359719.1| PREDICTED: uncharacterized protein LOC103950254 [Pyrus x bretschneideri]
Length=755

 Score =   185 bits (469),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-TAHSYLPSAPMLYAVIENPAV  333
            MA +F+ AV+DGL+LSKR+ FGKDRAV+PP+   +M+K T+ ++LP APM+YAVI +PA+
Sbjct  1    MAEDFSKAVDDGLKLSKRLYFGKDRAVSPPKPPPSMDKATSCTFLPKAPMVYAVISDPAI  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDPPALIPL MN + +  +CY+DTAF+ V+GSWRVHCV  S+ C
Sbjct  61   VDNPDIPSYQPHVHGRCDPPALIPLTMNRVELEVDCYMDTAFIRVSGSWRVHCVKPSKGC  120

Query  514  DC  519
             C
Sbjct  121  GC  122



>ref|XP_004488095.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Cicer arietinum]
Length=752

 Score =   184 bits (468),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 78/122 (64%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF+ AVE+G+RLSKRI FG DRAV+PP+  T+M K+  ++LP++PM+YAVI +PA+V
Sbjct  1    MAEEFSKAVEEGIRLSKRIYFGNDRAVSPPKPPTSMLKSNTAFLPTSPMVYAVIHDPAIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            DNPDVPSYQP+VHGRC+PPALIPL M N + +  +CYL++AF+ V G WR+HCV GSR+C
Sbjct  61   DNPDVPSYQPYVHGRCEPPALIPLHMINVVELKGDCYLNSAFLEVVGCWRLHCVSGSRAC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_010242255.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Nelumbo nucifera]
Length=750

 Score =   184 bits (468),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 81/121 (67%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +F+ +VE+G RLSKR+ +GK   V PP    AM+K+  ++LP+APM+YAVI +PAVV
Sbjct  1    MADDFSKSVEEGFRLSKRLYYGKHHPVLPPLP-AAMKKSRRTHLPTAPMVYAVISDPAVV  59

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQP+VHG CDPPALIPLQMN I+V  +CYLDTA V+V+GSWRVHCVMGSRSC 
Sbjct  60   DNPDIPSYQPYVHGLCDPPALIPLQMNDIAVQVDCYLDTALVSVSGSWRVHCVMGSRSCS  119

Query  517  C  519
            C
Sbjct  120  C  120



>ref|XP_007154569.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
 gb|ESW26563.1| hypothetical protein PHAVU_003G129800g [Phaseolus vulgaris]
Length=753

 Score =   183 bits (465),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +F+ AV+DGL+LSKRI FGKDRAVAPP+    M ++A ++LPSA M+YAVI +P +V
Sbjct  1    MAEDFSKAVDDGLKLSKRIYFGKDRAVAPPKPPPPMARSAKAFLPSASMIYAVICDPGIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQPHVHGRCDPPALIPLQM +I +  +C+ +TAFVTV+G+WR+HC+  SRSCD
Sbjct  61   DNPDIPSYQPHVHGRCDPPALIPLQMTAIQMEVDCHHETAFVTVSGTWRLHCIKASRSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_010666845.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Beta 
vulgaris subsp. vulgaris]
Length=758

 Score =   183 bits (465),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  345
            +F  AVE+GL+LSKR+ FGKDR+VAPP+    M K    YLP+APM+YAV+ +P +VDNP
Sbjct  7    DFMEAVEEGLKLSKRLYFGKDRSVAPPKPPPPMSKFPRFYLPTAPMVYAVVSDPGIVDNP  66

Query  346  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            D+PSYQP+V+GRCDPPALIPLQMN++S+  +CYLDT FV+V+G WRVHCVMGS+SCDC
Sbjct  67   DIPSYQPYVYGRCDPPALIPLQMNNVSMEVDCYLDTVFVSVSGEWRVHCVMGSKSCDC  124



>ref|XP_003595328.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Medicago truncatula]
 gb|AES65579.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=751

 Score =   182 bits (462),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF+ +VE+G++LSKRI FG DRAV  P+    M KT  ++LP++PM+YAVI +P +V
Sbjct  1    MAEEFSKSVEEGIKLSKRIYFGNDRAVTAPKPPPTMSKTNTAFLPTSPMVYAVIHDPKIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            DNPDVPSYQPHVHGRCDPPALIPLQM N + +  + +LDTAFV V+G WR+HCV GSRSC
Sbjct  61   DNPDVPSYQPHVHGRCDPPALIPLQMINGVDLRVDAWLDTAFVEVSGCWRLHCVSGSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_007138646.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
 gb|ESW10640.1| hypothetical protein PHAVU_009G226200g [Phaseolus vulgaris]
Length=761

 Score =   182 bits (462),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF+ +VE+GL LSKRI FGKDRAV+PP+    M K+  +YLP+APMLYAVI +PA+V
Sbjct  1    MAEEFSKSVEEGLHLSKRIYFGKDRAVSPPKPPLTMSKSHTAYLPTAPMLYAVIHDPAIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLD-TAFVTVTGSWRVHCVMGSRSC  513
            DNPDVPSYQP+VHG+CDPPA IPL M ++ + A C+LD  AFVT+  +WR+HC+ GSRSC
Sbjct  61   DNPDVPSYQPYVHGKCDPPAHIPLHMTAVHLQAHCHLDAAAFVTLFATWRLHCISGSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_002271630.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X1 [Vitis vinifera]
 emb|CBI35850.3| unnamed protein product [Vitis vinifera]
Length=747

 Score =   182 bits (461),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  330
            MA +F+ AVE GLRLSKRI +GKDR+ + P+    MEK+    S+LP+APM+YAVI  P+
Sbjct  1    MAEDFSTAVEYGLRLSKRIYYGKDRSASAPKPQE-MEKSESQESFLPTAPMVYAVIPEPS  59

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPDVPSYQP+VHGRCDPPALIPL M  I++  +CYLDTAF++V+G+WRVHCVMGSR 
Sbjct  60   IVDNPDVPSYQPYVHGRCDPPALIPLHMLGIAMEVDCYLDTAFISVSGTWRVHCVMGSRR  119

Query  511  CDC  519
            CDC
Sbjct  120  CDC  122



>ref|XP_010654417.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 isoform 
X2 [Vitis vinifera]
Length=746

 Score =   182 bits (461),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  330
            MA +F+ AVE GLRLSKRI +GKDR+ + P+    MEK+    S+LP+APM+YAVI  P+
Sbjct  1    MAEDFSTAVEYGLRLSKRIYYGKDRSASAPKPQE-MEKSESQESFLPTAPMVYAVIPEPS  59

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
            +VDNPDVPSYQP+VHGRCDPPALIPL M  I++  +CYLDTAF++V+G+WRVHCVMGSR 
Sbjct  60   IVDNPDVPSYQPYVHGRCDPPALIPLHMLGIAMEVDCYLDTAFISVSGTWRVHCVMGSRR  119

Query  511  CDC  519
            CDC
Sbjct  120  CDC  122



>ref|XP_009404352.1| PREDICTED: uncharacterized protein LOC103987694 [Musa acuminata 
subsp. malaccensis]
Length=750

 Score =   179 bits (454),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = +1

Query  169  FAAAVEDGLRLSKRINFGKDRA-VAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNP  345
            FA AVEDGL+L+KR+  GK+R   APPR  T ME+++  +LP+APM+YAVI +PA+VDNP
Sbjct  7    FATAVEDGLKLAKRVYAGKERQFAAPPRPATGMERSSEPFLPTAPMVYAVISDPAIVDNP  66

Query  346  DVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            D+PSYQPHV+G CDPPALIPLQM  + +  EC LD AFV V+G WRVHCVM ++SCDC
Sbjct  67   DIPSYQPHVYGACDPPALIPLQMGDVGLEVECLLDAAFVAVSGRWRVHCVMRNKSCDC  124



>gb|KJB07322.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=654

 Score =   177 bits (449),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  330
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>gb|KJB07324.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
 gb|KJB07326.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=614

 Score =   176 bits (447),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  330
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>gb|KJB07323.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=781

 Score =   177 bits (449),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  330
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>gb|KJB07327.1| hypothetical protein B456_001G016000 [Gossypium raimondii]
Length=756

 Score =   176 bits (447),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  330
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>gb|KCW79380.1| hypothetical protein EUGRSUZ_C00792 [Eucalyptus grandis]
Length=600

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 97/127 (76%), Gaps = 6/127 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPS------APMLYAVI  318
            MA +FA AV+DGLRLSKR+ FGKDRAV  PR+   ME+   +   +      +PM+YAVI
Sbjct  1    MADDFAKAVDDGLRLSKRLYFGKDRAVTAPRSPAPMERAPAAGEAALLLLPASPMVYAVI  60

Query  319  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  498
             +P VVDNPD+PSYQPHVHGRCDPPALIPLQMN I V A+C LD A V V+GSWRVHCVM
Sbjct  61   PDPTVVDNPDIPSYQPHVHGRCDPPALIPLQMNGIEVEADCQLDAAVVRVSGSWRVHCVM  120

Query  499  GSRSCDC  519
            GS+ CDC
Sbjct  121  GSKCCDC  127



>ref|XP_009389548.1| PREDICTED: uncharacterized protein LOC103976087 [Musa acuminata 
subsp. malaccensis]
Length=747

 Score =   176 bits (446),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVA-PPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDN  342
            EFA AVE+GL+L+KR+  GKDR +A PP     ME+T  S LP APM+YAVI +PA+VDN
Sbjct  6    EFAKAVEEGLKLAKRVYAGKDRQLAAPPLPAAKMERTPESLLPGAPMVYAVISDPAIVDN  65

Query  343  PDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            PD+PSYQPHVHGRC+PPALIPLQM  I +  +C L TAFV V G W+VHCVM  +SCDC
Sbjct  66   PDIPSYQPHVHGRCNPPALIPLQMGEIGLEVDCLLGTAFVAVRGRWKVHCVMRHKSCDC  124



>gb|KHG29331.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=756

 Score =   176 bits (445),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAV--APPRAMTAMEKTAHSYLPSAPMLYAVIENPA  330
            MA +FA AVEDGL+L+KRI  GKD+AV  AP      ++  A  YLPSAPM+YAVI +P 
Sbjct  1    MAEDFAKAVEDGLKLAKRIYLGKDKAVMTAPKPPSPPVQGLADYYLPSAPMVYAVISDPR  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
             VDNPD PSYQPHV+GRCDPPALIPLQM+ + +   CY DTAFV ++G WRVHCVMGS S
Sbjct  61   FVDNPDFPSYQPHVYGRCDPPALIPLQMSGVDLEVNCYGDTAFVQISGKWRVHCVMGSHS  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010047465.1| PREDICTED: uncharacterized protein LOC104436401 [Eucalyptus grandis]
 gb|KCW79379.1| hypothetical protein EUGRSUZ_C00792 [Eucalyptus grandis]
Length=755

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 97/127 (76%), Gaps = 6/127 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPS------APMLYAVI  318
            MA +FA AV+DGLRLSKR+ FGKDRAV  PR+   ME+   +   +      +PM+YAVI
Sbjct  1    MADDFAKAVDDGLRLSKRLYFGKDRAVTAPRSPAPMERAPAAGEAALLLLPASPMVYAVI  60

Query  319  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  498
             +P VVDNPD+PSYQPHVHGRCDPPALIPLQMN I V A+C LD A V V+GSWRVHCVM
Sbjct  61   PDPTVVDNPDIPSYQPHVHGRCDPPALIPLQMNGIEVEADCQLDAAVVRVSGSWRVHCVM  120

Query  499  GSRSCDC  519
            GS+ CDC
Sbjct  121  GSKCCDC  127



>gb|KJB82978.1| hypothetical protein B456_013G222900 [Gossypium raimondii]
Length=749

 Score =   172 bits (436),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 77/122 (63%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKD-RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  333
            MA +FA AVEDGL+L+KR+  GKD R VA   A   ME++ + YLPSAPM+YAVI +P +
Sbjct  1    MAEDFAKAVEDGLKLAKRVYLGKDSRTVARRMAPPLMERSTNWYLPSAPMVYAVISDPRM  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHG  DPPALIPLQM  +++  +CY+DTA + V G+WR+HCVMGSRSC
Sbjct  61   VDNPDMPSYQPYVHGMYDPPALIPLQMMGVNLNVDCYVDTAIIVVAGTWRIHCVMGSRSC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_009625881.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X1 [Nicotiana tomentosiformis]
Length=745

 Score =   169 bits (429),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 73/124 (59%), Positives = 98/124 (79%), Gaps = 7/124 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---YLPSAPMLYAVIENP  327
            MA +FA +V+ GL+L+KRI +GK+    PP+ +   +K++ +   YLP+ PM+YAVI +P
Sbjct  1    MADDFATSVDMGLQLAKRIYYGKN----PPKPLVMEKKSSFTEINYLPTGPMMYAVIRDP  56

Query  328  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  507
            ++VDNPD+PSYQP+VHGRCDPPALIPL M++I +  +CY+DTAFVTV GSWRVHCV  SR
Sbjct  57   SIVDNPDIPSYQPYVHGRCDPPALIPLDMHAIGMEVDCYMDTAFVTVNGSWRVHCVASSR  116

Query  508  SCDC  519
             CDC
Sbjct  117  CCDC  120



>ref|XP_009625882.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0285981-like isoform X2 [Nicotiana tomentosiformis]
Length=744

 Score =   169 bits (429),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 73/124 (59%), Positives = 98/124 (79%), Gaps = 7/124 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---YLPSAPMLYAVIENP  327
            MA +FA +V+ GL+L+KRI +GK+    PP+ +   +K++ +   YLP+ PM+YAVI +P
Sbjct  1    MADDFATSVDMGLQLAKRIYYGKN----PPKPLVMEKKSSFTEINYLPTGPMMYAVIRDP  56

Query  328  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  507
            ++VDNPD+PSYQP+VHGRCDPPALIPL M++I +  +CY+DTAFVTV GSWRVHCV  SR
Sbjct  57   SIVDNPDIPSYQPYVHGRCDPPALIPLDMHAIGMEVDCYMDTAFVTVNGSWRVHCVASSR  116

Query  508  SCDC  519
             CDC
Sbjct  117  CCDC  120



>emb|CDO97834.1| unnamed protein product [Coffea canephora]
Length=736

 Score =   168 bits (425),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 70/121 (58%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +F+ +VE GL+LSKRI +GK+ +   P  M    +T    LP+ PM+YAVI  P++V
Sbjct  1    MADQFSKSVEFGLKLSKRIFYGKESSAPAPAVMERKSETNWPLLPTGPMVYAVISEPSMV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQP+VHGRC+PPALIPL M+ +++  +CYLDTAF+TVTG+WR+HCV  S+SCD
Sbjct  61   DNPDIPSYQPYVHGRCEPPALIPLHMHGVAMEVDCYLDTAFITVTGTWRLHCVTASKSCD  120

Query  517  C  519
            C
Sbjct  121  C  121



>ref|XP_010318476.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0292028 isoform X4 [Solanum lycopersicum]
Length=641

 Score =   167 bits (424),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 71/122 (58%), Positives = 98/122 (80%), Gaps = 5/122 (4%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            MA EFA++V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+ +P++
Sbjct  1    MADEFASSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVRDPSM  56

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHGRCDPPALIPL M  I++  +CY+DTAFVTV G+WRVHC+  SR C
Sbjct  57   VDNPDIPSYQPYVHGRCDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRVHCIASSRYC  116

Query  514  DC  519
            DC
Sbjct  117  DC  118



>ref|XP_009764208.1| PREDICTED: uncharacterized protein LOC104215964 isoform X1 [Nicotiana 
sylvestris]
Length=745

 Score =   166 bits (421),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 9/125 (7%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK----TAHSYLPSAPMLYAVIEN  324
            MA +FA +V+ GL+L+KRI +GK+    PP+ +  MEK    T  +YLP  PM+YAVI +
Sbjct  1    MADDFATSVDMGLQLAKRIYYGKN----PPKPLV-MEKKSSFTETNYLPMGPMMYAVIRD  55

Query  325  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  504
            P++VDNPD+PSYQP+VHGRCDPPALIPL M +I +  +CY+DTAFVTV GSWRVHCV  S
Sbjct  56   PSMVDNPDIPSYQPYVHGRCDPPALIPLDMQAIGMEVDCYMDTAFVTVNGSWRVHCVASS  115

Query  505  RSCDC  519
            R CDC
Sbjct  116  RCCDC  120



>ref|XP_009764209.1| PREDICTED: uncharacterized protein LOC104215964 isoform X2 [Nicotiana 
sylvestris]
Length=744

 Score =   166 bits (421),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 9/125 (7%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK----TAHSYLPSAPMLYAVIEN  324
            MA +FA +V+ GL+L+KRI +GK+    PP+ +  MEK    T  +YLP  PM+YAVI +
Sbjct  1    MADDFATSVDMGLQLAKRIYYGKN----PPKPLV-MEKKSSFTETNYLPMGPMMYAVIRD  55

Query  325  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  504
            P++VDNPD+PSYQP+VHGRCDPPALIPL M +I +  +CY+DTAFVTV GSWRVHCV  S
Sbjct  56   PSMVDNPDIPSYQPYVHGRCDPPALIPLDMQAIGMEVDCYMDTAFVTVNGSWRVHCVASS  115

Query  505  RSCDC  519
            R CDC
Sbjct  116  RCCDC  120



>gb|KCW71314.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=527

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA +V+ GL LSKRI +GK  A AP     AM ++   YLP+APM+YAV+ +P  V
Sbjct  1    MARKFAGSVDYGLALSKRIYYGKGAATAPDPP--AMSRSPDDYLPTAPMVYAVVPDPTAV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VHGRCDPPAL+PLQM+ +++  +CYLDTAFV++TG WRVHC+M SR CD
Sbjct  59   DNPDVPSYQPYVHGRCDPPALVPLQMHEVAMEVDCYLDTAFVSMTGRWRVHCIMTSRRCD  118

Query  517  C  519
            C
Sbjct  119  C  119



>ref|XP_006587053.1| PREDICTED: uncharacterized protein LOC100820133 [Glycine max]
Length=759

 Score =   166 bits (421),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 81/123 (66%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF+ +VE+GLRLSKRI FG DRAV+PP+   +M K+  + LP+APMLYAVI +PA+V
Sbjct  1    MAEEFSKSVEEGLRLSKRIYFGNDRAVSPPKPPPSMSKSHTACLPTAPMLYAVIHDPAIV  60

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLD-TAFVTVTGSWRVHCVMGSRS  510
            DNPDVPSYQP+VHG+CDPPALIPL M  ++ + A CY++  AFVTV+GSWR+HCV GSR+
Sbjct  61   DNPDVPSYQPYVHGQCDPPALIPLHMIGNVHLQAHCYVNAVAFVTVSGSWRLHCVSGSRT  120

Query  511  CDC  519
            CDC
Sbjct  121  CDC  123



>ref|XP_010318475.1| PREDICTED: uncharacterized protein LOC101253877 isoform X3 [Solanum 
lycopersicum]
Length=739

 Score =   166 bits (420),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 71/122 (58%), Positives = 98/122 (80%), Gaps = 5/122 (4%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            MA EFA++V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+ +P++
Sbjct  1    MADEFASSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVRDPSM  56

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHGRCDPPALIPL M  I++  +CY+DTAFVTV G+WRVHC+  SR C
Sbjct  57   VDNPDIPSYQPYVHGRCDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRVHCIASSRYC  116

Query  514  DC  519
            DC
Sbjct  117  DC  118



>gb|KCW71313.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=590

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA +V+ GL LSKRI +GK  A AP     AM ++   YLP+APM+YAV+ +P  V
Sbjct  1    MARKFAGSVDYGLALSKRIYYGKGAATAPDPP--AMSRSPDDYLPTAPMVYAVVPDPTAV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VHGRCDPPAL+PLQM+ +++  +CYLDTAFV++TG WRVHC+M SR CD
Sbjct  59   DNPDVPSYQPYVHGRCDPPALVPLQMHEVAMEVDCYLDTAFVSMTGRWRVHCIMTSRRCD  118

Query  517  C  519
            C
Sbjct  119  C  119



>ref|XP_004235553.1| PREDICTED: uncharacterized protein LOC101253877 isoform X1 [Solanum 
lycopersicum]
Length=744

 Score =   166 bits (420),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 71/122 (58%), Positives = 98/122 (80%), Gaps = 5/122 (4%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            MA EFA++V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+ +P++
Sbjct  1    MADEFASSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVRDPSM  56

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHGRCDPPALIPL M  I++  +CY+DTAFVTV G+WRVHC+  SR C
Sbjct  57   VDNPDIPSYQPYVHGRCDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRVHCIASSRYC  116

Query  514  DC  519
            DC
Sbjct  117  DC  118



>ref|XP_010318474.1| PREDICTED: uncharacterized protein LOC101253877 isoform X2 [Solanum 
lycopersicum]
Length=743

 Score =   166 bits (419),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 71/122 (58%), Positives = 98/122 (80%), Gaps = 5/122 (4%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            MA EFA++V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+ +P++
Sbjct  1    MADEFASSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVRDPSM  56

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHGRCDPPALIPL M  I++  +CY+DTAFVTV G+WRVHC+  SR C
Sbjct  57   VDNPDIPSYQPYVHGRCDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRVHCIASSRYC  116

Query  514  DC  519
            DC
Sbjct  117  DC  118



>gb|EYU21307.1| hypothetical protein MIMGU_mgv1a001939mg [Erythranthe guttata]
Length=736

 Score =   165 bits (418),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 79/125 (63%), Positives = 93/125 (74%), Gaps = 5/125 (4%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAV----APPRAMTAMEKTAHSYLPSAPMLYAVIEN  324
            MA EF+AAV+ GLRL KRI +GKD A      PPR    M   A SYLP+A M+YA + +
Sbjct  1    MAAEFSAAVDVGLRLCKRIYYGKDAAAPVVSVPPRT-AEMSPEAESYLPAALMVYAEVND  59

Query  325  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  504
            PAVV+NPDVPSYQP+VHGRC+ PALIPL M+ +SV  +C LDTAFVTV G+WRVHCV  S
Sbjct  60   PAVVENPDVPSYQPYVHGRCETPALIPLHMHGVSVEVDCCLDTAFVTVGGAWRVHCVSAS  119

Query  505  RSCDC  519
            RSC C
Sbjct  120  RSCYC  124



>gb|KCW71310.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=694

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA +V+ GL LSKRI +GK  A AP     AM ++   YLP+APM+YAV+ +P  V
Sbjct  1    MARKFAGSVDYGLALSKRIYYGKGAATAPDPP--AMSRSPDDYLPTAPMVYAVVPDPTAV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VHGRCDPPAL+PLQM+ +++  +CYLDTAFV++TG WRVHC+M SR CD
Sbjct  59   DNPDVPSYQPYVHGRCDPPALVPLQMHEVAMEVDCYLDTAFVSMTGRWRVHCIMTSRRCD  118

Query  517  C  519
            C
Sbjct  119  C  119



>ref|XP_007216978.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
 gb|EMJ18177.1| hypothetical protein PRUPE_ppa002885mg [Prunus persica]
Length=624

 Score =   164 bits (415),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 95/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF++ VE GL LSKR+ +GK+ +V  P AMT   +++ SYLP APM+YAV+ +P+VV
Sbjct  1    MAAEFSSCVEYGLGLSKRVFYGKE-SVPDPSAMT---RSSESYLPEAPMVYAVVPDPSVV  56

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQP+VHG C+PPALIPL M+ I++  E YLDTAFVTV G+WRVHCV   + CD
Sbjct  57   DNPDIPSYQPYVHGMCEPPALIPLHMHGIAMEIESYLDTAFVTVNGTWRVHCVSAGKRCD  116

Query  517  C  519
            C
Sbjct  117  C  117



>ref|XP_010064019.1| PREDICTED: uncharacterized protein LOC104450974 [Eucalyptus grandis]
 gb|KCW71311.1| hypothetical protein EUGRSUZ_F04397 [Eucalyptus grandis]
Length=751

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +FA +V+ GL LSKRI +GK  A AP     AM ++   YLP+APM+YAV+ +P  V
Sbjct  1    MARKFAGSVDYGLALSKRIYYGKGAATAPDPP--AMSRSPDDYLPTAPMVYAVVPDPTAV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VHGRCDPPAL+PLQM+ +++  +CYLDTAFV++TG WRVHC+M SR CD
Sbjct  59   DNPDVPSYQPYVHGRCDPPALVPLQMHEVAMEVDCYLDTAFVSMTGRWRVHCIMTSRRCD  118

Query  517  C  519
            C
Sbjct  119  C  119



>ref|XP_009414823.1| PREDICTED: uncharacterized protein LOC103995835 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=599

 Score =   162 bits (410),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 76/122 (62%), Positives = 92/122 (75%), Gaps = 5/122 (4%)
 Frame = +1

Query  169  FAAAVEDGLRLSKRINFGKDR----AVAPPRAMTAMEKTAHS-YLPSAPMLYAVIENPAV  333
            FA AVEDGL+L+KR+  GKD+     V  PR    ME++  S +LP+APM+YAVI +PA+
Sbjct  7    FAKAVEDGLKLAKRVYAGKDQRFAPPVPAPRPAAGMERSPESPFLPAAPMVYAVITDPAI  66

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDPPALIPL M  I V  +C LD+AFV + G WRVHCVM +RS 
Sbjct  67   VDNPDIPSYQPHVHGRCDPPALIPLHMTDIGVEVDCILDSAFVAIRGRWRVHCVMRTRSS  126

Query  514  DC  519
            DC
Sbjct  127  DC  128



>ref|XP_008228173.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Prunus 
mume]
Length=749

 Score =   162 bits (409),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 71/121 (59%), Positives = 96/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF++ VE GL LSKR+ +GK+ +V  P AMT   +++ SYLP APM+YAV+ +P++V
Sbjct  1    MAAEFSSCVEYGLGLSKRVFYGKE-SVPDPSAMT---RSSESYLPEAPMVYAVVPDPSIV  56

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQP+VHG C+PPAL+PL M+ I++  E YLDTAFVTV+G+WR+HCV   + CD
Sbjct  57   DNPDIPSYQPYVHGMCEPPALMPLHMHGIAMEIESYLDTAFVTVSGTWRLHCVAAGKRCD  116

Query  517  C  519
            C
Sbjct  117  C  117



>gb|KJB35007.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=745

 Score =   162 bits (409),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  RGVMAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENP  327
            + V+A EF+++V  GL LSKRI +GK  +  P     ++  T   YLP+A M YAV+  P
Sbjct  4    KSVIADEFSSSVSCGLMLSKRIYYGKGASPTPALMSRSLSSTESCYLPTAVMAYAVVSEP  63

Query  328  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  507
            +VVDNPDVPSYQP+VHGRC+PPALIPL M+ +S+  +C++DTAFVT +G+WRVHC+M  R
Sbjct  64   SVVDNPDVPSYQPYVHGRCEPPALIPLHMHEVSMEVDCWMDTAFVTASGAWRVHCIMAGR  123

Query  508  SCDC  519
             CDC
Sbjct  124  RCDC  127



>ref|XP_008373868.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Malus domestica]
Length=745

 Score =   161 bits (408),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 95/121 (79%), Gaps = 4/121 (3%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF++ VE GL LSKRI +GK+ +V  P AMT   +++ S+LP APM+YAV+ NP +V
Sbjct  1    MAAEFSSCVEYGLGLSKRIFYGKE-SVPDPLAMT---RSSKSFLPEAPMVYAVVTNPEIV  56

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            +NPD+PSYQP+VHG C PPALIPL M+ I++  E YLDTAFVTV+G+WRVHCV  ++ CD
Sbjct  57   ENPDIPSYQPYVHGLCQPPALIPLHMHGIAMEIEVYLDTAFVTVSGTWRVHCVSSAKRCD  116

Query  517  C  519
            C
Sbjct  117  C  117



>gb|KJB35006.1| hypothetical protein B456_006G094900 [Gossypium raimondii]
Length=763

 Score =   162 bits (409),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +1

Query  148  RGVMAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENP  327
            + V+A EF+++V  GL LSKRI +GK  +  P     ++  T   YLP+A M YAV+  P
Sbjct  4    KSVIADEFSSSVSCGLMLSKRIYYGKGASPTPALMSRSLSSTESCYLPTAVMAYAVVSEP  63

Query  328  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  507
            +VVDNPDVPSYQP+VHGRC+PPALIPL M+ +S+  +C++DTAFVT +G+WRVHC+M  R
Sbjct  64   SVVDNPDVPSYQPYVHGRCEPPALIPLHMHEVSMEVDCWMDTAFVTASGAWRVHCIMAGR  123

Query  508  SCDC  519
             CDC
Sbjct  124  RCDC  127



>ref|XP_004141711.1| PREDICTED: uncharacterized protein LOC101206287 [Cucumis sativus]
 ref|XP_004155911.1| PREDICTED: uncharacterized LOC101206287 [Cucumis sativus]
 gb|KGN45475.1| hypothetical protein Csa_7G448860 [Cucumis sativus]
Length=754

 Score =   161 bits (408),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 71/121 (59%), Positives = 85/121 (70%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF+ +VE GL LSKRI +GK     P      M + +  YLP APM+YAVI  P +V
Sbjct  1    MATEFSNSVEYGLHLSKRIYYGK--GSTPAALARQMSRVSEDYLPRAPMVYAVIPEPTIV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQP+VHGRC PPALIPL MN +S+   C  DTAF+ V G+WRVHCVM  RSC+
Sbjct  59   DNPDIPSYQPYVHGRCVPPALIPLHMNGVSMEINCCFDTAFICVNGTWRVHCVMAGRSCE  118

Query  517  C  519
            C
Sbjct  119  C  119



>ref|XP_008462286.1| PREDICTED: uncharacterized protein LOC103500681 isoform X2 [Cucumis 
melo]
Length=755

 Score =   161 bits (407),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 72/121 (60%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF+ +VE GL LSKRI +GK    AP      M + +  YLP APM+YAVI  P +V
Sbjct  1    MATEFSNSVEYGLHLSKRIYYGK--GSAPAALARQMSRVSEDYLPRAPMVYAVIPEPTIV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VHGRC PPALIPL MN +S+   C  DTAF+ V G+WRVHCVM  +SC+
Sbjct  59   DNPDVPSYQPYVHGRCVPPALIPLHMNGVSMEINCCFDTAFIGVNGTWRVHCVMAGKSCE  118

Query  517  C  519
            C
Sbjct  119  C  119



>ref|XP_009414822.1| PREDICTED: uncharacterized protein LOC103995835 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=754

 Score =   161 bits (407),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 76/122 (62%), Positives = 92/122 (75%), Gaps = 5/122 (4%)
 Frame = +1

Query  169  FAAAVEDGLRLSKRINFGKDR----AVAPPRAMTAMEKTAHS-YLPSAPMLYAVIENPAV  333
            FA AVEDGL+L+KR+  GKD+     V  PR    ME++  S +LP+APM+YAVI +PA+
Sbjct  7    FAKAVEDGLKLAKRVYAGKDQRFAPPVPAPRPAAGMERSPESPFLPAAPMVYAVITDPAI  66

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQPHVHGRCDPPALIPL M  I V  +C LD+AFV + G WRVHCVM +RS 
Sbjct  67   VDNPDIPSYQPHVHGRCDPPALIPLHMTDIGVEVDCILDSAFVAIRGRWRVHCVMRTRSS  126

Query  514  DC  519
            DC
Sbjct  127  DC  128



>gb|KDO64973.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
Length=591

 Score =   159 bits (403),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 8/125 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  324
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  325  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  504
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  505  RSCDC  519
            R CDC
Sbjct  117  RQCDC  121



>gb|KDO64974.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
 gb|KDO64975.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
Length=591

 Score =   159 bits (403),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 8/125 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  324
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  325  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  504
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  505  RSCDC  519
            R CDC
Sbjct  117  RQCDC  121



>ref|XP_008462285.1| PREDICTED: uncharacterized protein LOC103500681 isoform X1 [Cucumis 
melo]
Length=758

 Score =   160 bits (406),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 72/121 (60%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF+ +VE GL LSKRI +GK    AP      M + +  YLP APM+YAVI  P +V
Sbjct  1    MATEFSNSVEYGLHLSKRIYYGK--GSAPAALARQMSRVSEDYLPRAPMVYAVIPEPTIV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VHGRC PPALIPL MN +S+   C  DTAF+ V G+WRVHCVM  +SC+
Sbjct  59   DNPDVPSYQPYVHGRCVPPALIPLHMNGVSMEINCCFDTAFIGVNGTWRVHCVMAGKSCE  118

Query  517  C  519
            C
Sbjct  119  C  119



>gb|KEH18486.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=597

 Score =   159 bits (403),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MAG+F+++VE GL LSKRI+  K  A AP   +  M ++   +LPSAPM YAVI +P +V
Sbjct  1    MAGQFSSSVEFGLNLSKRIHHTKLSAPAP---LPEMTRSIDEHLPSAPMCYAVIPDPDIV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQP+V+GRCDPPALIPLQ+  I +  +C LDTAFVTVTG WRVHCV GS  CD
Sbjct  58   DNPDIRSYQPYVYGRCDPPALIPLQLQGIEMDVDCCLDTAFVTVTGRWRVHCVRGSSLCD  117

Query  517  C  519
            C
Sbjct  118  C  118



>gb|KEH18485.1| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=648

 Score =   159 bits (403),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MAG+F+++VE GL LSKRI+  K  A AP   +  M ++   +LPSAPM YAVI +P +V
Sbjct  1    MAGQFSSSVEFGLNLSKRIHHTKLSAPAP---LPEMTRSIDEHLPSAPMCYAVIPDPDIV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQP+V+GRCDPPALIPLQ+  I +  +C LDTAFVTVTG WRVHCV GS  CD
Sbjct  58   DNPDIRSYQPYVYGRCDPPALIPLQLQGIEMDVDCCLDTAFVTVTGRWRVHCVRGSSLCD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_004510514.1| PREDICTED: uncharacterized protein LOC101499440 [Cicer arietinum]
Length=757

 Score =   159 bits (402),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA +F+++VE GL LSKRI+  K+ A AP  AM+   ++   +LPSAPM YAVI +P +V
Sbjct  1    MAEQFSSSVEFGLNLSKRIHHVKESAPAPAPAMS---RSPKLHLPSAPMCYAVIPDPQIV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQP+V+GRCDPPALIPLQ++ I +  EC LDTAFVTVTG WRVHC+M S  CD
Sbjct  58   DNPDIRSYQPYVYGRCDPPALIPLQLHGIGMEVECCLDTAFVTVTGKWRVHCIMASSICD  117

Query  517  C  519
            C
Sbjct  118  C  118



>gb|AET01809.2| inter-alpha-trypsin inhibitor heavy chain-like protein [Medicago 
truncatula]
Length=753

 Score =   159 bits (401),  Expect = 7e-42, Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MAG+F+++VE GL LSKRI+  K  A AP   +  M ++   +LPSAPM YAVI +P +V
Sbjct  1    MAGQFSSSVEFGLNLSKRIHHTKLSAPAP---LPEMTRSIDEHLPSAPMCYAVIPDPDIV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQP+V+GRCDPPALIPLQ+  I +  +C LDTAFVTVTG WRVHCV GS  CD
Sbjct  58   DNPDIRSYQPYVYGRCDPPALIPLQLQGIEMDVDCCLDTAFVTVTGRWRVHCVRGSSLCD  117

Query  517  C  519
            C
Sbjct  118  C  118



>gb|KDO64972.1| hypothetical protein CISIN_1g004469mg [Citrus sinensis]
Length=751

 Score =   159 bits (401),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 8/125 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  324
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  325  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  504
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  505  RSCDC  519
            R CDC
Sbjct  117  RQCDC  121



>ref|XP_006465891.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
[Citrus sinensis]
Length=751

 Score =   159 bits (401),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 8/125 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  324
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  325  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  504
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  505  RSCDC  519
            R CDC
Sbjct  117  RQCDC  121



>ref|XP_006342928.1| PREDICTED: uncharacterized protein LOC102599336 [Solanum tuberosum]
Length=744

 Score =   158 bits (400),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 68/122 (56%), Positives = 97/122 (80%), Gaps = 5/122 (4%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH-SYLPSAPMLYAVIENPAV  333
            MA EFA +V+ GL+L+KRI +GK+    PP+ +   +K++  + LP+APM+YAV+++P++
Sbjct  1    MADEFATSVDMGLQLTKRIYYGKN----PPKPLVMEKKSSEINNLPTAPMVYAVVKDPSM  56

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+V+GR DPPALIPL M  I++  +CY+DTAFVTV G+WR+HC+  SR C
Sbjct  57   VDNPDIPSYQPYVYGRSDPPALIPLDMQGIAMEVDCYMDTAFVTVNGTWRMHCIASSRYC  116

Query  514  DC  519
            DC
Sbjct  117  DC  118



>ref|XP_006426697.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
 gb|ESR39937.1| hypothetical protein CICLE_v10024980mg [Citrus clementina]
Length=742

 Score =   158 bits (400),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 8/125 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKD----RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIEN  324
            MA EF + V  GL LSKRI +GK+    RAV PP     M +   SYLP A M+YAV+  
Sbjct  1    MASEFESCVNYGLNLSKRIYYGKEPGSGRAVMPP----GMTRQPESYLPEAVMVYAVVGE  56

Query  325  PAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGS  504
            P +VDNPDVPSYQP+VHG+C PPALIPL M+ + +  +C LDTAFV   GSWRVHC+M  
Sbjct  57   PQIVDNPDVPSYQPYVHGKCQPPALIPLHMHGVEMEVDCCLDTAFVAFNGSWRVHCIMAG  116

Query  505  RSCDC  519
            R CDC
Sbjct  117  RQCDC  121



>ref|XP_007135424.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07418.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=650

 Score =   157 bits (396),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA  F+ +VE GL LSKR+ +G+  A   P ++ +M ++   +LP+APM YAVI +P  V
Sbjct  1    MADYFSGSVEFGLNLSKRVYYGRGSA---PLSVPSMSRSPEGFLPTAPMCYAVISDPEKV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQP+V G CDPPALIPL+++ +++  EC LDTAFVTVTG WRVHCV GS +CD
Sbjct  58   DNPDIRSYQPYVLGECDPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTGSSTCD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_011072601.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105157816 
[Sesamum indicum]
Length=745

 Score =   157 bits (397),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 6/124 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDR---AVAPPRAMTAMEKTAHSYLPSAPMLYAVIENP  327
            MA EF+ AVE GL+LSKRI +GK+    ++APPR    M     SYLP+A M+YA I  P
Sbjct  1    MAAEFSKAVELGLKLSKRIYYGKNAPTVSLAPPRG-AEMTAETESYLPTAVMVYAEINEP  59

Query  328  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  507
             VVDNPDVPSYQP+VHGR   P LIPL M+ + +  +CYLDTAFVTV+G+WRVHCV  SR
Sbjct  60   GVVDNPDVPSYQPYVHGR--XPVLIPLHMHGVELEVDCYLDTAFVTVSGAWRVHCVAASR  117

Query  508  SCDC  519
            SCDC
Sbjct  118  SCDC  121



>ref|XP_006583165.1| PREDICTED: uncharacterized protein LOC100807956 isoform X2 [Glycine 
max]
Length=699

 Score =   156 bits (394),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 70/122 (57%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-AMEKTAHSYLPSAPMLYAVIENPAV  333
            MA  F+ +VE GL LSKRI +GK  A +P  AM+ ++ K+   YLP+APM YAVI +P  
Sbjct  1    MADYFSGSVEFGLNLSKRIYYGKGSAPSPAPAMSRSLSKSPEGYLPTAPMCYAVISDPEK  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            V+NPD+ SYQP+V G+C+PPALIPL+++ +++  EC LDTAFVTVTG WRVHCV  S +C
Sbjct  61   VENPDIRSYQPYVLGQCEPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTASSTC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_003528576.1| PREDICTED: uncharacterized protein LOC100807956 isoform X1 [Glycine 
max]
Length=756

 Score =   157 bits (396),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 70/122 (57%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-AMEKTAHSYLPSAPMLYAVIENPAV  333
            MA  F+ +VE GL LSKRI +GK  A +P  AM+ ++ K+   YLP+APM YAVI +P  
Sbjct  1    MADYFSGSVEFGLNLSKRIYYGKGSAPSPAPAMSRSLSKSPEGYLPTAPMCYAVISDPEK  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            V+NPD+ SYQP+V G+C+PPALIPL+++ +++  EC LDTAFVTVTG WRVHCV  S +C
Sbjct  61   VENPDIRSYQPYVLGQCEPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTASSTC  120

Query  514  DC  519
            DC
Sbjct  121  DC  122



>ref|XP_010111991.1| von Willebrand factor A domain-containing protein [Morus notabilis]
 gb|EXC32302.1| von Willebrand factor A domain-containing protein [Morus notabilis]
Length=745

 Score =   156 bits (394),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 69/127 (54%), Positives = 93/127 (73%), Gaps = 9/127 (7%)
 Frame = +1

Query  160  AGEFAAAVEDGLRLSKRINFGKD-------RAVAPPRAMTAMEKTAHSYLPSAPMLYAVI  318
            A EF++ V+ G++LSKRI +GKD            P+AMT     +  YLP+APM YAV+
Sbjct  3    AAEFSSCVDYGVQLSKRIYYGKDLRPSLSAAEAVEPQAMT--RSPSEEYLPTAPMAYAVV  60

Query  319  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  498
              PA+VDNPDVPSYQP+VHGRC+PPAL+PLQM+ +++  + YLDTAFV V+ +WRVHC+M
Sbjct  61   PEPAIVDNPDVPSYQPYVHGRCEPPALVPLQMHEVAMEVDAYLDTAFVGVSATWRVHCIM  120

Query  499  GSRSCDC  519
             ++ CDC
Sbjct  121  AAKRCDC  127



>ref|XP_007135423.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
 gb|ESW07417.1| hypothetical protein PHAVU_010G128200g [Phaseolus vulgaris]
Length=752

 Score =   155 bits (392),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA  F+ +VE GL LSKR+ +G+  A   P ++ +M ++   +LP+APM YAVI +P  V
Sbjct  1    MADYFSGSVEFGLNLSKRVYYGRGSA---PLSVPSMSRSPEGFLPTAPMCYAVISDPEKV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+ SYQP+V G CDPPALIPL+++ +++  EC LDTAFVTVTG WRVHCV GS +CD
Sbjct  58   DNPDIRSYQPYVLGECDPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTGSSTCD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_007024661.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
 gb|EOY27283.1| Inter-alpha-trypsin inhibitor heavy chain-related, putative [Theobroma 
cacao]
Length=752

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MAGEF+ +V  G+ LSKR+ +G+  + APP  M+    +  SY P+  M YAV+  PA V
Sbjct  1    MAGEFSTSVTCGIMLSKRLYYGRGASPAPP-VMSRSLSSTESYRPTGVMAYAVVPEPAAV  59

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VHGRCDPPALIPL M+ +S+  +C +DTAFVTV G+WRVHC+M SR CD
Sbjct  60   DNPDVPSYQPYVHGRCDPPALIPLHMHEVSMEVDCCMDTAFVTVRGAWRVHCIMSSRRCD  119

Query  517  C  519
            C
Sbjct  120  C  120



>ref|XP_009344471.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
 ref|XP_009344474.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Pyrus x bretschneideri]
Length=745

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF + VE GL LSKR+ +GK+    P    + M++++ SY P APM+YAV+ +P +V
Sbjct  1    MAAEFTSCVEYGLGLSKRVFYGKESVPNP----SEMKRSSKSYFPEAPMVYAVVSDPEIV  56

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQP+VHG C PPALIPL M+ I +  E YLDTAFVTV+G+WRVHCV  ++ C+
Sbjct  57   DNPDIPSYQPYVHGLCQPPALIPLHMHGIGMEIEVYLDTAFVTVSGTWRVHCVSAAKRCE  116

Query  517  C  519
            C
Sbjct  117  C  117



>ref|XP_010685291.1| PREDICTED: uncharacterized protein LOC104899734 [Beta vulgaris 
subsp. vulgaris]
Length=756

 Score =   154 bits (388),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 70/124 (56%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---YLPSAPMLYAVIENP  327
            MA +F  +V+ GL+LSKRI +GKD ++ PP+   +MEK++     +LP++PM+YAV+ +P
Sbjct  1    MADDFQRSVQLGLKLSKRIYYGKDPSMKPPQPPPSMEKSSEQEPQFLPTSPMVYAVVSDP  60

Query  328  AVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSR  507
             VVDNPD+ SYQP+VHGRC+PPALIPL +  I V  +CYLD AFV  TG+WR+HCV G+R
Sbjct  61   IVVDNPDIRSYQPYVHGRCNPPALIPLHLYGIEVEVDCYLDMAFVNFTGTWRLHCVDGNR  120

Query  508  SCDC  519
             CDC
Sbjct  121  RCDC  124



>ref|XP_004303707.1| PREDICTED: von Willebrand factor A domain-containing protein 
DDB_G0286969 [Fragaria vesca subsp. vesca]
Length=756

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 93/128 (73%), Gaps = 7/128 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPP-------RAMTAMEKTAHSYLPSAPMLYAV  315
            MAG+F++ VE GL +SKRI +GK+   APP        +  +       YLP +PM+YA 
Sbjct  1    MAGQFSSCVEYGLAISKRILYGKESVPAPPAMSRSSSHSSQSRPSPEQGYLPESPMVYAA  60

Query  316  IENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCV  495
            + +PA+VDNPD+PSYQP+V+GRC+PPALIPL M+ +++  E YL+TAFVTVTG+WRVHC+
Sbjct  61   VSDPAIVDNPDIPSYQPYVYGRCEPPALIPLHMHGVALEVESYLETAFVTVTGNWRVHCI  120

Query  496  MGSRSCDC  519
               +SCDC
Sbjct  121  STGKSCDC  128



>ref|XP_008342579.1| PREDICTED: uncharacterized protein LOC103405374 [Malus domestica]
Length=745

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF + VE GL LSKR+ +GK+    P    + M++++ SY P APM+YAV+ +P +V
Sbjct  1    MATEFTSCVEYGLGLSKRVFYGKESVPNP----SEMKRSSKSYFPEAPMVYAVVSDPEIV  56

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPD+PSYQP+VHG C PPALIPL M+ I +  E YLDTAFVTV+G+WRVHCV  ++ C+
Sbjct  57   DNPDIPSYQPYVHGLCQPPALIPLHMHGIGMEIEVYLDTAFVTVSGTWRVHCVSAAKRCE  116

Query  517  C  519
            C
Sbjct  117  C  117



>ref|XP_002532724.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
 gb|EEF29655.1| inter-alpha-trypsin inhibitor heavy chain, putative [Ricinus 
communis]
Length=752

 Score =   151 bits (382),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 72/123 (59%), Positives = 85/123 (69%), Gaps = 5/123 (4%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  330
            MA EF   V+ GLRLSKRI +GK+    PP     M KT    SYLP+A M+YAV+  P 
Sbjct  1    MAEEFGTCVDYGLRLSKRIYYGKE---LPPAPEPEMSKTVSWESYLPTAVMVYAVVPEPE  57

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
             VDNPDVPSYQP+VHGRC PPALIPLQM+ +++  +C LD A V+  G WRVHCV  SR 
Sbjct  58   AVDNPDVPSYQPYVHGRCQPPALIPLQMHGVAMDVDCCLDYANVSFNGKWRVHCVKTSRK  117

Query  511  CDC  519
            CDC
Sbjct  118  CDC  120



>gb|KDP40680.1| hypothetical protein JCGZ_24679 [Jatropha curcas]
Length=750

 Score =   150 bits (379),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA EF  +V+ GL+LSKRI +GK     PP  +  M K++ S+LP+A M+YAVI  P VV
Sbjct  1    MADEFETSVDFGLKLSKRIYYGKG---LPPAPVLGMSKSSESFLPTAVMVYAVIPEPEVV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDV SYQPHVHGRC+PPALIPL M  +++  E  LD A V+ +G+WRVHC+  S  CD
Sbjct  58   DNPDVQSYQPHVHGRCEPPALIPLHMYGVAMEVESCLDHANVSFSGNWRVHCIKASSKCD  117

Query  517  C  519
            C
Sbjct  118  C  118



>gb|KFK41669.1| hypothetical protein AALP_AA2G157400 [Arabis alpina]
Length=761

 Score =   150 bits (379),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+LS+RI +GK   VAPP        +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGK--GVAPPIVQDPPSSSPENFLPTAITAYASITDPVAV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VH RCDP AL+PLQM  I ++ +C+LDTAFV+VTG WRVHCVM S+  D
Sbjct  59   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMSIDCWLDTAFVSVTGRWRVHCVMPSKRFD  118

Query  517  C  519
            C
Sbjct  119  C  119



>gb|KHN01425.1| Inter-alpha-trypsin inhibitor heavy chain H3 [Glycine soja]
Length=753

 Score =   149 bits (377),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 68/121 (56%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            MA  F+ +VE GL LSKRI +G   A A  R+++   K+   YLP+APM YAVI +P  V
Sbjct  1    MADYFSGSVEFGLNLSKRIYYGPSPAPAMSRSLS---KSPEGYLPTAPMCYAVISDPEKV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            +NPD+ SYQP+V G+C+PPALIPL+++ +++  EC LDTAFVTVTG WRVHCV  S +CD
Sbjct  58   ENPDIRSYQPYVLGQCEPPALIPLELHGVAMEVECSLDTAFVTVTGKWRVHCVTASSTCD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_009337232.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3 [Pyrus 
x bretschneideri]
Length=757

 Score =   149 bits (375),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 60/94 (64%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = +1

Query  241  PPRAMTAMEK-TAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN  417
            PP+   +M+K T+ ++LP+APM+YAVI +P +VDNPD+PSYQPHVHGRCDPPALIPL MN
Sbjct  31   PPKHPPSMDKATSCAFLPTAPMVYAVISDPGIVDNPDIPSYQPHVHGRCDPPALIPLTMN  90

Query  418  SISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
             + +  +CY+DTAF+ V+GSWRVHC+ GS+SC C
Sbjct  91   RVELQVDCYMDTAFIRVSGSWRVHCIKGSKSCGC  124



>emb|CDX72920.1| BnaC06g33680D [Brassica napus]
Length=756

 Score =   148 bits (373),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+LS+RI +GK   +APP  +   + +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAVRVEQGLKLSRRIYYGK--GIAPP-VVPDPQSSPENFLPTAITAYASITDPVAV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAFVTVTG WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMRVDCWLDTAFVTVTGRWRVHCVMPSKRFD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_009105911.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4 [Brassica 
rapa]
 emb|CDX96412.1| BnaA07g30230D [Brassica napus]
Length=756

 Score =   147 bits (372),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+LS+RI +GK   +APP  +   + +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAVRVEQGLKLSRRIYYGK--GIAPP-VVPDPQSSPENFLPTAITAYASITDPVAV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAFVTVTG WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMRVDCWLDTAFVTVTGRWRVHCVMPSKRFD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_011035746.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Populus euphratica]
Length=641

 Score =   146 bits (368),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT        + A SYLP+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAASAAMTRSMSSKSSELAESYLPTALMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN-SISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +VDNPDVPSYQP+VHGRC+PPALIPLQM+ ++++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVDNPDVPSYQPYVHGRCEPPALIPLQMHGAVAMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
             SR CD
Sbjct  121  ASRKCD  126



>gb|KHG04434.1| von Willebrand factor A domain-containing [Gossypium arboreum]
Length=735

 Score =   146 bits (369),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 71/122 (58%), Positives = 85/122 (70%), Gaps = 19/122 (16%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKD-RAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  333
            MA +FA AVEDGL+L+KR+  GKD R VA   A   ME++ + YLPSAPM+YAVI +P +
Sbjct  1    MAEDFAKAVEDGLKLAKRVYLGKDSRTVARRMAPPLMERSTNWYLPSAPMVYAVISDPRM  60

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPD+PSYQP+VHG  DPPALIPLQM                   G+WR+HCVMGSRSC
Sbjct  61   VDNPDMPSYQPYVHGMYDPPALIPLQM------------------MGTWRIHCVMGSRSC  102

Query  514  DC  519
            DC
Sbjct  103  DC  104



>ref|XP_011035745.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X3 [Populus euphratica]
Length=643

 Score =   145 bits (365),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT        + A SYLP+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAASAAMTRSMSSKSSELAESYLPTALMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN-SISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +VDNPDVPSYQP+VHGRC+PPALIPLQM+ ++++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVDNPDVPSYQPYVHGRCEPPALIPLQMHGAVAMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
             SR CD
Sbjct  121  ASRKCD  126



>ref|XP_010428136.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X1 [Camelina sativa]
 ref|XP_010428137.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
isoform X2 [Camelina sativa]
Length=758

 Score =   145 bits (365),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 64/121 (53%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+L++RI +GK   + PP A +    +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLARRIYYGK--GITPPLAPSDPPSSPENFLPTAITAYASITDPVAV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VH RCDP AL+PLQM  + +  +C+LDTAFV+++G WRVHCVM S+  D
Sbjct  59   DNPDVPSYQPYVHARCDPSALVPLQMLGVEMRVDCWLDTAFVSISGRWRVHCVMPSKRFD  118

Query  517  C  519
            C
Sbjct  119  C  119



>ref|XP_011035743.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=756

 Score =   144 bits (363),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT        + A SYLP+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAASAAMTRSMSSKSSELAESYLPTALMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN-SISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +VDNPDVPSYQP+VHGRC+PPALIPLQM+ ++++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVDNPDVPSYQPYVHGRCEPPALIPLQMHGAVAMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
             SR CD
Sbjct  121  ASRKCD  126



>ref|XP_011035744.1| PREDICTED: uncharacterized protein LOC105133437 isoform X2 [Populus 
euphratica]
Length=717

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT        + A SYLP+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAASAAMTRSMSSKSSELAESYLPTALMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMN-SISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +VDNPDVPSYQP+VHGRC+PPALIPLQM+ ++++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVDNPDVPSYQPYVHGRCEPPALIPLQMHGAVAMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
             SR CD
Sbjct  121  ASRKCD  126



>ref|XP_002888881.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65140.1| hypothetical protein ARALYDRAFT_476383 [Arabidopsis lyrata subsp. 
lyrata]
Length=757

 Score =   143 bits (360),  Expect = 5e-36, Method: Composition-based stats.
 Identities = 67/121 (55%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+LS+RI +GK   + PP  +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFALRVEQGLKLSRRIYYGK--GITPP-VVPDSPSSPENFLPTAITAYASITDPVAV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LD AFVTVTG WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMRVDCWLDMAFVTVTGRWRVHCVMPSKRFD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_010471276.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=758

 Score =   141 bits (356),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 63/121 (52%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+LS+RI +GK   + PP        +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGK--GITPPLVPADPPSSPDNFLPTAITAYASITDPVAV  58

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNP+VPSYQP+VH RCDP AL+PLQM  + +  +C+LDTAFV+++G WRVHCVM S+  D
Sbjct  59   DNPEVPSYQPYVHARCDPSALVPLQMLGVEMRVDCWLDTAFVSISGRWRVHCVMPSKRFD  118

Query  517  C  519
            C
Sbjct  119  C  119



>ref|XP_006385519.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63316.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=535

 Score =   139 bits (350),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
            G+  CD
Sbjct  121  GNSKCD  126



>ref|XP_006385520.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63317.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=606

 Score =   139 bits (350),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
            G+  CD
Sbjct  121  GNSKCD  126



>ref|XP_010416000.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like 
[Camelina sativa]
Length=759

 Score =   140 bits (353),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 86/122 (70%), Gaps = 3/122 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA-HSYLPSAPMLYAVIENPAV  333
            M+ EFA  VE GL+LS+RI +GK   + PP   +    ++  ++LP+A   YA I +P  
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGK--GITPPLVPSDHPPSSPENFLPTAITAYASITDPVA  58

Query  334  VDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSC  513
            VDNPDVPSYQP+VH RCDP AL+PLQM  + +  +C+LDTAFV+++G WRVHCVM S+  
Sbjct  59   VDNPDVPSYQPYVHARCDPSALVPLQMLGVEMRVDCWLDTAFVSISGRWRVHCVMPSKRF  118

Query  514  DC  519
            DC
Sbjct  119  DC  120



>ref|XP_006385522.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63319.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=690

 Score =   139 bits (350),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
            G+  CD
Sbjct  121  GNSKCD  126



>ref|XP_006301970.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
 gb|EOA34868.1| hypothetical protein CARUB_v10022450mg [Capsella rubella]
Length=757

 Score =   139 bits (351),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 65/121 (54%), Positives = 82/121 (68%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+LS+RI +GK         +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGKGITPP---VVPDPPSSPENFLPTAITAYASITDPVAV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VH RCDP AL+PLQM  + +  +C+LDTAFVTVTG WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGVEMRVDCWLDTAFVTVTGRWRVHCVMPSKRFD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_011036461.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X4 [Populus euphratica]
Length=647

 Score =   138 bits (347),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 82/126 (65%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT          A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLNLSKRIYYGKEMTPAATAAMTRSMSAKSSDVAESYFPTAVMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +V+NPDVPSYQP+VHGRC+PPALIPL M   +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMLGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
            G+  CD
Sbjct  121  GNSKCD  126



>ref|XP_006390650.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
 gb|ESQ27936.1| hypothetical protein EUTSA_v10018177mg [Eutrema salsugineum]
Length=756

 Score =   139 bits (349),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 64/121 (53%), Positives = 81/121 (67%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+LS+RI +GK         +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFAIRVEQGLKLSRRIYYGKGITPP---LLPDPPSSPENFLPTAITAYASITDPVAV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAF TV+G WRVHCVM S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMRVDCWLDTAFFTVSGRWRVHCVMNSKRFD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_006385521.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|ERP63318.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=758

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
            G+  CD
Sbjct  121  GNSKCD  126



>ref|XP_002304123.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
 gb|EEE79102.1| hypothetical protein POPTR_0003s06600g [Populus trichocarpa]
Length=757

 Score =   138 bits (347),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKT---AHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT    EK+   A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLSLSKRIYYGKEMTPAATAAMTRSVSEKSSDVAESYFPTAVMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNS-ISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +V+NPDVPSYQP+VHGRC+PPALIPL M+  +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMHGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
            G+  CD
Sbjct  121  GNSKCD  126



>ref|NP_177394.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35331.1| uncharacterized protein AT1G72500 [Arabidopsis thaliana]
Length=756

 Score =   137 bits (344),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 65/121 (54%), Positives = 82/121 (68%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+L++RI +GK  A      +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFALRVEQGLQLARRIYYGKGIAPP---VVPDPPSSPENFLPTAITAYASITDPVAV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAFVTVTG WRVHCV  S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMNIDCWLDTAFVTVTGRWRVHCVRPSKRFD  117

Query  517  C  519
            C
Sbjct  118  C  118



>gb|AAG52586.1|AC016529_17 hypothetical protein; 14673-17893 [Arabidopsis thaliana]
Length=758

 Score =   137 bits (344),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 65/121 (54%), Positives = 82/121 (68%), Gaps = 3/121 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVV  336
            M+ EFA  VE GL+L++RI +GK  A      +     +  ++LP+A   YA I +P  V
Sbjct  1    MSEEFALRVEQGLQLARRIYYGKGIAPP---VVPDPPSSPENFLPTAITAYASITDPVAV  57

Query  337  DNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCD  516
            DNPDVPSYQP+VH RCDP AL+PLQM  I +  +C+LDTAFVTVTG WRVHCV  S+  D
Sbjct  58   DNPDVPSYQPYVHARCDPSALVPLQMLGIEMNIDCWLDTAFVTVTGRWRVHCVRPSKRFD  117

Query  517  C  519
            C
Sbjct  118  C  118



>ref|XP_011036459.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X2 [Populus euphratica]
Length=757

 Score =   136 bits (342),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 82/126 (65%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT          A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLNLSKRIYYGKEMTPAATAAMTRSMSAKSSDVAESYFPTAVMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +V+NPDVPSYQP+VHGRC+PPALIPL M   +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMLGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
            G+  CD
Sbjct  121  GNSKCD  126



>ref|XP_011036458.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H3-like 
isoform X1 [Populus euphratica]
Length=758

 Score =   136 bits (342),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 82/126 (65%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT-----AMEKTAHSYLPSAPMLYAVIE  321
            MA EFA  VE GL LSKRI +GK+   A   AMT          A SY P+A M YAV+ 
Sbjct  1    MAREFATCVEYGLNLSKRIYYGKEMTPAATAAMTRSMSAKSSDVAESYFPTAVMAYAVVS  60

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQM-NSISVAAECYLDTAFVTVTGSWRVHCVM  498
             P +V+NPDVPSYQP+VHGRC+PPALIPL M   +++  +C  D A V  +G+WRVHC+ 
Sbjct  61   EPELVENPDVPSYQPYVHGRCEPPALIPLHMLGVVTMEIDCCFDHANVCFSGAWRVHCIK  120

Query  499  GSRSCD  516
            G+  CD
Sbjct  121  GNSKCD  126



>ref|XP_006836596.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
 gb|ERM99449.1| hypothetical protein AMTR_s00131p00098870 [Amborella trichopoda]
Length=761

 Score =   134 bits (336),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 63/126 (50%), Positives = 85/126 (67%), Gaps = 8/126 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKD----RAVAP-PRAMTAMEKTAHSYLPSAPMLYAVIE  321
            M   F  +VE GL+LSKR+ +G++    R  AP P  M  +E + H + P +PM+Y++I 
Sbjct  1    MEEAFGRSVESGLKLSKRLYYGRNELSGRRSAPFPAKM--VEDSKHLF-PRSPMVYSMIS  57

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMG  501
            +P++VDNPD+PSYQPHV+G  DPPALIPL MN I V   C +++A   + GSWRVHCV  
Sbjct  58   DPSIVDNPDIPSYQPHVYGTLDPPALIPLHMNRIEVDVNCVVNSAIFELKGSWRVHCVSC  117

Query  502  SRSCDC  519
             R CDC
Sbjct  118  DRKCDC  123



>ref|XP_003627333.1| hypothetical protein MTR_8g021230, partial [Medicago truncatula]
Length=311

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  262  MEKTAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAEC  441
            M ++   +LPSAPM YAVI +P +VDNPD+ SYQP+V+GRCDPPALIPLQ+  I +  +C
Sbjct  1    MTRSIDEHLPSAPMCYAVIPDPDIVDNPDIRSYQPYVYGRCDPPALIPLQLQGIEMDVDC  60

Query  442  YLDTAFVTVTGSWRVHCVMGSRSCDC  519
             LDTAFVTVTG WRVHCV GS  CDC
Sbjct  61   CLDTAFVTVTGRWRVHCVRGSSLCDC  86



>ref|XP_010537629.1| PREDICTED: uncharacterized protein LOC104812256 [Tarenaya hassleriana]
Length=763

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTA--HSYLPSAPMLYAVIENPA  330
            M+ +FA  VE GL+LS+RI +GK  A+ PP         +   ++LP+A   Y+ I +P 
Sbjct  1    MSCDFAGRVEQGLQLSRRIYYGKGVALPPPVIPEPPPARSPPENFLPTAVTAYSAIYDPV  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
             VDNPDVPSYQP+VH RCDPPAL+PLQM +  V  +C+LDTA VT  G WRVHC+M  R 
Sbjct  61   AVDNPDVPSYQPYVHARCDPPALVPLQMLAAEVRVDCWLDTAVVTFIGRWRVHCLMACRR  120

Query  511  CDC  519
             DC
Sbjct  121  ADC  123



>dbj|BAJ95100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   129 bits (323),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 65/128 (51%), Positives = 80/128 (63%), Gaps = 9/128 (7%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-----TAHSYLPSAPMLYAVIE  321
            M  +F  AVEDGLRLSKR+         PPR   AM++      A S LP APM YAV+ 
Sbjct  1    MEEDFERAVEDGLRLSKRLVLPG--GAGPPRPHAAMDRYGAPEAATSLLPVAPMAYAVVT  58

Query  322  NPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLD--TAFVTVTGSWRVHCV  495
            +PA VD+PDVPSY+PHV+GR  PPALIPLQM  + +  +C     TA VT+   W +HC+
Sbjct  59   DPAAVDSPDVPSYKPHVYGRLSPPALIPLQMREVELRVDCAAGCATAEVTLVARWWLHCL  118

Query  496  MGSRSCDC  519
              SR CDC
Sbjct  119  TRSRDCDC  126



>gb|KHN39616.1| Inter-alpha-trypsin inhibitor heavy chain H5 [Glycine soja]
Length=742

 Score =   128 bits (321),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  AMEKTAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAE  438
            ++ K+   YLP+APM YAVI +P  V+NPD+ SYQP+V G+C+PPALIPL+++ + +  E
Sbjct  4    SLSKSPEGYLPTAPMCYAVISDPEKVENPDIRSYQPYVLGQCEPPALIPLELHGVGMEVE  63

Query  439  CYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            C LDTAFVTV+G WRVHCV  S +CDC
Sbjct  64   CSLDTAFVTVSGKWRVHCVTASSTCDC  90



>tpg|DAA41434.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=758

 Score =   126 bits (317),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 78/126 (62%), Gaps = 11/126 (9%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---------YLPSAPMLYAVI  318
            +FA AVEDGL+LSKR+           R    ME+T  S          LP+APM YAV+
Sbjct  3    DFARAVEDGLKLSKRLVLPGGVPPP--RPPAGMERTMSSASASGPDPRLLPTAPMAYAVV  60

Query  319  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  498
             +PA +D PDVPSYQP+V+G  DPPALIPLQM  + +A +C LD A VT+   W +HC+ 
Sbjct  61   TDPAAIDTPDVPSYQPYVYGHLDPPALIPLQMKEVDLAVDCALDAAHVTLRARWWLHCIT  120

Query  499  GSRSCD  516
             SR CD
Sbjct  121  RSRDCD  126



>tpg|DAA41433.1| TPA: hypothetical protein ZEAMMB73_769800 [Zea mays]
Length=1295

 Score =   127 bits (318),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 78/126 (62%), Gaps = 11/126 (9%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---------YLPSAPMLYAVI  318
            +FA AVEDGL+LSKR+           R    ME+T  S          LP+APM YAV+
Sbjct  3    DFARAVEDGLKLSKRLVLPGGVPPP--RPPAGMERTMSSASASGPDPRLLPTAPMAYAVV  60

Query  319  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  498
             +PA +D PDVPSYQP+V+G  DPPALIPLQM  + +A +C LD A VT+   W +HC+ 
Sbjct  61   TDPAAIDTPDVPSYQPYVYGHLDPPALIPLQMKEVDLAVDCALDAAHVTLRARWWLHCIT  120

Query  499  GSRSCD  516
             SR CD
Sbjct  121  RSRDCD  126



>ref|XP_010235662.1| PREDICTED: uncharacterized protein LOC100843408 [Brachypodium 
distachyon]
Length=746

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 82/122 (67%), Gaps = 7/122 (6%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEK-----TAHSYLPSAPMLYAVIENPA  330
            +FA AVEDGL+LSKR+       + PPR  T ME+      +   LP+APM YAV+ +P 
Sbjct  3    DFARAVEDGLKLSKRLV--LPGGLPPPRPPTGMERGPDAAVSQLLLPTAPMAYAVVSDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVMGSRS  510
             VD PDVPSYQP+V+GR DPPALIPLQM  I +AA+C LD A VT+   W +HC+  SR 
Sbjct  61   AVDTPDVPSYQPYVYGRLDPPALIPLQMKEIDLAADCTLDAAAVTLRARWWLHCITRSRE  120

Query  511  CD  516
            CD
Sbjct  121  CD  122



>ref|XP_002461009.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
 gb|EER97530.1| hypothetical protein SORBIDRAFT_02g039160 [Sorghum bicolor]
Length=751

 Score =   124 bits (312),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 79/126 (63%), Gaps = 11/126 (9%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---------YLPSAPMLYAVI  318
            +FA AVEDGL+LSKR+          P A   ME+T  +          LP+APM YAV+
Sbjct  3    DFARAVEDGLKLSKRLVLPGGLPPPRPPA--GMERTVSAAAASGPDPRLLPTAPMAYAVV  60

Query  319  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  498
             +PA VD PDVPSYQP+V+G  DPPALIPLQM  + +  +C +DTA VT+   W +HC+ 
Sbjct  61   TDPAAVDTPDVPSYQPYVYGNLDPPALIPLQMKEVDLTVDCAVDTAHVTLRARWWLHCIT  120

Query  499  GSRSCD  516
             SR CD
Sbjct  121  RSRECD  126



>gb|ABF96529.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=680

 Score =   122 bits (307),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 22/135 (16%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  303
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  304  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAF---VTVTG  474
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +C         VT+  
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVDCAAAGCAAAEVTLRA  114

Query  475  SWRVHCVMGSRSCDC  519
             W VHC+  +RSCDC
Sbjct  115  RWWVHCL--TRSCDC  127



>gb|ABF96530.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=614

 Score =   122 bits (305),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 22/135 (16%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  303
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  304  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAF---VTVTG  474
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +C         VT+  
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVDCAAAGCAAAEVTLRA  114

Query  475  SWRVHCVMGSRSCDC  519
             W VHC+  +RSCDC
Sbjct  115  RWWVHCL--TRSCDC  127



>gb|AAU89244.1| von Willebrand factor type A domain containing protein [Oryza 
sativa Japonica Group]
Length=801

 Score =   122 bits (305),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 22/135 (16%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  303
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  304  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAF---VTVTG  474
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +C         VT+  
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVDCAAAGCAAAEVTLRA  114

Query  475  SWRVHCVMGSRSCDC  519
             W VHC+  +RSCDC
Sbjct  115  RWWVHCL--TRSCDC  127



>ref|XP_010242206.1| PREDICTED: uncharacterized protein LOC104586618 [Nelumbo nucifera]
Length=121

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +1

Query  202  SKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGR  381
            +++ N    R+        AMEK++H+ LP++PMLYAVI +P +VD PD+ SYQPHVHGR
Sbjct  11   ARKANIIWKRSFRFASKAVAMEKSSHTLLPTSPMLYAVISDPTIVDKPDITSYQPHVHGR  70

Query  382  CDPPALIPLQMNSISVAAECYLDTAFVTVT  471
            CD PALIPLQMN+ISV  +CYLDT  + +T
Sbjct  71   CDLPALIPLQMNAISVEVDCYLDTGSLRLT  100



>gb|ABF96527.1| von Willebrand factor type A domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|EEC75447.1| hypothetical protein OsI_11983 [Oryza sativa Indica Group]
Length=751

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 22/135 (16%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  303
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  304  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAF---VTVTG  474
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +C         VT+  
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVDCAAAGCAAAEVTLRA  114

Query  475  SWRVHCVMGSRSCDC  519
             W VHC+  +RSCDC
Sbjct  115  RWWVHCL--TRSCDC  127



>ref|XP_006650182.1| PREDICTED: uncharacterized protein LOC102717967 [Oryza brachyantha]
Length=750

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 63/126 (50%), Positives = 80/126 (63%), Gaps = 6/126 (5%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT--AHSYLPSAPMLYAVIENPA  330
            M  +FA AVEDGL+LSKR+      A +P R +  M+++    S LPSAPM YAV+ +PA
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGGAPSP-RPLAPMDRSLDVTSLLPSAPMAYAVVVDPA  59

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYL---DTAFVTVTGSWRVHCVMG  501
              D+PDVPSYQPHV+GR DPPALIPL +  + +A +C       A VTV   W V C+  
Sbjct  60   AGDSPDVPSYQPHVYGRLDPPALIPLHVREVDLAVDCAYAGSPAAEVTVRARWWVQCIAR  119

Query  502  SRSCDC  519
            SR C C
Sbjct  120  SRDCHC  125



>ref|XP_003557739.1| PREDICTED: uncharacterized protein LOC100836064 [Brachypodium 
distachyon]
Length=754

 Score =   120 bits (302),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMT--AMEKTAHSYLPSAPMLYAVIENPA  330
            M  +FA AVEDGL+LSKR+          P A    A    A   LP+APM YAV+ +P 
Sbjct  1    MDEDFARAVEDGLKLSKRLVLPGGAPPPRPPAGMDRAAAWDAAPLLPTAPMAYAVVTDPG  60

Query  331  VVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLD--TAFVTVTGSWRVHCVMGS  504
             VD+PDVPSYQPHV+GR +PPALIPLQM  I +  +C     TA VTV   W +HC+  S
Sbjct  61   TVDSPDVPSYQPHVYGRLNPPALIPLQMREIDLRVDCVAGCATAEVTVRARWWLHCITRS  120

Query  505  RSCDC  519
            R CDC
Sbjct  121  RDCDC  125



>gb|EEE67586.1| hypothetical protein OsJ_25118 [Oryza sativa Japonica Group]
Length=755

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 75/127 (59%), Gaps = 11/127 (9%)
 Frame = +1

Query  169  FAAAVEDGLRLSKRI-----------NFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYAV  315
            FA AVEDGL+LSKR+             G DR V            A   LPSAPM YAV
Sbjct  4    FARAVEDGLKLSKRLVLPGGLPPPRPLAGMDRGVGVGGGGGGDASVAALLLPSAPMAYAV  63

Query  316  IENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCV  495
            + +P  VD PDVPSYQP+V+GR DPPALIPLQM  + ++ +C L  A VTV   W +HC+
Sbjct  64   VTDPGAVDTPDVPSYQPYVYGRLDPPALIPLQMKEVDLSVDCALGEAAVTVRARWWLHCI  123

Query  496  MGSRSCD  516
              SR CD
Sbjct  124  TRSRDCD  130



>ref|XP_004958289.1| PREDICTED: uncharacterized protein LOC101756562 [Setaria italica]
Length=751

 Score =   120 bits (301),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 60/128 (47%), Positives = 77/128 (60%), Gaps = 15/128 (12%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGK-----------DRAVAPPRAMTAMEKTAHSYLPSAPMLYA  312
            +FA AVEDGL+LSKR+               DR V+   A     +     LP+AP  YA
Sbjct  3    DFARAVEDGLKLSKRLVLPGGVPPPRPPAGMDRTVSAASAAGPDPR----LLPTAPTAYA  58

Query  313  VIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHC  492
            V+ +P  VD PDVPSYQP+V+GR +PPALIPLQM  + +A +C LD A VT+   W +HC
Sbjct  59   VVTDPGAVDTPDVPSYQPYVYGRLEPPALIPLQMKEVDLAVDCALDAAHVTLRARWWLHC  118

Query  493  VMGSRSCD  516
            +  SR CD
Sbjct  119  ITRSRECD  126



>tpg|DAA63586.1| TPA: hypothetical protein ZEAMMB73_270893 [Zea mays]
Length=750

 Score =   119 bits (299),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 60/126 (48%), Positives = 77/126 (61%), Gaps = 11/126 (9%)
 Frame = +1

Query  166  EFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHS---------YLPSAPMLYAVI  318
            +FA AVEDGL+LSKR+           R    ME+T  +          LP+APM YA++
Sbjct  3    DFARAVEDGLKLSKRLVLPGGVPPP--RPPAGMERTVSAASASGPDPRLLPTAPMAYALV  60

Query  319  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSWRVHCVM  498
             +PA VD PDVPSYQP+V+G  DPPALIPLQM  + +A +C LD A VT+   W +HC+ 
Sbjct  61   TDPAAVDTPDVPSYQPYVYGDLDPPALIPLQMKEVDLAVDCALDAAHVTLRARWWLHCIT  120

Query  499  GSRSCD  516
             SR  D
Sbjct  121  RSRDSD  126



>gb|EEC82439.1| hypothetical protein OsI_26857 [Oryza sativa Indica Group]
Length=863

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 79/132 (60%), Gaps = 16/132 (12%)
 Frame = +1

Query  154  VMAGEFAAAVEDGLRLSKRI-----------NFGKDRAVAPPRAMTAMEKTAHSYLPSAP  300
            VM G FA AVEDGL+LSKR+             G DR V      +     A   LPSAP
Sbjct  112  VMEG-FARAVEDGLKLSKRLVLPGGLPPPRPLAGMDRGVGGGGDAS----VAALLLPSAP  166

Query  301  MLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSW  480
            M YAV+ +P  VD PDVPSYQP+V+GR DPPALIPLQM  + ++ +C L  A VTV   W
Sbjct  167  MAYAVVTDPGAVDTPDVPSYQPYVYGRLDPPALIPLQMKEVDLSVDCALGEAAVTVRARW  226

Query  481  RVHCVMGSRSCD  516
             +HC+  SR CD
Sbjct  227  WLHCITRSRDCD  238



>ref|XP_002465153.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
 gb|EER92151.1| hypothetical protein SORBIDRAFT_01g032840 [Sorghum bicolor]
Length=756

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 79/130 (61%), Gaps = 9/130 (7%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH------SYLPSAPMLYAVI  318
            M   FA AVEDGL+L+KR+       + PPR   AM++           +P++PM YAV+
Sbjct  1    MDEAFARAVEDGLKLTKRLVLPNGGGLPPPRPHLAMDRDNDPAAALLQLMPASPMAYAVV  60

Query  319  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECY---LDTAFVTVTGSWRVH  489
             +P  VD+PDVPSYQPHV+GR DPPALIPLQM  + +  +C      TA V +   W VH
Sbjct  61   VDPGAVDSPDVPSYQPHVYGRLDPPALIPLQMREVDLRVDCAAAGCATAEVALRARWWVH  120

Query  490  CVMGSRSCDC  519
            C+  SR+C C
Sbjct  121  CITRSRACHC  130



>ref|XP_006658810.1| PREDICTED: inter alpha-trypsin inhibitor, heavy chain 4-like, 
partial [Oryza brachyantha]
Length=703

 Score =   114 bits (286),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 48/79 (61%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  280  SYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAF  459
            + LPSAPM YAV+ +P  VD PDVPSYQP+V+GR DPPALIPLQM  + +A +C LD A 
Sbjct  1    ALLPSAPMAYAVVSDPGAVDTPDVPSYQPYVYGRLDPPALIPLQMKEVDLAVDCALDEAA  60

Query  460  VTVTGSWRVHCVMGSRSCD  516
            VTV   W +HC+  SR CD
Sbjct  61   VTVRARWWLHCITRSRECD  79



>ref|XP_008667805.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=756

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 79/129 (61%), Gaps = 8/129 (6%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAM-TAMEK-----TAHSYLPSAPMLYAVI  318
            M   FA AVEDGL+L+KR+       + PP     AM++          +P+APM YAV+
Sbjct  1    MDEAFARAVEDGLKLTKRLVLPSGGGMPPPPRPHLAMDRDDPAAALQQLMPAAPMAYAVV  60

Query  319  ENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLD--TAFVTVTGSWRVHC  492
             +PA VD+PDVPSYQPHV+GR DPPALIPLQM  + +  +C     TA V +   W +HC
Sbjct  61   VDPAAVDSPDVPSYQPHVYGRLDPPALIPLQMREVELRVDCAAGCATAEVALRARWWLHC  120

Query  493  VMGSRSCDC  519
            +  SR+C C
Sbjct  121  ITRSRACHC  129



>gb|EEE59232.1| hypothetical protein OsJ_11214 [Oryza sativa Japonica Group]
Length=718

 Score =   106 bits (265),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 17/105 (16%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINF-----------GKDRAVAPPRAMTAMEKTAHSYLPSAPM  303
            M  +FA AVEDGL+LSKR+             G DR + P  A       A S LPSAPM
Sbjct  1    MEEDFARAVEDGLKLSKRLVLPGGAPSPRPVPGMDRGLLPDAA------AASSLLPSAPM  54

Query  304  LYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAE  438
             YAV+ +PA VD+PDVPSYQPHV+GR DPPALIPL M  +++A +
Sbjct  55   AYAVVVDPAAVDSPDVPSYQPHVYGRLDPPALIPLHMREVALAVD  99



>ref|XP_004984064.1| PREDICTED: uncharacterized protein LOC101774989 isoform X1 [Setaria 
italica]
Length=760

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 78/134 (58%), Gaps = 13/134 (10%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKT----------AHSYLPSAPML  306
            M   FA AV+DGL+L+KR+       + PPR    M++               LP++PM 
Sbjct  1    MEEAFARAVDDGLKLTKRLIMPGGGGLPPPRPPHGMDRDDDPGAAQAAWLRRLLPASPMA  60

Query  307  YAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECY---LDTAFVTVTGS  477
            YAV+ +P  VD+PDVPSYQPHV+GR DPPALIPLQM  + +  +C      TA V +   
Sbjct  61   YAVVVDPGAVDSPDVPSYQPHVYGRLDPPALIPLQMREVELRVDCAAAGCATAEVALRAR  120

Query  478  WRVHCVMGSRSCDC  519
            W VHCV  SR+C C
Sbjct  121  WWVHCVTRSRACHC  134



>ref|XP_006593107.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Glycine max]
Length=262

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  262  MEKTAHSYLPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISV  429
            M ++A ++LPSAPM+YAVI +P +VDNPD+PSYQPHV+GRCDPPALIPLQMN+ +V
Sbjct  1    MARSATAFLPSAPMVYAVISDPGIVDNPDIPSYQPHVYGRCDPPALIPLQMNARNV  56



>ref|XP_002446722.1| hypothetical protein SORBIDRAFT_06g021180 [Sorghum bicolor]
 gb|EES11050.1| hypothetical protein SORBIDRAFT_06g021180 [Sorghum bicolor]
Length=103

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +1

Query  301  MLYAVIENPAVVDNPDVPSYQPHVHGRCDPPALIPLQMNSISVAAECYLDTAFVTVTGSW  480
            M YAV+ +   VD+PDVPSYQPH++GR DPPALIPL+M  + +  +C    +  T   + 
Sbjct  1    MAYAVVVDSGAVDSPDVPSYQPHMYGRLDPPALIPLKMQEVELRVDCAA-ASCATTEVAL  59

Query  481  RVHC  492
            R HC
Sbjct  60   RAHC  63



>ref|XP_001768544.1| predicted protein [Physcomitrella patens]
 gb|EDQ66695.1| predicted protein [Physcomitrella patens]
Length=778

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/129 (32%), Positives = 62/129 (48%), Gaps = 12/129 (9%)
 Frame = +1

Query  169  FAAAVEDGLRLSKRINFG---KDRAVAPPRAMT---AMEKTAHSYLPSAPMLYAVIENPA  330
            F  ++  G  LS+++  G      ++ PP+  T     EK     LP+ PM+YA+I +  
Sbjct  7    FVTSIAAGQILSQQLRHGGGVSAPSLGPPKHSTIPTMPEKKKMKGLPTCPMIYAIITDLN  66

Query  331  VVDNPDVPSYQPHVHG---RCDPP---ALIPLQMNSISVAAECYLDTAFVTVTGSWRVHC  492
               NP V +    +H    R D P   AL+PL +  I +   C++ T FVT    W ++C
Sbjct  67   TFGNPKVDNAHGSLHPPTFRADAPPLPALVPLSLEMIELDVACHISTGFVTAKSRWNLNC  126

Query  493  VMGSRSCDC  519
            V    SCDC
Sbjct  127  VRSQASCDC  135



>gb|KHN07890.1| von Willebrand factor A domain-containing protein [Glycine soja]
Length=669

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  412  MNSISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            MN+I + A+CY +TAF+TV+G+WR+HCVMGSRSCDC
Sbjct  1    MNAIQMEADCYHETAFITVSGTWRLHCVMGSRSCDC  36



>ref|XP_001770617.1| predicted protein [Physcomitrella patens]
 gb|EDQ64600.1| predicted protein [Physcomitrella patens]
Length=634

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 65/129 (50%), Gaps = 14/129 (11%)
 Frame = +1

Query  160  AGEFAAAVEDGLRLSKRINFGK--DRAVAPPRAMTAMEKTAHSYLPSAPMLYAVIENPAV  333
            A  FA +V  G  L++++ +G   D     P   TA   T  ++L + PM+YAVI +  V
Sbjct  3    ANSFATSVGAGRVLAQQLRYGGPLDYPTMSPMDGTA---TQEAFL-TCPMVYAVITDMNV  58

Query  334  VDNPDVPSYQPH-VHGRCDP------PALIPLQMNSISVAAECYLDTAFVTVTGSWRVHC  492
                D   Y P+  H +  P      PA +PL +  + V  EC++ T FVT+  +W V+C
Sbjct  59   FGKADA-EYDPYNQHPQTYPMNAPTLPAFVPLTLGKMKVKVECHISTGFVTMKSTWHVNC  117

Query  493  VMGSRSCDC  519
            +    SCDC
Sbjct  118  IRSQASCDC  126



>ref|XP_010253846.1| PREDICTED: protein TIME FOR COFFEE-like [Nelumbo nucifera]
Length=381

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = +1

Query  157  MAGEFAAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAHSYLPSAPMLYA  312
            MA +F  +V+DGL+L+KRI FG DR+V+ PR + AMEK++H+ LP++PM YA
Sbjct  1    MAQQFVKSVKDGLKLAKRIYFGNDRSVSSPRPV-AMEKSSHTLLPTSPMFYA  51



>gb|EEE51525.1| hypothetical protein OsJ_32720 [Oryza sativa Japonica Group]
Length=53

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  286  LPSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDP  390
            LPSAPM YAV+ +P  VD PD+PSYQP+V+GR DP
Sbjct  17   LPSAPMAYAVVTDPGTVDTPDMPSYQPYVYGRLDP  51



>gb|EEC67542.1| hypothetical protein OsI_34867 [Oryza sativa Indica Group]
Length=59

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  289  PSAPMLYAVIENPAVVDNPDVPSYQPHVHGRCDP  390
            PSAPM YAV+ +P  VD PD+PSYQP+V+GR DP
Sbjct  24   PSAPMAYAVVTDPGTVDTPDMPSYQPYVYGRLDP  57



>gb|KJB83726.1| hypothetical protein B456_013G261400 [Gossypium raimondii]
Length=644

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  421  ISVAAECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            +++  +CY+DTA + V+G+WR+ CVMGSRSCDC
Sbjct  3    VNLNVDCYVDTAIIVVSGTWRIRCVMGSRSCDC  35



>ref|XP_006598837.1| PREDICTED: inter-alpha-trypsin inhibitor heavy chain H1-like 
[Glycine max]
Length=665

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +1

Query  436  ECYLDTAFVTVTGSWRVHCVMGSRSCDC  519
            EC LDTAFVTV+G WRVHCV  S +CDC
Sbjct  4    ECSLDTAFVTVSGKWRVHCVTASSTCDC  31



>ref|XP_011458408.1| PREDICTED: calcium-dependent protein kinase 11-like isoform X3 
[Fragaria vesca subsp. vesca]
 ref|XP_011458409.1| PREDICTED: calcium-dependent protein kinase 11-like isoform X3 
[Fragaria vesca subsp. vesca]
Length=471

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = +1

Query  172  AAAVEDGLRLSKRINFGKDRAVAPPRAMTAMEKTAH--SYLPSAPMLYAVIENPAVVDNP  345
            + AV+DGL LSK + F KD   +P +  +  +K+    +YLP +P +Y VI +P +V+N 
Sbjct  54   SNAVDDGLHLSKHLYFRKDPGKSPHKPSSGKDKSVVGCAYLPKSPTVYTVISDPMIVENS  113

Query  346  DVPSYQPHVHGRCDPPAL  399
            D+ S        C PPAL
Sbjct  114  DILS----TSRTCTPPAL  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000