BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005G07

Length=527
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     296   5e-98   Nicotiana sylvestris
ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     290   2e-95   Nicotiana tomentosiformis
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     285   1e-93   Nicotiana sylvestris
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     284   3e-93   Nicotiana tomentosiformis
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    283   7e-93   Solanum tuberosum [potatoes]
ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          283   9e-93   Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     282   3e-92   Solanum tuberosum [potatoes]
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          274   3e-89   Vitis vinifera
gb|KJB15718.1|  hypothetical protein B456_002G192400                    272   2e-88   Gossypium raimondii
gb|KHG25400.1|  Proteasome subunit beta type-5                          271   2e-88   Gossypium arboreum [tree cotton]
gb|KHG05622.1|  Proteasome subunit beta type-5                          271   3e-88   Gossypium arboreum [tree cotton]
gb|KJB78067.1|  hypothetical protein B456_012G175200                    271   5e-88   Gossypium raimondii
gb|KDP26783.1|  hypothetical protein JCGZ_17941                         271   6e-88   Jatropha curcas
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          270   1e-87   
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     270   1e-87   Sesamum indicum [beniseed]
ref|XP_007045045.1|  N-terminal nucleophile aminohydrolases (Ntn ...    268   1e-87   
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          269   2e-87   Pyrus x bretschneideri [bai li]
emb|CDP13326.1|  unnamed protein product                                271   2e-87   Coffea canephora [robusta coffee]
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5-like     269   2e-87   Cucumis sativus [cucumbers]
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          268   8e-87   Prunus mume [ume]
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    268   8e-87   
gb|EPS61043.1|  hypothetical protein M569_13757                         267   1e-86   Genlisea aurea
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          267   2e-86   Cucumis melo [Oriental melon]
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             266   3e-86   Prunus persica
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          266   3e-86   Beta vulgaris subsp. vulgaris [field beet]
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    266   4e-86   Spinacia oleracea
gb|KCW61971.1|  hypothetical protein EUGRSUZ_H04655                     262   1e-85   Eucalyptus grandis [rose gum]
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             264   2e-85   Eutrema salsugineum [saltwater cress]
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     263   6e-85   
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        263   8e-85   Eucalyptus grandis [rose gum]
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     262   1e-84   Pyrus x bretschneideri [bai li]
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             262   2e-84   Capsella rubella
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        261   2e-84   Camelina sativa [gold-of-pleasure]
ref|NP_189265.1|  proteasome subunit beta type-5-B                      261   3e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010105786.1|  Proteasome subunit beta type-5                     261   3e-84   Morus notabilis
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    261   3e-84   Populus euphratica
ref|XP_002312631.2|  20S proteasome beta subunit family protein         261   4e-84   
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    261   5e-84   Tarenaya hassleriana [spider flower]
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                260   7e-84   Erythranthe guttata [common monkey flower]
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    260   8e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          259   1e-83   Nelumbo nucifera [Indian lotus]
emb|CDY26610.1|  BnaA09g46670D                                          259   1e-83   Brassica napus [oilseed rape]
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        259   2e-83   Brassica rapa
emb|CDY21081.1|  BnaA08g24440D                                          259   2e-83   Brassica napus [oilseed rape]
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    259   2e-83   Brassica rapa
emb|CDX98014.1|  BnaA06g07650D                                          259   2e-83   
emb|CDY34594.1|  BnaC03g56940D                                          259   2e-83   Brassica napus [oilseed rape]
emb|CDY16054.1|  BnaC08g40690D                                          259   2e-83   Brassica napus [oilseed rape]
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        259   2e-83   Tarenaya hassleriana [spider flower]
emb|CDY19402.1|  BnaC05g09110D                                          258   5e-83   Brassica napus [oilseed rape]
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             258   8e-83   Eutrema salsugineum [saltwater cress]
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    258   9e-83   Camelina sativa [gold-of-pleasure]
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     256   2e-82   Phoenix dactylifera
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             256   3e-82   
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     256   4e-82   Nelumbo nucifera [Indian lotus]
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     254   1e-81   Glycine max [soybeans]
ref|XP_006842100.1|  hypothetical protein AMTR_s00078p00083100          254   1e-81   
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     254   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     253   3e-81   Elaeis guineensis
gb|KDO81953.1|  hypothetical protein CISIN_1g022125mg                   251   3e-81   Citrus sinensis [apfelsine]
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             253   5e-81   Phaseolus vulgaris [French bean]
gb|KHN31904.1|  Proteasome subunit beta type-5                          253   6e-81   Glycine soja [wild soybean]
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     253   7e-81   Elaeis guineensis
gb|ACU23791.1|  unknown                                                 253   7e-81   Glycine max [soybeans]
gb|ABK25888.1|  unknown                                                 252   8e-81   Picea sitchensis
gb|KDO81951.1|  hypothetical protein CISIN_1g022125mg                   253   1e-80   Citrus sinensis [apfelsine]
gb|ACP43315.1|  20S proteasome beta subunit 5                           252   1e-80   Citrus maxima [buntan]
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    251   2e-80   Brassica rapa
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    251   2e-80   Citrus sinensis [apfelsine]
ref|XP_002315619.1|  20S proteasome beta subunit family protein         251   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_006484069.1|  PREDICTED: proteasome subunit beta type-5-B-...    252   2e-80   Citrus sinensis [apfelsine]
gb|AFK46055.1|  unknown                                                 251   3e-80   Lotus japonicus
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    251   4e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006438070.1|  hypothetical protein CICLE_v10032238mg             252   4e-80   
gb|ABK25785.1|  unknown                                                 251   4e-80   Picea sitchensis
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             251   4e-80   Citrus clementina [clementine]
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    251   4e-80   Camelina sativa [gold-of-pleasure]
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     250   5e-80   Cucumis sativus [cucumbers]
gb|AAT44125.1|  20S proteasome beta subunit E                           246   5e-80   Saussurea medusa
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        250   5e-80   Camelina sativa [gold-of-pleasure]
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    250   6e-80   Populus euphratica
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     250   6e-80   Phoenix dactylifera
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg             250   6e-80   
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    250   7e-80   Glycine max [soybeans]
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             250   9e-80   Capsella rubella
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       250   1e-79   Cucumis sativus [cucumbers]
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     249   1e-79   Fragaria vesca subsp. vesca
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             249   1e-79   
ref|XP_003602092.1|  Proteasome subunit beta type                       248   3e-79   Medicago truncatula
ref|NP_172765.1|  20S proteasome beta subunit E1                        248   3e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AAK92808.1|  putative proteasome epsilon chain precursor             248   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative         246   1e-78   
gb|AFK34329.1|  unknown                                                 247   1e-78   Medicago truncatula
gb|ACJ85344.1|  unknown                                                 246   2e-78   Medicago truncatula
gb|AFK38197.1|  unknown                                                 246   2e-78   Medicago truncatula
ref|XP_010440898.1|  PREDICTED: proteasome subunit beta type-5-B-...    239   4e-77   
ref|NP_001184978.1|  20S proteasome beta subunit E1                     235   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     233   3e-73   Phoenix dactylifera
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     232   9e-73   Elaeis guineensis
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    229   2e-71   Oryza brachyantha
gb|AFW85805.1|  hypothetical protein ZEAMMB73_646691                    224   7e-71   
gb|ACU51028.1|  20S proteasome beta5 subunit                            227   1e-70   Conocephalum conicum
ref|XP_001759925.1|  predicted protein                                  226   2e-70   
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    224   5e-70   
ref|NP_001132821.1|  uncharacterized protein LOC100194311               224   9e-70   Zea mays [maize]
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    223   2e-69   Setaria italica
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          222   6e-69   Sorghum bicolor [broomcorn]
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       222   6e-69   Oryza sativa Japonica Group [Japonica rice]
gb|EEE65108.1|  hypothetical protein OsJ_20167                          221   1e-68   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056842.1|  Os06g0153800                                       221   2e-68   
gb|EEC80034.1|  hypothetical protein OsI_21721                          221   2e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             216   1e-66   Selaginella moellendorffii
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             216   1e-66   Selaginella moellendorffii
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    215   5e-66   Brachypodium distachyon [annual false brome]
gb|AAU82107.1|  20S proteasome beta 5 subunit                           213   2e-65   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ97061.1|  predicted protein                                      211   9e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAT80906.1|  26S proteasome beta subunit                             206   1e-64   Lemna minor
ref|XP_001751936.1|  predicted protein                                  201   5e-61   
dbj|BAG92607.1|  unnamed protein product                                197   7e-60   Oryza sativa Japonica Group [Japonica rice]
gb|EMS57921.1|  Proteasome subunit beta type-5                          194   2e-58   Triticum urartu
ref|XP_003061052.1|  predicted protein                                  194   6e-58   Micromonas pusilla CCMP1545
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        206   1e-57   
ref|XP_007514496.1|  predicted protein                                  194   2e-57   Bathycoccus prasinos
ref|XP_001421201.1|  predicted protein                                  193   3e-57   Ostreococcus lucimarinus CCE9901
gb|ABD61730.2|  26S proteasome beta subunit                             187   4e-57   Lupinus albus
ref|XP_002506817.1|  predicted protein                                  191   9e-57   Micromonas commoda
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...    189   6e-56   Ostreococcus tauri
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5         188   1e-55   Coccomyxa subellipsoidea C-169
gb|ABQ50544.1|  hypothetical protein                                    186   2e-55   Brassica rapa
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983              186   5e-55   Chlorella variabilis
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5         184   5e-54   Chlamydomonas reinhardtii
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437              184   5e-54   Volvox carteri f. nagariensis
ref|XP_011396916.1|  Proteasome subunit beta type-5-B                   182   2e-53   Auxenochlorella protothecoides
ref|XP_002889983.1|  hypothetical protein ARALYDRAFT_888660             171   8e-51   
gb|KDD75121.1|  proteasome subunit protein                              174   1e-50   Helicosporidium sp. ATCC 50920
ref|NP_001265983.1|  proteasome subunit beta type-5-like                171   3e-49   Cicer arietinum [garbanzo]
gb|EIE77859.1|  proteasome component PRE2                               170   1e-48   Rhizopus delemar RA 99-880
gb|EPB87271.1|  proteasome component PRE2                               168   5e-48   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN10935.1|  20S proteasome subunit                                 168   6e-48   Mucor ambiguus
emb|CEP17612.1|  hypothetical protein                                   168   6e-48   Parasitella parasitica
emb|CEG76258.1|  Putative Proteasome subunit beta type                  166   2e-47   Rhizopus microsporus
emb|CEG76257.1|  Putative Proteasome subunit beta type                  166   3e-47   Rhizopus microsporus
emb|CEJ04297.1|  Putative Proteasome subunit beta type                  164   5e-47   Rhizopus microsporus
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        163   8e-47   Prunus persica
ref|XP_002678668.1|  predicted protein                                  166   1e-46   Naegleria gruberi strain NEG-M
emb|CBY21147.1|  unnamed protein product                                164   3e-46   Oikopleura dioica
emb|CDH56820.1|  20s proteasome subunit                                 164   3e-46   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006957104.1|  20S proteasome subunit                             164   4e-46   Wallemia mellicola CBS 633.66
ref|XP_009038619.1|  hypothetical protein AURANDRAFT_28593              163   1e-45   Aureococcus anophagefferens
ref|XP_002290272.1|  proteasome subunit beta type 5 precursor           162   1e-45   Thalassiosira pseudonana CCMP1335
ref|XP_005537552.1|  20S core proteasome subunit beta 5                 163   1e-45   Cyanidioschyzon merolae strain 10D
emb|CAC43326.1|  putative beta5 proteasome subunit                      159   1e-45   Nicotiana tabacum [American tobacco]
ref|XP_009265754.1|  Proteasome component PRE2                          162   1e-45   Wallemia ichthyophaga EXF-994
gb|KFH71396.1|  20S proteasome subunit beta 5                           162   1e-45   Mortierella verticillata NRRL 6337
gb|EJU05281.1|  proteasome-domain-containing protein                    163   2e-45   Dacryopinax primogenitus
ref|XP_001730616.1|  hypothetical protein MGL_2412                      162   2e-45   Malassezia globosa CBS 7966
gb|ABE68720.1|  20S proteasome beta subunit                             160   2e-45   Arachis hypogaea [goober]
ref|XP_008036606.1|  proteasome component pts1                          162   3e-45   Trametes versicolor FP-101664 SS1
emb|CCM00020.1|  predicted protein                                      161   7e-45   Fibroporia radiculosa
gb|KIY65291.1|  proteasome-domain-containing protein                    161   7e-45   Cylindrobasidium torrendii FP15055 ss-10
emb|CCU99044.1|  unnamed protein product                                160   9e-45   Malassezia sympodialis ATCC 42132
ref|XP_007863011.1|  20S proteasome subunit                             160   1e-44   Gloeophyllum trabeum ATCC 11539
ref|XP_007006996.1|  hypothetical protein TREMEDRAFT_34309              160   1e-44   Tremella mesenterica DSM 1558
ref|XP_002111558.1|  hypothetical protein TRIADDRAFT_55706              159   1e-44   Trichoplax adhaerens
gb|KDQ60928.1|  hypothetical protein JAAARDRAFT_125152                  160   1e-44   Jaapia argillacea MUCL 33604
gb|AAM18885.1|AF391293_2  unknown                                       159   1e-44   Branchiostoma floridae
ref|XP_007395513.1|  hypothetical protein PHACADRAFT_255622             160   1e-44   Phanerochaete carnosa HHB-10118-sp
ref|XP_002162379.2|  PREDICTED: proteasome subunit beta type-5-like     159   2e-44   Hydra vulgaris
ref|XP_007385467.1|  N-terminal nucleophile aminohydrolase              160   2e-44   Punctularia strigosozonata HHB-11173 SS5
gb|KDE05583.1|  proteasome component PRE2                               160   2e-44   Microbotryum lychnidis-dioicae p1A1 Lamole
emb|CCF49354.1|  probable PRE2-20S core proteasome subunit (beta5)      160   3e-44   Ustilago hordei
gb|EIF47547.1|  proteasome component pre2 precursor                     159   3e-44   Brettanomyces bruxellensis AWRI1499
gb|EKD04801.1|  proteasome component                                    159   3e-44   Trichosporon asahii var. asahii CBS 8904
gb|EJT45706.1|  proteasome component                                    159   3e-44   Trichosporon asahii var. asahii CBS 2479
ref|XP_007326468.1|  hypothetical protein AGABI1DRAFT_111072            159   3e-44   Agaricus bisporus var. burnettii JB137-S8
gb|EJK48257.1|  hypothetical protein THAOC_32963                        157   3e-44   Thalassiosira oceanica
ref|XP_003332961.2|  20S proteasome subunit beta 5                      159   4e-44   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_005713380.1|  20S core proteasome subunit beta 5                 159   4e-44   Chondrus crispus [carageen]
ref|XP_006457891.1|  20S proteasome subunit                             159   4e-44   Agaricus bisporus var. bisporus H97
gb|KII89158.1|  hypothetical protein PLICRDRAFT_109139                  159   4e-44   Plicaturopsis crispa FD-325 SS-3
emb|CCO27714.1|  20S proteasome subunit beta 5                          159   4e-44   Rhizoctonia solani AG-1 IB
gb|KDQ33416.1|  hypothetical protein PLEOSDRAFT_1110569                 159   4e-44   Pleurotus ostreatus PC15
gb|KDR73611.1|  hypothetical protein GALMADRAFT_124865                  159   5e-44   Galerina marginata CBS 339.88
gb|AAS01050.1|  putative proteasome 20S beta5 subunit                   154   5e-44   Brassica napus [oilseed rape]
ref|XP_002730946.1|  PREDICTED: proteasome subunit beta type-5-like     158   5e-44   Saccoglossus kowalevskii
gb|KIK08153.1|  hypothetical protein K443DRAFT_672633                   159   6e-44   Laccaria amethystina LaAM-08-1
gb|KIK59625.1|  hypothetical protein GYMLUDRAFT_201809                  159   6e-44   Gymnopus luxurians FD-317 M1
ref|XP_002179855.1|  predicted protein                                  158   6e-44   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_001875479.1|  20S proteasome subunit                             159   6e-44   Laccaria bicolor S238N-H82
ref|XP_007418509.1|  20S proteasome subunit                             158   7e-44   Melampsora larici-populina 98AG31
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                  158   7e-44   
gb|KIJ17479.1|  hypothetical protein PAXINDRAFT_168130                  159   7e-44   Paxillus involutus ATCC 200175
ref|XP_007100520.1|  PREDICTED: proteasome subunit beta type-5 is...    155   7e-44   
ref|XP_006746559.1|  PREDICTED: proteasome subunit beta type-5          154   7e-44   Leptonychotes weddellii
gb|KIM65350.1|  hypothetical protein SCLCIDRAFT_542814                  158   8e-44   Scleroderma citrinum Foug A
ref|XP_007361365.1|  N-terminal nucleophile aminohydrolase              159   8e-44   Dichomitus squalens LYAD-421 SS1
ref|XP_007764597.1|  20S proteasome subunit                             158   8e-44   Coniophora puteana RWD-64-598 SS2
ref|XP_007880004.1|  hypothetical protein PFL1_04286                    159   1e-43   Anthracocystis flocculosa PF-1
ref|XP_007850837.1|  proteasome component pre2 precursor                158   1e-43   
gb|EMS25821.1|  20S proteasome subunit beta 5                           158   1e-43   Rhodotorula toruloides NP11
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5          157   1e-43   Otolemur garnettii
gb|KIW62885.1|  proteasome subunit beta type-5                          157   1e-43   Phialophora americana
gb|KIL00906.1|  hypothetical protein PAXRUDRAFT_821100                  158   1e-43   Paxillus rubicundulus Ve08.2h10
emb|CBN74512.1|  conserved unknown protein                              157   1e-43   Ectocarpus siliculosus
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                  157   1e-43   Capitella teleta
ref|XP_007723577.1|  proteasome component PRE2                          157   1e-43   Capronia coronata CBS 617.96
gb|EUC61688.1|  proteasome subunit beta type-5 protein                  157   1e-43   Rhizoctonia solani AG-3 Rhs1AP
gb|KEP54479.1|  proteasome subunit beta type-5 protein                  157   1e-43   Rhizoctonia solani 123E
ref|XP_007449603.1|  PREDICTED: proteasome subunit beta type-5 is...    155   1e-43   Lipotes vexillifer [baiji]
gb|KJA27011.1|  hypothetical protein HYPSUDRAFT_35526                   158   1e-43   Hypholoma sublateritium FD-334 SS-4
ref|XP_002911819.1|  proteasome component pts1                          158   1e-43   Coprinopsis cinerea okayama7#130
emb|CDO73558.1|  hypothetical protein BN946_scf185014.g28               157   2e-43   Trametes cinnabarina
ref|XP_004283229.1|  PREDICTED: proteasome subunit beta type-5 is...    154   2e-43   
gb|KIJ69319.1|  hypothetical protein HYDPIDRAFT_79749                   157   2e-43   Hydnomerulius pinastri MD-312
gb|ELU16739.1|  hypothetical protein CAPTEDRAFT_41193                   152   2e-43   Capitella teleta
ref|XP_008731643.1|  proteasome component PRE2                          157   2e-43   Cladophialophora carrionii CBS 160.54
gb|KFH47961.1|  Proteasome subunit beta type-like protein               157   2e-43   Acremonium chrysogenum ATCC 11550
gb|KIW59603.1|  proteasome subunit beta type-5                          156   2e-43   Exophiala xenobiotica
gb|KIW29970.1|  proteasome subunit beta type-5                          156   2e-43   Cladophialophora immunda
ref|XP_007739562.1|  proteasome component PRE2                          156   2e-43   Cladophialophora psammophila CBS 110553
gb|KIX98319.1|  proteasome subunit beta type-5                          156   2e-43   Fonsecaea multimorphosa CBS 102226
ref|XP_008156743.1|  PREDICTED: proteasome subunit beta type-5 is...    154   2e-43   
gb|KIW80298.1|  hypothetical protein Z517_06913                         156   2e-43   Fonsecaea pedrosoi CBS 271.37
ref|XP_007761346.1|  proteasome component PRE2                          156   2e-43   Cladophialophora yegresii CBS 114405
gb|EST08741.1|  20S proteasome, regulatory subunit beta type PSMB...    158   2e-43   Kalmanozyma brasiliensis GHG001
ref|XP_011276949.1|  Proteasome subunit beta type-5                     156   3e-43   Wickerhamomyces ciferrii
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5          155   3e-43   Dasypus novemcinctus
gb|EAW66194.1|  proteasome (prosome, macropain) subunit, beta typ...    152   3e-43   Homo sapiens [man]
emb|CAA66313.1|  LMP7-like protein                                      155   3e-43   Botryllus schlosseri
ref|XP_006696296.1|  hypothetical protein CTHT_0059780                  156   3e-43   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_009160370.1|  proteasome component PRE2                          156   4e-43   Exophiala dermatitidis NIH/UT8656
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5          155   4e-43   Galeopterus variegatus [Malayan flying lemur]
ref|XP_007321997.1|  hypothetical protein SERLADRAFT_475676             157   4e-43   Serpula lacrymans var. lacrymans S7.9
emb|CDI55907.1|  probable PRE2-20S core proteasome subunit (beta5...    157   4e-43   Melanopsichium pennsylvanicum 4
gb|KIW10869.1|  proteasome subunit beta type-5                          156   4e-43   Exophiala spinifera
ref|XP_007730075.1|  proteasome component PRE2                          156   4e-43   Capronia epimyces CBS 606.96
gb|KIW41006.1|  proteasome subunit beta type-5                          156   4e-43   Exophiala oligosperma
gb|KIO13433.1|  hypothetical protein M404DRAFT_122218                   156   4e-43   Pisolithus tinctorius Marx 270
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510              155   4e-43   Batrachochytrium dendrobatidis JAM81
gb|KDQ18004.1|  hypothetical protein BOTBODRAFT_104582                  156   4e-43   Botryobasidium botryosum FD-172 SS1
ref|XP_009541838.1|  subunit beta type peptidase T1A, 20S proteasome    156   5e-43   Heterobasidion irregulare TC 32-1
gb|ACP43316.1|  20S proteasome beta subunit 5                           153   5e-43   Citrus maxima [buntan]
ref|XP_007821942.1|  hypothetical protein MAA_05753                     155   5e-43   Metarhizium robertsii ARSEF 23
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...    155   5e-43   Physeter catodon
gb|EWM22648.1|  proteasome subunit beta type 5                          155   5e-43   Nannochloropsis gaditana
gb|KIV81807.1|  proteasome subunit beta type-5                          155   5e-43   Exophiala sideris
ref|XP_004755395.1|  PREDICTED: proteasome subunit beta type-5 is...    153   5e-43   
ref|XP_005267928.1|  PREDICTED: proteasome subunit beta type-5 is...    152   5e-43   
ref|XP_007989006.1|  PREDICTED: proteasome subunit beta type-5 is...    153   6e-43   Chlorocebus sabaeus
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5          155   6e-43   Carlito syrichta
emb|CDK27355.1|  unnamed protein product                                155   6e-43   Kuraishia capsulata CBS 1993
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...    153   6e-43   
gb|KIP12266.1|  hypothetical protein PHLGIDRAFT_17679                   156   6e-43   Phlebiopsis gigantea 11061_1 CR5-6
gb|EPS96804.1|  hypothetical protein FOMPIDRAFT_1025230                 156   6e-43   Fomitopsis pinicola FP-58527 SS1
dbj|BAA06097.1|  proteasome subunit X                                   153   6e-43   Homo sapiens [man]
dbj|GAM85683.1|  hypothetical protein ANO11243_036910                   155   7e-43   fungal sp. No.11243
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5          155   7e-43   Myotis davidii
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...    153   7e-43   synthetic construct
ref|XP_009209435.1|  PREDICTED: proteasome subunit beta type-5 is...    153   7e-43   Papio anubis [baboon]
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...    153   7e-43   
ref|XP_003363600.1|  PREDICTED: proteasome subunit beta type-5 is...    153   7e-43   
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...    154   8e-43   Lipotes vexillifer [baiji]
gb|KIY43500.1|  N-terminal nucleophile aminohydrolase                   155   8e-43   Fistulina hepatica ATCC 64428
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5          154   8e-43   Tupaia chinensis
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative         155   8e-43   Acanthamoeba castellanii str. Neff
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...    154   8e-43   Eptesicus fuscus
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5          154   8e-43   Myotis lucifugus
ref|XP_011391773.1|  putative proteasome core particle subunit be...    155   9e-43   Ustilago maydis 521
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...    154   9e-43   Orcinus orca [Orca]
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...    154   9e-43   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5          153   9e-43   
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5          154   9e-43   Saimiri boliviensis boliviensis
ref|XP_004347536.2|  hypothetical protein CAOG_04785                    155   1e-42   Capsaspora owczarzaki ATCC 30864
ref|XP_005560889.1|  PREDICTED: proteasome subunit beta type-5 is...    152   1e-42   
gb|KIM79653.1|  hypothetical protein PILCRDRAFT_823192                  155   1e-42   Piloderma croceum F 1598
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223             154   1e-42   Lottia gigantea
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like     154   1e-42   Myotis brandtii
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...    154   1e-42   Pantholops hodgsonii [Tibetan antelope]
gb|KIK46362.1|  hypothetical protein CY34DRAFT_420304                   155   1e-42   Suillus luteus UH-Slu-Lm8-n1
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5          154   1e-42   
ref|XP_790345.2|  PREDICTED: proteasome subunit beta type-5-like        153   1e-42   
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...    154   1e-42   
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...    154   1e-42   
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5          154   1e-42   
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...    154   1e-42   
emb|CDR40695.1|  CYFA0S05e03378g1_1                                     154   1e-42   
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like     154   1e-42   
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like     154   1e-42   
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like     154   1e-42   
gb|KEF54386.1|  proteasome component PRE2                               154   1e-42   
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5          154   1e-42   
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5          154   1e-42   
emb|CDQ73519.1|  unnamed protein product                                153   1e-42   
ref|XP_008718323.1|  hypothetical protein HMPREF1541_05764              154   2e-42   
gb|KHN95162.1|  proteasome component PRE2 precursor                     154   2e-42   
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like     154   2e-42   
ref|XP_003260674.1|  PREDICTED: proteasome subunit beta type-5 is...    152   2e-42   
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5          154   2e-42   
ref|XP_003954551.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    152   2e-42   
ref|XP_003036093.1|  hypothetical protein SCHCODRAFT_81440              155   2e-42   
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5          154   2e-42   
emb|CAD62626.1|  unnamed protein product                                152   2e-42   
ref|NP_001138404.1|  proteasome subunit beta type-5 isoform 3           152   2e-42   
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5          154   2e-42   
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5          154   2e-42   
ref|XP_006040730.1|  PREDICTED: proteasome subunit beta type-5-like     151   2e-42   
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...    154   2e-42   
gb|EMD38457.1|  20S proteasome subunit                                  155   2e-42   
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5          154   2e-42   
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5          154   2e-42   
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5          154   2e-42   
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5          153   2e-42   
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit               155   2e-42   
ref|XP_004609529.1|  PREDICTED: proteasome subunit beta type-5          153   2e-42   
ref|XP_005139397.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    153   2e-42   
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371              153   2e-42   
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5          153   2e-42   
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...    153   2e-42   
dbj|BAA08204.1|  proteasome subunit RCX                                 152   2e-42   
gb|EWC46740.1|  proteasome component PRE2                               154   3e-42   
ref|XP_009242876.1|  PREDICTED: proteasome subunit beta type-5-like     153   3e-42   
ref|XP_010887405.1|  PREDICTED: proteasome subunit beta type-5 is...    150   3e-42   
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...    153   3e-42   
ref|NP_001099197.2|  proteasome subunit beta type-5                     153   3e-42   
ref|XP_007319616.1|  hypothetical protein SERLADRAFT_470232             154   3e-42   
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5          153   3e-42   
gb|KIL61310.1|  hypothetical protein M378DRAFT_861259                   154   3e-42   
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                  151   3e-42   
gb|KIV93101.1|  proteasome subunit beta type-5                          154   3e-42   
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5          153   3e-42   
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...    151   3e-42   
emb|CCX09778.1|  Similar to Proteasome component PRE2; acc. no. P...    153   3e-42   
gb|KEQ99430.1|  hypothetical protein AUEXF2481DRAFT_76056               154   3e-42   
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like     153   3e-42   
gb|KEQ89998.1|  proteasome-domain-containing protein                    154   3e-42   
gb|KEQ71620.1|  proteasome-domain-containing protein                    154   3e-42   
ref|NP_001247774.1|  proteasome subunit beta type-5                     153   3e-42   
gb|AAB33092.1|  proteasome subunit MB1                                  151   4e-42   
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...    153   4e-42   
gb|AAY98499.1|  LMP X                                                   153   4e-42   
ref|XP_005707411.1|  20S proteasome subunit beta 5                      153   4e-42   
ref|XP_002835466.1|  hypothetical protein                               153   4e-42   
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...    153   4e-42   
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5          153   4e-42   
gb|KFY29536.1|  hypothetical protein V493_02281                         155   4e-42   
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5          152   4e-42   
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1              152   4e-42   
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...    152   4e-42   
gb|KIJ35744.1|  hypothetical protein M422DRAFT_180410                   150   4e-42   
emb|CAD97956.1|  hypothetical protein                                   152   4e-42   
gb|KEQ58949.1|  proteasome-domain-containing protein                    153   5e-42   
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5          152   5e-42   
ref|NP_001032701.1|  proteasome subunit beta type-5                     152   5e-42   
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5          152   5e-42   
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5          152   5e-42   
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5          152   5e-42   
gb|KFH65162.1|  20S proteasome subunit beta 5                           152   5e-42   
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5          152   5e-42   
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5          152   6e-42   
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...    152   6e-42   
gb|ELR56586.1|  Proteasome subunit beta type-5                          152   6e-42   
gb|AAB87680.1|  proteasome subunit X                                    151   6e-42   
ref|XP_005809292.1|  PREDICTED: proteasome subunit beta type-5-like     152   6e-42   
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5          152   6e-42   
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5          152   6e-42   
gb|KIX03620.1|  hypothetical protein Z518_07173                         152   7e-42   
gb|ADO27969.1|  proteasome subunit beta type-5                          152   7e-42   
ref|XP_007300583.1|  N-terminal nucleophile aminohydrolase              153   7e-42   
emb|CCA68455.1|  probable PRE2-20S core proteasome subunit (beta5...    153   7e-42   
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5          152   8e-42   
ref|XP_010887395.1|  PREDICTED: proteasome subunit beta type-5 is...    150   8e-42   
emb|CCE40402.1|  hypothetical protein CPAR2_104380                      152   8e-42   
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5          152   8e-42   
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5          152   8e-42   
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor                150   8e-42   
ref|NP_571226.1|  proteasome subunit beta type-5                        152   8e-42   
dbj|GAC98484.1|  20S proteasome subunit                                 157   8e-42   
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5          152   8e-42   
gb|AAD53518.1|AF155578_1  proteasome subunit beta 5                     152   9e-42   
gb|AAI53590.1|  Psmb5 protein                                           152   9e-42   
ref|XP_011123539.1|  hypothetical protein AOL_s00083g57                 152   9e-42   
emb|CBQ69839.1|  probable PRE2-20S core proteasome subunit (beta5)      153   9e-42   
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5          152   9e-42   
emb|CAQ14651.1|  proteasome (prosome, macropain) subunit, beta ty...    152   9e-42   
ref|NP_035316.1|  proteasome subunit beta type-5                        152   1e-41   
dbj|BAE93066.1|  low molecular mass polypeptide                         150   1e-41   
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5    152   1e-41   
ref|XP_002132107.1|  PREDICTED: proteasome subunit beta type-5          152   1e-41   
gb|ELR08191.1|  20S proteasome subunit beta 5                           152   1e-41   
gb|AAI55951.1|  LOC100127332 protein                                    151   1e-41   
gb|KEZ44601.1|  Proteasome subunit beta type-5                          152   1e-41   
emb|CEJ94974.1|  Putative Proteasome subunit beta type                  152   1e-41   
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5          151   1e-41   
ref|XP_008431210.1|  PREDICTED: proteasome subunit beta type-5          152   1e-41   
ref|XP_009226325.1|  proteasome component PRE2                          152   1e-41   
ref|XP_004994692.1|  LMP X protein                                      152   1e-41   
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5          152   1e-41   
gb|EPQ17641.1|  Proteasome subunit beta type-5                          154   1e-41   
ref|XP_010870425.1|  PREDICTED: proteasome subunit beta type-5-like     151   1e-41   
gb|KJE01830.1|  proteasome subunit beta type-5                          152   1e-41   
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5          151   1e-41   
ref|XP_007552653.1|  PREDICTED: proteasome subunit beta type-5          152   2e-41   
ref|XP_571562.1|  proteasome component pts1                             152   2e-41   
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5          151   2e-41   
ref|XP_001626004.1|  predicted protein                                  152   2e-41   
emb|CAF97719.1|  unnamed protein product                                151   2e-41   
ref|XP_003851747.1|  proteasome core particle subunit beta 5            152   2e-41   
gb|KGR00284.1|  proteasome component PRE2                               152   2e-41   
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5          151   2e-41   
ref|XP_001509497.1|  PREDICTED: proteasome subunit beta type-5          151   2e-41   
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5-like     151   2e-41   
gb|KIR99960.1|  proteasome subunit beta type-5                          152   2e-41   
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...    149   2e-41   
gb|KGQ95684.1|  proteasome component PRE2                               152   2e-41   
ref|XP_714824.1|  hypothetical protein CaO19.2233                       152   2e-41   
ref|XP_003194765.1|  proteasome component                               152   2e-41   
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5          151   2e-41   
ref|XP_002494106.1|  Beta 5 subunit of the 20S proteasome, respon...    151   2e-41   
gb|AFR96090.1|  proteasome component PRE2                               153   2e-41   
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...    151   2e-41   
ref|XP_628966.1|  proteasome subunit beta type 5                        151   2e-41   
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...    151   2e-41   
gb|EMF13044.1|  proteasome subunit beta type-5 precursor                151   2e-41   
emb|CDQ73245.1|  unnamed protein product                                151   2e-41   
ref|XP_007928014.1|  hypothetical protein MYCFIDRAFT_55997              151   2e-41   
ref|XP_008027551.1|  hypothetical protein SETTUDRAFT_163798             151   2e-41   
gb|KGK36555.1|  hypothetical protein JL09_g4296                         151   2e-41   
gb|ACH85299.1|  proteasome (prosome, macropain) subunit beta type 5     151   2e-41   
ref|XP_007683699.1|  hypothetical protein COCMIDRAFT_83732              151   2e-41   
ref|XP_007676937.1|  hypothetical protein BAUCODRAFT_70978              151   2e-41   
gb|ACI67172.1|  Proteasome subunit beta type-5 precursor                151   2e-41   
gb|ACM08263.1|  Proteasome subunit beta type-5 precursor                151   3e-41   
gb|ACM08758.1|  Proteasome subunit beta type-5 precursor                150   3e-41   
ref|XP_006963913.1|  proteasome catalytic subunit 3                     151   3e-41   
ref|XP_007806219.1|  Proteasome component PRE2                          151   3e-41   
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5          150   3e-41   
ref|XP_003303688.1|  hypothetical protein PTT_16006                     151   3e-41   
ref|XP_005825075.1|  20S proteasome subunit beta type 5                 151   3e-41   
gb|EEH19404.1|  proteasome component PRE2                               151   3e-41   
ref|XP_007584467.1|  putative proteasome component pre2 protein         151   3e-41   
emb|CCE27886.1|  probable 20S core proteasome subunit PRE2              151   3e-41   
gb|EDL31171.1|  mCG118255                                               149   3e-41   
gb|KIJ26450.1|  hypothetical protein M422DRAFT_236567                   151   4e-41   
ref|XP_003845348.1|  similar to proteasome subunit beta type-5          150   4e-41   
ref|XP_001932350.1|  proteasome subunit beta type-5 precursor           150   4e-41   
ref|XP_007772248.1|  proteasome component pts1                          151   4e-41   
ref|XP_455453.1|  hypothetical protein                                  150   4e-41   
gb|EKG17638.1|  Peptidase T1A proteasome beta-subunit                   150   4e-41   
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5          150   4e-41   
ref|XP_003867707.1|  Pre2 proteasome beta-5 subunit                     150   4e-41   
dbj|GAA98585.1|  hypothetical protein E5Q_05272                         151   4e-41   
ref|XP_002418590.1|  macropain subunit, putative; multicatalytic ...    150   4e-41   
ref|XP_001384894.1|  hypothetical protein PICST_36375                   150   4e-41   
ref|XP_002618149.1|  proteasome component PRE2 precursor                150   5e-41   
gb|AAL74417.1|  proteosome PSMB5/8 protein                              148   5e-41   
gb|KDB13437.1|  proteasome component PRE2 precursor                     150   5e-41   
ref|XP_003652191.1|  hypothetical protein THITE_2065666                 150   5e-41   
gb|EHK15431.1|  hypothetical protein TRIVIDRAFT_87262                   150   5e-41   
ref|XP_004181237.1|  hypothetical protein TBLA_0F01760                  150   5e-41   
ref|XP_003051739.1|  predicted protein                                  150   5e-41   
emb|CDQ86611.1|  unnamed protein product                                149   5e-41   
gb|KIN04587.1|  hypothetical protein OIDMADRAFT_156702                  150   5e-41   
ref|XP_009263168.1|  hypothetical protein FPSE_11776                    150   5e-41   
ref|XP_005994469.1|  PREDICTED: proteasome subunit beta type-5-like     150   5e-41   
ref|XP_001220016.1|  conserved hypothetical protein                     150   6e-41   
dbj|BAB26942.1|  unnamed protein product                                150   6e-41   
gb|EHK42320.1|  hypothetical protein TRIATDRAFT_135900                  150   6e-41   
gb|EWG55946.1|  proteasome component PRE2                               150   6e-41   
gb|EMT65514.1|  Proteasome component PRE2                               150   6e-41   
ref|XP_007289258.1|  proteasome A-type and B-type                       150   6e-41   
ref|XP_003718955.1|  proteasome component PRE2                          150   6e-41   
ref|XP_006667564.1|  proteasome component PRE2 precursor                150   6e-41   
ref|NP_593825.1|  20S proteasome component beta 5                       150   6e-41   
gb|KGB75936.1|  proteasome component pts1                               151   6e-41   
gb|KFA67504.1|  hypothetical protein S40285_00247                       150   6e-41   
ref|XP_008594307.1|  proteasome component PRE2                          150   7e-41   
gb|KEY71291.1|  hypothetical protein S7711_08872                        150   7e-41   
ref|XP_003005184.1|  proteasome component PRE2                          150   7e-41   
ref|XP_002626185.1|  proteasome component PRE2                          150   7e-41   
ref|XP_008121563.1|  PREDICTED: proteasome subunit beta type-5          150   8e-41   
ref|XP_007779133.1|  proteasome component PRE2                          150   8e-41   
ref|XP_007439509.1|  PREDICTED: proteasome subunit beta type-5          149   9e-41   
gb|ENH88518.1|  proteasome component pre2                               150   9e-41   
emb|CCF34208.1|  proteasome component PRE2                              150   9e-41   
ref|XP_006883201.1|  PREDICTED: proteasome subunit beta type-5          149   9e-41   
emb|CDH13818.1|  Proteasome component PRE2                              150   9e-41   
gb|ETS60462.1|  hypothetical protein PaG_05302                          154   9e-41   
ref|XP_003667884.1|  hypothetical protein NDAI_0A04860                  150   9e-41   
emb|CDF89695.1|  ZYBA0S04-10418g1_1                                     150   1e-40   
emb|CBK22690.2|  unnamed protein product                                149   1e-40   
ref|XP_007596580.1|  proteasome component PRE2                          150   1e-40   
ref|XP_007374634.1|  proteasome component PRE2 precursor                149   1e-40   
ref|XP_003659396.1|  hypothetical protein MYCTH_2296370                 149   1e-40   
gb|EFQ26512.1|  proteasome A-type and B-type                            150   1e-40   
gb|KDN66676.1|  putative proteasome A-type and B-type                   149   1e-40   
gb|KFA45931.1|  hypothetical protein S40293_09534                       150   1e-40   
ref|XP_002797291.1|  proteasome component PRE2                          149   1e-40   
ref|XP_011441202.1|  PREDICTED: proteasome subunit beta type-5-like     149   1e-40   
gb|KIK31131.1|  hypothetical protein PISMIDRAFT_73645                   147   1e-40   
ref|XP_007828102.1|  Proteasome component PRE2                          150   1e-40   



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   296 bits (759),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP+RGESSELFD+IP  PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLRGESSELFDDIPSSPSFQIPNTTNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD IP  PSFQIP+  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGIPSSPSFQIPDTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAPI+GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPIKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLS  152



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE TAP++GESSEL D I   PSFQIPN T+FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPTAPLKGESSELCDGILSSPSFQIPNATNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLS  152



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   283 bits (724),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   283 bits (724),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE +AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPSAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDFSGLE  AP+RGESSELFD I   PSF +PN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MMKIDFSGLEPRAPLRGESSELFDGISNSPSFHLPNTANFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   274 bits (700),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G +SEL       PSF++PN TDFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTVPLFGANSELLGGFSAAPSFELPNTTDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPVWGAPSELVDGFSAGPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE  AP+ G  SEL D     PSF +PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLEPAAPVSGAPSELVDGFSAAPSFDLPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   271 bits (692),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +G+ES AP+ G  +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGMESAAPVWGSHNELVDGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGTKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   271 bits (692),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G + ELF+     PSF++P  TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLFGATGELFNGFSTAPSFELPVTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESXAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++IDF GL+ +AP++G + +L +EI   PSF++P   DFDGFQK A+QMVKPAKGTTTL
Sbjct  1    MMKIDFGGLDPSAPLKGNTDDLHNEILAAPSFKLPITADFDGFQKAAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVAGASKLLANILYSYRGMGLS  152



>ref|XP_007045045.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY00877.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=213

 Score =   268 bits (684),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGLES AP+ GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MRLDTSGLESHAPLFGESSGFLDGVSAPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            VTM++IDFSGLE  + +RG  +EL   +   P FQIPN  DFDGFQK+++QMVKPAKGTT
Sbjct  66   VTMMKIDFSGLEPNSLLRGNPNELLSGLSTAPEFQIPNTNDFDGFQKESVQMVKPAKGTT  125

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  126  TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  185

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            CRLHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  186  CRLHELANKRRISVTGASKLLANILYSYRGMGLS  219



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004171974.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G + E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPLFGPTMEAMEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            H+LANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  HKLANKRRISVAGASKLLANILYSYRGMGLS  151



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   268 bits (684),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   268 bits (684),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+    +EL D     PSF++PN TDFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAEPVWATFNELADGFSAAPSFELPNTTDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++ID SGL+  AP++G S +L DEI   PSF++P   DFDGFQK A+QMVKPAKGTTTL
Sbjct  2    MMKIDLSGLDPLAPVKGNSDDLDDEIMAAPSFKLPTTVDFDGFQKAAVQMVKPAKGTTTL  61

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIF +GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  62   AFIFDKGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  121

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISVAGASKLL NILYSYRGMGLS
Sbjct  122  LHELANKRRISVAGASKLLGNILYSYRGMGLS  153



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   267 bits (682),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL++TAP+ G   E  +     PSF+IPN +DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQTTAPMFGPRMEALEGFAAAPSFEIPNSSDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR 
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRR  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLS  151



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES AP+ G SS   D     PSF++P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESAAPLVGASSGFLDGFADAPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAP+   S+ +FD +   PSF++PN  DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPLFRSSNVIFDGLQMTPSFELPNALDFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILY+YRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYNYRGMGLS  151



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   266 bits (679),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTAPI   S  +FD +   PSF +PN TDFDGFQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTAPIFRRSDFVFDGLQMTPSFDLPNPTDFDGFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKHGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILY+YRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYNYRGMGLS  151



>gb|KCW61971.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=201

 Score =   262 bits (670),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 138/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPMIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   263 bits (672),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   PSF++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPSFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   263 bits (671),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST P+ G + ELF+     P+F+IP   DFD FQK+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTMPVFGVNKELFEGFSAAPAFEIPGACDFDNFQKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINP+MLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPHMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAP-IRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES AP + GESS   D +   P+F++P   DFDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESHAPHLFGESSGFLDGVSGPPAFEVPTTNDFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   262 bits (669),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G SSE+ D    VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSSSEMLDGFSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 138/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E+T P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETTMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D     PSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSAPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLESTA + G S+E  D +   PSF +P+  D DGF K+A+QMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESTASLFGASNEFHDGLSTAPSFDLPSNVDLDGFLKEAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   261 bits (667),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES-SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++ D SGLESTA + G + SEL D     P+F++P  TDFDGFQK+A+QMVKPAKGTTTL
Sbjct  1    MKFDTSGLESTASVFGTAGSELVDGFSAAPAFELPTTTDFDGFQKEAVQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK+GV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKDGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 138/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLES  P+ G +  SE+ D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGLESNVPMFGRNCESEMLDGLSDVPSFDLPLANDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   260 bits (665),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            M++ID SGL+ +AP++  + +L +EI   PSF +P   DFDGFQK +IQMVKPA+GTTTL
Sbjct  1    MMKIDLSGLDPSAPMKRNTDDLDNEILATPSFALPTTVDFDGFQKASIQMVKPARGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRIS+AGASK+LANILYSYRGMGLS
Sbjct  121  LHELANKRRISIAGASKMLANILYSYRGMGLS  152



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   260 bits (664),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 138/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            ++ID SGLES  P+ G  +EL D     PSF++P  TDFDGFQK+A Q +KPAKGTTTLA
Sbjct  1    MKIDLSGLESAFPLFGGGNELSDGFSAAPSFELPCSTDFDGFQKEAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFTTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTVGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P  G   S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFESSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 136/153 (89%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG EST P+ G    +E+ D +  VPSF +P   DFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFESTLPMFGGNTETEMLDGLSSVPSFDLPFTKDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVPGASKLLANMLYSYRGMGLS  153



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   258 bits (659),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPA+GTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPARGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   258 bits (658),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 137/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPLIGFGSSNDMLDGFSSVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   258 bits (658),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 138/153 (90%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G +SE+ D +  VPSF +P  TDFDGFQK +++MVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPVIGFGSNSEMLDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG+MAGG+ADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGSMAGGSADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLS  151



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   256 bits (655),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 3/154 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SGLE+T P+   G +SE+ D    VPSF +P  TDFDGFQK A++MVKPAKGTTT
Sbjct  1    MKLDTSGLETTMPVIGFGSNSEMLDGFSSVPSFDLPRTTDFDGFQKKAVEMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS-SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            LAFIFKEGVMVAADSRASMGGYI  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   LAFIFKEGVMVAADSRASMGGYICMSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            CRLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  CRLHELANKRRISVSGASKLLANMLYSYRGMGLS  154



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES +P+    +E  +     PSF++P  TDFDGFQKDA Q +KPAKGTTTLA
Sbjct  1    MKLDLSGLESASPLFAVGNEFSNGFSAAPSFELPCTTDFDGFQKDAKQTLKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLL NILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLTNILYSYRGMGLS  151



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_006842100.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
 gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +R+D SGL S AP    + EL +    +PSFQ+PN  DFD FQK A+QMVKPAKGTTTLA
Sbjct  6    MRLDTSGLNSLAPAHVVNDELCEGFMSLPSFQLPNSADFDTFQKKAVQMVKPAKGTTTLA  65

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPY++GT+AGGAADCQFWHRNLG+KCRL
Sbjct  66   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYLIGTLAGGAADCQFWHRNLGIKCRL  125

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  126  HELANKRRISVTGASKLLANILYSYRGMGLS  156



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGL+S   I G + + L +++   PSFQ+P  +DFDGFQKDAIQMVKPAKGTTTL
Sbjct  1    MKLDLSGLQSFTSIPGGAVDGLGEDLFAAPSFQLPACSDFDGFQKDAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  LHELANKRRISVTGASKLLANILYSYRGMGLS  152



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   253 bits (647),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGL+S  P+     +L  ++   P+F +P   DFDGFQKDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLQSFVPLSAPIDDLCPDLSAPPTFDLPRSADFDGFQKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLS  151



>gb|KDO81953.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=212

 Score =   251 bits (641),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    S++   +   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPSLLAPQSDVVGALSAAPSFDLPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   PSF +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPSFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   253 bits (645),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP+ G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPLSGSIDDVCSDLSAHQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FVFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLS  151



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   253 bits (645),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E+   PSF +PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGT+AGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTVAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   252 bits (644),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +  +  L D     PSF+IPN  DFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQLSNDNLCDVFSPTPSFEIPNDADFDGFQKAAVQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINPY+LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|KDO81951.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=302

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   252 bits (643),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFSLPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIF EG MVAA SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFIEGAMVAAASRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESS-ELFD--EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            ++ D SGLEST+ + G +  EL D       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTSSVFGTAGRELVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            CRLHELANKRRISV GASKLLANIL+SYRGMGLS
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSYRGMGLS  154



>ref|XP_006484069.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X1 [Citrus 
sinensis]
Length=302

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFPKLVAPGNDVVGEFTAPPSFELPNSNDFDGFVKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASK+LANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKMLANILYSYRGMGLS  151



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_006438070.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51310.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=302

 Score =   252 bits (643),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLE     +     L D     PSF+IPN TDFDGFQK A+QMVKPAKGTTTLA
Sbjct  1    MKLDLSGLEPATLHQRSDDNLCDVFSPSPSFKIPNDTDFDGFQKAALQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEG+MVAADSRASMGGYISSQSVKKIIEINP++LGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGIMVAADSRASMGGYISSQSVKKIIEINPHLLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSVPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004159677.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  1    MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
             HEL NKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  RHELENKRRISVTGASKLLANILYSYRGMGLS  152



>gb|AAT44125.1| 20S proteasome beta subunit E [Saussurea medusa]
Length=150

 Score =   246 bits (628),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++DF GLES+AP+ G + + L D     PSF +P  +DFDGFQK +IQMVKPAKGTTTL
Sbjct  1    MKLDFGGLESSAPLYGGNDDVLSDGFSTAPSFDLPVTSDFDGFQKSSIQMVKPAKGTTTL  60

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AFIFKEGVMVAA+SRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  61   AFIFKEGVMVAANSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCR  120

Query  432  LHELANKRRISVAGASKLLANILYSY  509
            LHELANKRRISV GASKLLANILYSY
Sbjct  121  LHELANKRRISVTGASKLLANILYSY  146



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK A+ M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKKAVDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   250 bits (639),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 133/154 (86%), Gaps = 3/154 (2%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDE---IPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            ++ D SGLESTA + G +   F +       P+F++P   DFDGFQK+A+QMVKPAKGTT
Sbjct  1    MKFDTSGLESTASVFGTAGREFVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TLAFIFKEGV+VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGG ADCQFWHRNLG+K
Sbjct  61   TLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGGADCQFWHRNLGIK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            CRLHELANKRRISV GASKLLANIL+SYRGMGLS
Sbjct  121  CRLHELANKRRISVTGASKLLANILFSYRGMGLS  154



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   250 bits (639),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SG ES AP  G   ++  ++     F +PN +DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGFESFAPRSGLIDDVCSDLSAQQFFDLPNCSDFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGV+VAADSRASMGGYISSQ+VKKIIEINPYM+GTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVIVAADSRASMGGYISSQTVKKIIEINPYMIGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVAGASKLLANILYSYRGMGLS  151



>ref|XP_006438071.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51311.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=271

 Score =   250 bits (639),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLEST+P  G   EL  E+   PSF +P  TDFD FQKD    +K AKGTTTLA
Sbjct  1    MKLDTSGLESTSPFFGSGDELCPELLAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   250 bits (638),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D + LES   +    +++  E+   P F +PN  DFDGF KDAIQMVKPAKGTTTLA
Sbjct  1    MKLDTTSLESFPTLIAPQNDVAGELSAAPFFDLPNSNDFDGFLKDAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  HELANKRRISVTGASKLLANILYSYRGMGLS  151



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   250 bits (638),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P    G SS++ DE+  VPSF +P+  +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPTIGFGSSSDMLDELSSVPSFDLPHTKEFDGFQKEASNMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGE-SSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            +++D SGLES   + G  S+EL D +   PSF IPN  +FDGFQK+AIQMVKPAKGTTTL
Sbjct  17   MKLDTSGLESATFLSGAGSTELLDGLSSAPSFGIPNARNFDGFQKEAIQMVKPAKGTTTL  76

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF FKEGVMVAADSRASMGGYISSQS KKIIEIN YMLGTMAGGAADCQFWHRNLG+KCR
Sbjct  77   AFTFKEGVMVAADSRASMGGYISSQSAKKIIEINSYMLGTMAGGAADCQFWHRNLGIKCR  136

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
             HEL NKRRISV GASKLLANILYSYRGMGLS
Sbjct  137  RHELENKRRISVTGASKLLANILYSYRGMGLS  168



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 133/156 (85%), Gaps = 4/156 (3%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIP----RVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            M ++DFS L++TAP+ G+SS      P      PSF++P   DFDGFQK+A  MVK  KG
Sbjct  1    MRQLDFSSLQTTAPLLGDSSGFSGGFPGDFSAAPSFEVPVTDDFDGFQKEARDMVKSKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            +KCRLHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  121  IKCRLHELANKRRISVTGASKLLANILYSYRGMGLS  156



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK+A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKEAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLS  527
            LANKRRISV GASKLLANILYSYRGMGLS
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGLS  150



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDVLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  RLHELANKRRISVSGASKLLANMLYSYRGMGLS  153



>ref|XP_002514943.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
 gb|EEF47497.1| proteasome subunit beta type 5,8, putative [Ricinus communis]
Length=249

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRG--ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG ESTAP+ G   SSE+ +      SF++P  +DFDGFQ +A Q +K AKGTTT
Sbjct  1    MKLDTSGFESTAPLFGASSSSEMVNGFSAPASFELPVTSDFDGFQSEAKQTLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  61   LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  120

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV GASKLLANILY+YRGMGLS
Sbjct  121  RLHELANKRRISVTGASKLLANILYNYRGMGLS  153



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISS SVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSHSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLS  527
            LANKRRISV GASKLLANILYSYRGMGLS
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGLS  150



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLS  527
            LANKRRISV GASKLLANILYSYRGMG S
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGSS  150



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +D + LES   +      +  EI   PSFQ+PN  DFDGF K+ IQMVKPAKGTTTLAFI
Sbjct  2    LDTTALESFPSLISHGINVAGEISAPPSFQLPNSNDFDGFVKETIQMVKPAKGTTTLAFI  61

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHE
Sbjct  62   FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHE  121

Query  441  LANKRRISVAGASKLLANILYSYRGMGLS  527
            LANKRRISV GASKLLANILYSYRGMG S
Sbjct  122  LANKRRISVTGASKLLANILYSYRGMGSS  150



>ref|XP_010440898.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=160

 Score =   239 bits (610),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 125/136 (92%), Gaps = 1/136 (1%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  299
            G ++E+FD +  VPSF +P  TDFDGFQK +++MVKPAKGTTTLAFIFKEGVMVAADSRA
Sbjct  7    GSNNEMFDGVSSVPSFDLPRTTDFDGFQKKSVEMVKPAKGTTTLAFIFKEGVMVAADSRA  66

Query  300  SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGAS  479
            SMGGYISS S+K IIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GAS
Sbjct  67   SMGGYISSPSMK-IIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGAS  125

Query  480  KLLANILYSYRGMGLS  527
            KLLAN+LYSYRGM LS
Sbjct  126  KLLANMLYSYRGMRLS  141



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 134/177 (76%), Gaps = 26/177 (15%)
 Frame = +3

Query  75   VRIDFSGLESTAPI--RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            +++D SG E++ P+   G SS++ DE+  VPSF +P   +FDGFQK A  M+K AKGTTT
Sbjct  1    MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTT  60

Query  249  LAFIFKEGVMVAADSRASMGGYIS------------------------SQSVKKIIEINP  356
            LAFIFK GVMVAADSRASMGGYIS                        SQSVKKIIEINP
Sbjct  61   LAFIFKGGVMVAADSRASMGGYISVSSLKNSSKNMHPFDIVDFGRNTTSQSVKKIIEINP  120

Query  357  YMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            YMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV+GASKLLAN+LYSYRGMGLS
Sbjct  121  YMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLS  177



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES A   GE  +L  E    PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFASFHGEMDDLHGEFWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINPYM+ T+AGGAADC FWHRNLG+KCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPYMIATVAGGAADCIFWHRNLGMKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            +EL NKRRISVAGASKLL N+LYSYRGMGLS
Sbjct  121  YELENKRRISVAGASKLLTNMLYSYRGMGLS  151



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   232 bits (591),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D +GLES AP+ G   +L  E+   PSF +P   DFDGFQK+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTTGLESFAPLHGGMDDLHGELWAPPSFDLPVCADFDGFQKNAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F+FKEG++VAA+SR SMGGY++SQ+VKKI+EINP+M+ T+AGGAADC FWHRNLGVKCRL
Sbjct  61   FVFKEGIIVAAESRTSMGGYVASQNVKKIVEINPHMIATVAGGAADCIFWHRNLGVKCRL  120

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            +EL NKRRISVAGASKLL N+LYSYRGM LS
Sbjct  121  YELENKRRISVAGASKLLTNMLYSYRGMELS  151



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 131/155 (85%), Gaps = 4/155 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIR--GESSE--LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D S +E+   +R  GE  +  +F     +P+ ++P   DFDGFQK+A +++K  KGT
Sbjct  1    MKLDVSAMENNFAVRCGGEDDDGGIFGAGADLPAMELPTCADFDGFQKEAKELMKNKKGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG+
Sbjct  61   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGI  120

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            KCRLHELANKRRISVAGASKLLANILYSYRGMGLS
Sbjct  121  KCRLHELANKRRISVAGASKLLANILYSYRGMGLS  155



>gb|AFW85805.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=203

 Score =   224 bits (572),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 126/156 (81%), Gaps = 3/156 (2%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLS  157



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 123/156 (79%), Gaps = 5/156 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE-----LFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            +R+DF+GL+     R  S +      +D I   PSF +P + D DGF+K A+ MVKP  G
Sbjct  1    MRLDFAGLDPVTLRRPSSGDGGFDVAYDSIGSAPSFNLPAVADLDGFEKAAVDMVKPLHG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAF+FKEGV+VAADSRASMG YISSQ VKKI+EINPY+LGTMAGGAADCQFW RNLG
Sbjct  61   TTTLAFVFKEGVIVAADSRASMGNYISSQDVKKILEINPYLLGTMAGGAADCQFWQRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
             +CRLHEL NKRRISV GASKLLAN LYSYRGMGLS
Sbjct  121  TRCRLHELGNKRRISVTGASKLLANTLYSYRGMGLS  156



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PSF++P + D DGFQK A+QMVKPAKGTTTLAF+FK GV+VAADSRASMG YISSQSVKK
Sbjct  27   PSFELPAVADLDGFQKAAVQMVKPAKGTTTLAFVFKHGVIVAADSRASMGNYISSQSVKK  86

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            I+EINPY+LGTMAGGAADCQFW RNLG +CRLHELANKRRISV GASKLLAN LYSYRGM
Sbjct  87   ILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHELANKRRISVTGASKLLANTLYSYRGM  146

Query  519  GLS  527
            GLS
Sbjct  147  GLS  149



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   224 bits (572),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 126/156 (81%), Gaps = 3/156 (2%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLS  157



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   224 bits (572),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 126/156 (81%), Gaps = 3/156 (2%)
 Frame = +3

Query  60   LVVTMVRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            L ++ +  +F+ L ++A   G+ +    E P VPS  +P   DFDGFQ     MVK  KG
Sbjct  5    LDMSALETNFANLTASA---GDDTYFSAEAPDVPSMVLPICDDFDGFQAATKDMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  122  TKCRLHELSNKRRISIAGASKLLANILYSYRGMGLS  157



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 123/155 (79%), Gaps = 4/155 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPI----RGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D S LE+   +     G+      E P VPS  +P   DFDGFQ     MVK  KGT
Sbjct  3    MKLDMSALETNFAVPCGDDGDGMYFSAEAPDVPSMVLPTCADFDGFQAATKDMVKNKKGT  62

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG 
Sbjct  63   TTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGN  122

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  123  KCRLHELSNKRRISIAGASKLLANILYSYRGMGLS  157



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   222 bits (566),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 124/156 (79%), Gaps = 6/156 (4%)
 Frame = +3

Query  75   VRIDFSGLES-----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKG  239
            +++D S LE+     T P   + +      P VPS  +P   DFDGFQ D   MVK  KG
Sbjct  3    MKVDMSALETNFANMTFPAS-DDTYFSAGAPDVPSMVLPTCDDFDGFQADTKAMVKNKKG  61

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  62   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  121

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
             KCRLHEL+NKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  122  NKCRLHELSNKRRISIAGASKLLANILYSYRGMGLS  157



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   222 bits (566),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 128/156 (82%), Gaps = 5/156 (3%)
 Frame = +3

Query  75   VRIDFSGLEST----APIRGESSELFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+     A  R +   LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGREDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLS  156



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 127/156 (81%), Gaps = 5/156 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+    +    E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAQAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLS  156



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 126/156 (81%), Gaps = 5/156 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLS  156



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 126/156 (81%), Gaps = 5/156 (3%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSE----LFDEIPRVPSFQIPNI-TDFDGFQKDAIQMVKPAKG  239
            +++D S +E+         E    LF     +P+ ++P    DFDGFQK+  +M+K  KG
Sbjct  1    MKLDVSAMENNFAAHAAGGEDDGGLFGAGADLPAMELPTCPADFDGFQKETKEMLKHKKG  60

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG
Sbjct  61   TTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLG  120

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            +KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  121  IKCRLHELANKRRISIAGASKLLANILYSYRGMGLS  156



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  3    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  62

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  63   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  122

Query  441  LANKRRISVAGASKLLANILYSYRGMGLS  527
            LANKRRISVAGASKLLAN LYSYRGMGLS
Sbjct  123  LANKRRISVAGASKLLANTLYSYRGMGLS  151



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  81   IDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFI  260
            +DFSGLE  +  +   S+         SF +P + D DGFQK A+ ++KPA GTTTLAF 
Sbjct  5    LDFSGLEPASLRQHSYSDPAAHWEPQCSFPLPKVADLDGFQKAAVDLLKPAHGTTTLAFE  64

Query  261  FKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHE  440
            F+ G++VAADSRASMG YISSQSVKKI+EINPY+LGTMAGGAADCQFW RNLG +CRLHE
Sbjct  65   FQGGIIVAADSRASMGQYISSQSVKKILEINPYLLGTMAGGAADCQFWQRNLGTRCRLHE  124

Query  441  LANKRRISVAGASKLLANILYSYRGMGLS  527
            LANKRRISVAGASKLLAN LYSYRGMGLS
Sbjct  125  LANKRRISVAGASKLLANTLYSYRGMGLS  153



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   215 bits (547),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 120/154 (78%), Gaps = 3/154 (2%)
 Frame = +3

Query  75   VRIDFSGLES---TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTT  245
            +R+D S LE+    AP       +F       + + P   DFDGFQK    MV   KGTT
Sbjct  1    MRLDVSALENHHFAAPGNEFGGGVFAADTEELAMEFPTCNDFDGFQKATKDMVNNKKGTT  60

Query  246  TLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            TL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQFWHRNLG K
Sbjct  61   TLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQFWHRNLGTK  120

Query  426  CRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            CRLHELANKRRIS+AG+SK+LANILYSYRGMGLS
Sbjct  121  CRLHELANKRRISIAGSSKMLANILYSYRGMGLS  154



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCNDFDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMG
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMG  154

Query  522  LS  527
            LS
Sbjct  155  LS  156



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            + + P   DFDGFQK    MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KI
Sbjct  35   ALEFPTCDDFDGFQKATKAMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKI  94

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMG
Sbjct  95   IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMG  154

Query  522  LS  527
            LS
Sbjct  155  LS  156



>gb|AAT80906.1| 26S proteasome beta subunit [Lemna minor]
Length=116

 Score =   206 bits (524),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            VKPAKGTTTLAFIFKEGV+V+ADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF
Sbjct  1    VKPAKGTTTLAFIFKEGVIVSADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  60

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            WHRNLG+KCRLHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  61   WHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLS  102



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  189  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGFQK A+Q+VKPAKGTTTLAF+FK GV+VAADS ASMG  ISSQSVKKI+EINPY+LG
Sbjct  1    LDGFQKAAVQLVKPAKGTTTLAFVFKHGVIVAADSSASMGNSISSQSVKKILEINPYLLG  60

Query  369  TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGL  524
            TMAGGAADCQFW RNLG +CRLHELANKR ISV GASKLLAN LYSYRGMGL
Sbjct  61   TMAGGAADCQFWQRNLGTRCRLHELANKRHISVTGASKLLANTLYSYRGMGL  112



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   197 bits (501),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
            M+K  KGTTTLAFIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MLKHKKGTTTLAFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  399  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            FWHRNLG+KCRLHELANKRRIS+AGASKLLANILYSYRGMGLS
Sbjct  61   FWHRNLGIKCRLHELANKRRISIAGASKLLANILYSYRGMGLS  103



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
            MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLGTMAGGAADCQ
Sbjct  1    MVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLGTMAGGAADCQ  60

Query  399  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            FWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS
Sbjct  61   FWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLS  103



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 119/155 (77%), Gaps = 4/155 (3%)
 Frame = +3

Query  75   VRIDFSGLES-TAPIRGESSELFDEIP---RVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++DFS L++ T  I  E +E   EI       +F++P + ++D FQ++ +  VKP  GT
Sbjct  1    MKLDFSVLDAPTRKIDAEIAECAAEINSDVHAQNFKLPMVENYDSFQREVVDYVKPNHGT  60

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  61   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  120

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            +CRLHEL N +RISV+GASKLL+N LY YRG GLS
Sbjct  121  QCRLHELENGKRISVSGASKLLSNTLYGYRGQGLS  155



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +3

Query  189   FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             FDGFQK   +MV   KGTTTL+FIF +GV+VAADSRASMGGYISSQ+V+KIIEINPYMLG
Sbjct  1285  FDGFQKATKEMVNNKKGTTTLSFIFDKGVIVAADSRASMGGYISSQTVRKIIEINPYMLG  1344

Query  369   TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
             TMAGGAADCQFWHRNLGVKCRLHELANKRRIS+AG+SK LANILYSYRGMGLS
Sbjct  1345  TMAGGAADCQFWHRNLGVKCRLHELANKRRISIAGSSKTLANILYSYRGMGLS  1397



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 116/163 (71%), Gaps = 11/163 (7%)
 Frame = +3

Query  66   VTMVRIDFSGLESTAPIRGESSELFDEIP---------RVPSFQIPNITDFDGFQKDAIQ  218
            +T + +DFS L+   P+R E+ EL   +              F IP + DF  FQKD ++
Sbjct  1    MTSLNLDFSVLDR--PVRKEADELTSTLENDVLCGINTHDQYFTIPRVEDFSRFQKDVVE  58

Query  219  MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQ  398
             VKP  GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQ
Sbjct  59   HVKPQHGTTTLGFIFEHGIIIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQ  118

Query  399  FWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            FW RNLG++CRLHEL   +RI+V GASKLLAN LY YRG GLS
Sbjct  119  FWQRNLGIQCRLHELETGKRITVTGASKLLANTLYGYRGRGLS  161



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 118/157 (75%), Gaps = 10/157 (6%)
 Frame = +3

Query  81   IDFSGLESTAPIRG--------ESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            +DFS L++TA  RG        ES +  D      +F+ P + DF+GFQ++ I  VKP  
Sbjct  6    LDFSFLDATA--RGSMASKHVDESLDAIDGNMHECNFKAPAVEDFEGFQREVINYVKPNH  63

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAFIF+ G++VA DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  64   GTTTLAFIFEHGIVVAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  123

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            G++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS
Sbjct  124  GIQCRLHELENGKRITVRAASKLLANTLYSYKGKGLS  160



>gb|ABD61730.2| 26S proteasome beta subunit [Lupinus albus]
Length=127

 Score =   187 bits (474),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +3

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            +TLAFIFK+GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+
Sbjct  1    STLAFIFKDGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGI  60

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            KCRLHELANKRRISV GASKLLANILYSYR MG S
Sbjct  61   KCRLHELANKRRISVTGASKLLANILYSYRRMGYS  95



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 4/155 (3%)
 Frame = +3

Query  75   VRIDFSGLES----TAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGT  242
            +++D+S L++    T  I  + +          +F++P + ++D FQ++ +  VKP  GT
Sbjct  4    LKLDYSVLDAPQRATDRIEADCAREIHGDVHAQNFKLPMVENYDEFQREVVDYVKPNHGT  63

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG+
Sbjct  64   TTLGFIFEHGVVIAVDSRASQGPYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLGI  123

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            +CRLHEL N +RISVAGASKLLAN LY YRG GLS
Sbjct  124  QCRLHELENGKRISVAGASKLLANTLYGYRGQGLS  158



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 111/157 (71%), Gaps = 6/157 (4%)
 Frame = +3

Query  75   VRIDFSGLEST------APIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            V +D S L  T         R E+ +         +F  P + DFD FQ++ I  VKPA 
Sbjct  3    VNLDLSFLHDTERGAASTKYRDEALQGVSNSVHASNFTAPAVEDFDAFQREVINYVKPAH  62

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTL FIF+ G+++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  63   GTTTLGFIFEHGIVIAVDSRASQGPYISSQTVKKVIEINPFLLGTMAGGAADCQFWQRNL  122

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            G++CRLHEL N +RI+V  ASKLLAN LYSY+G GLS
Sbjct  123  GIQCRLHELENGKRITVRAASKLLANTLYSYKGRGLS  159



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = +3

Query  72   MVRIDFSGLESTAPIRGESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKG  239
            M ++DFS L S  P+  +S    +++  + S    F +P + D D F+ + +  VKP  G
Sbjct  1    MDKLDFSALCSR-PLSEKSGACVEDVASITSAVQDFPLPQVQDVDRFENEVMSYVKPNHG  59

Query  240  TTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG  419
            TTTL FIFK GV++A DSRASMG YISSQ+VKK+IEINPY+LGTMAGGAADCQFW RNLG
Sbjct  60   TTTLGFIFKYGVIIAVDSRASMGSYISSQTVKKVIEINPYLLGTMAGGAADCQFWQRNLG  119

Query  420  VKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
             +CRL+EL N +RISV  ASKLLAN+++SY+G GLS
Sbjct  120  QQCRLYELNNGKRISVRAASKLLANVMFSYKGYGLS  155



>gb|ABQ50544.1| hypothetical protein [Brassica rapa]
Length=218

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRA  299
            G S+++ D    VPSF +P  TDFDGFQK+A+QMVKPAKGTTTLAFIFKEGVMVAADSRA
Sbjct  7    GSSNDMLDGFSTVPSFDLPRTTDFDGFQKEAVQMVKPAKGTTTLAFIFKEGVMVAADSRA  66

Query  300  SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVK  425
            SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+K
Sbjct  67   SMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIK  108



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score =   186 bits (473),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = +3

Query  72   MVRIDFSGLESTA-----PIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK  236
            M+++D S LE  A     P   E++ +      V SF +P + D D F+++ ++ VKP  
Sbjct  1    MMKLDLSCLEPAAGAGREPCGLEAAGVSGVA--VDSFPLPAVADIDSFEREVVEYVKPNH  58

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTL FIF+ GV++A DSRAS G YISSQ+VKK+IEINP++LGTMAGGAADCQFW RNL
Sbjct  59   GTTTLGFIFQGGVIIAVDSRASQGSYISSQTVKKVIEINPHLLGTMAGGAADCQFWERNL  118

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            G +CRL+ELAN +RI+V GASKLLAN ++SYRGMGLS
Sbjct  119  GRQCRLYELANGKRITVRGASKLLANTMFSYRGMGLS  155



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKI  341
            SF +P + D D F+++ ++MVKP  GTTTL FIF+ GV++A DSRA+MG YISSQ+VKK+
Sbjct  34   SFPLPAVQDVDKFEREVVEMVKPCHGTTTLGFIFQHGVIIAVDSRATMGAYISSQTVKKV  93

Query  342  IEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMG  521
            IEIN ++LGTMAGGAADCQFW RNLG++CRL+EL N +RI+V  ASKLL+N+++SYRGMG
Sbjct  94   IEINKFLLGTMAGGAADCQFWQRNLGMQCRLYELNNGKRITVRAASKLLSNVMFSYRGMG  153

Query  522  LS  527
            LS
Sbjct  154  LS  155



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 116/152 (76%), Gaps = 3/152 (2%)
 Frame = +3

Query  78   RIDFSGLESTAPIRGES--SELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTL  251
            ++D   LE  A  +G     +L  ++P   SF +P + D D F+++ ++MVKP  GTTTL
Sbjct  4    KLDLGILEPNAGRKGPGLGPDLQLDVP-TASFPLPAVQDLDKFEREVVEMVKPCHGTTTL  62

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
             FIF+ GV++A DSRA+MG +ISSQ+VKK+IEIN +++GTMAGGAADCQFW RNLG++CR
Sbjct  63   GFIFQHGVIIAVDSRATMGSFISSQTVKKVIEINKHLIGTMAGGAADCQFWQRNLGMRCR  122

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            L+EL N +RI+V  ASKLLAN ++SYRGMGLS
Sbjct  123  LYELNNGKRITVCAASKLLANTMFSYRGMGLS  154



>ref|XP_011396916.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
 gb|KFM24035.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
Length=277

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 3/127 (2%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVK  335
            + +F +P + D D F+K+ ++ VKP+ GTTTL FIF+ GV+VA DSRAS G YISSQ+VK
Sbjct  31   IDAFPLPAVADLDSFEKEVVEYVKPSHGTTTLGFIFQGGVIVAVDSRASQGSYISSQTVK  90

Query  336  KIIEINPYMLGTMAGGAADCQFWHRNLG---VKCRLHELANKRRISVAGASKLLANILYS  506
            K+IEINP++LGTMAGGAADCQFW RNLG   V CRL+EL N +RI+V GASKLLAN ++S
Sbjct  91   KVIEINPFLLGTMAGGAADCQFWERNLGRQVVWCRLYELNNGKRITVRGASKLLANTMFS  150

Query  507  YRGMGLS  527
            YRGMGLS
Sbjct  151  YRGMGLS  157



>ref|XP_002889983.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66242.1| hypothetical protein ARALYDRAFT_888660 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score =   171 bits (433),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +3

Query  276  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR  455
            MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLH LANKR
Sbjct  1    MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHALANKR  60

Query  456  RISVAGASKLLANILYSYRGMGLS  527
            RISV+GASKLLAN+LYSYRGMGLS
Sbjct  61   RISVSGASKLLANMLYSYRGMGLS  84



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +3

Query  189  FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLG  368
             DGF++  ++ VKP+ GTTTL FIF+ GV++A DSRAS G Y+SSQ+VKK+IEINPY+LG
Sbjct  9    LDGFERSVVEYVKPSHGTTTLGFIFQGGVIIAVDSRASQGSYLSSQTVKKVIEINPYLLG  68

Query  369  TMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            TMAGGAADCQFW RNLG +CRL+EL   RRI+V  ASKLLAN ++SYRGMGLS
Sbjct  69   TMAGGAADCQFWERNLGRQCRLYELKEGRRITVKAASKLLANTMFSYRGMGLS  121



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 99/151 (66%), Gaps = 34/151 (23%)
 Frame = +3

Query  75   VRIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLA  254
            +++D SGLES   +    +++  E    PSF++PN  DFDGF K+AIQMVKPAKGTTTLA
Sbjct  1    MKLDTSGLESFPSLISHGNDVVGEFEAPPSFELPNSNDFDGFLKEAIQMVKPAKGTTTLA  60

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            FIFKEGVMVAAD                                  CQFWHRNLG+KCRL
Sbjct  61   FIFKEGVMVAAD----------------------------------CQFWHRNLGIKCRL  86

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  87   HELANKRRISVTGASKLLANILYSYRGMGLS  117



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 98/129 (76%), Gaps = 6/129 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPA------KGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            PSF +P I +   F ++      P        GTTTLAF F+ GV+VA DSRA+MG YIS
Sbjct  37   PSFDVPAIHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIS  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSYRGMGLS  527
            YSY+GMGLS
Sbjct  157  YSYKGMGLS  165



>gb|EPB87271.1| proteasome component PRE2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=277

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 14/133 (11%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSYRGMGLS  527
            AN++Y+Y+GMGLS
Sbjct  153  ANMVYAYKGMGLS  165



>dbj|GAN10935.1| 20S proteasome subunit [Mucor ambiguus]
Length=277

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 14/133 (11%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            PSF IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PSFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQGGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSYRGMGLS  527
            AN++Y+Y+GMGLS
Sbjct  153  ANMVYAYKGMGLS  165



>emb|CEP17612.1| hypothetical protein [Parasitella parasitica]
Length=277

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 99/133 (74%), Gaps = 14/133 (11%)
 Frame = +3

Query  159  PSFQIP----------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMG  308
            P+F IP          N+TD    +K A   +K   GTTTLAF F+ GV+VA DSRA+MG
Sbjct  37   PAFDIPAIHNPVDFLRNVTD----EKSADYKIKIQHGTTTLAFQFQHGVIVAVDSRATMG  92

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
             YI SQ+VKK+IEINPY+LGTMAGGAADC +W R LG +CRLHEL NK RISVA ASKLL
Sbjct  93   NYIGSQTVKKVIEINPYLLGTMAGGAADCSYWERELGRRCRLHELRNKERISVAAASKLL  152

Query  489  ANILYSYRGMGLS  527
            AN++Y+Y+GMGLS
Sbjct  153  ANMVYAYKGMGLS  165



>emb|CEG76258.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=246

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 99/129 (77%), Gaps = 6/129 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F +P + +   F ++          +K   GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSYRGMGLS  527
            YSY+GMGLS
Sbjct  157  YSYKGMGLS  165



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 98/129 (76%), Gaps = 6/129 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPA------KGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F +P + +   F ++      P        GTTTLAF F+ GV+VA DSRA+MG YI+
Sbjct  37   PTFDVPAVHNPVDFLRNVTDEESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIA  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++
Sbjct  97   SQTVKKVIEINPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMV  156

Query  501  YSYRGMGLS  527
            YSY+GMGLS
Sbjct  157  YSYKGMGLS  165



>emb|CEJ04297.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=206

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 4/119 (3%)
 Frame = +3

Query  171  IPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEI  350
            + N+TD    ++     +K   GTTTLAF F+ GV+VA DSRA+MG YI+SQ+VKK+IEI
Sbjct  11   LRNVTD----EESPEYKIKIQHGTTTLAFQFQGGVVVAVDSRATMGNYIASQTVKKVIEI  66

Query  351  NPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            NPY+LGT+AGGAADCQ+W R LG +CRLHEL NK RISVA ASKLLAN++YSY+GMGLS
Sbjct  67   NPYLLGTLAGGAADCQYWERELGRRCRLHELRNKERISVAAASKLLANMVYSYKGMGLS  125



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +3

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            +SRASMGGYISSQSV+KIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV
Sbjct  1    NSRASMGGYISSQSVEKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISV  60

Query  468  AGASKLLANILYSYRGMGLS  527
             GASKLLANILYSYRGMGLS
Sbjct  61   TGASKLLANILYSYRGMGLS  80



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 120/178 (67%), Gaps = 11/178 (6%)
 Frame = +3

Query  21   P*VESTPSFYSRYLVVTMVRIDFSGLESTAPIRGESSELFDEIPRVP-------SFQIPN  179
            P  ++T SF     + +++  DF+ L S  P   ++  L D    +         F +P 
Sbjct  5    PSTKTTKSFKQGANLSSVLSSDFTSL-SIGPQDEDNVILQDPCLDISYGLDGQQGFALPP  63

Query  180  ITDFDGF--QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEIN  353
              +  GF  QK+ ++    AKGTTTL F+F +G+++A DSRASMG YISSQ+VKK+IEIN
Sbjct  64   SLNNSGFIHQKEKLEKTY-AKGTTTLGFVFNKGIVIAVDSRASMGNYISSQNVKKVIEIN  122

Query  354  PYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            PY+LGTMAGGAADCQFW R LG++CRL+EL NKRRISVA ASKLL+NI+Y Y+  GLS
Sbjct  123  PYLLGTMAGGAADCQFWERYLGMQCRLYELRNKRRISVAAASKLLSNIVYQYKDHGLS  180



>emb|CBY21147.1| unnamed protein product [Oikopleura dioica]
 emb|CBY40350.1| unnamed protein product [Oikopleura dioica]
Length=287

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P F  P +     F  D    +K   GTT LAF FK GVMVA DSRA+ GGYI+SQ VKK
Sbjct  52   PPFSNPQLHLDQNFGDDKPVKIKFNHGTTCLAFKFKHGVMVATDSRATAGGYIASQEVKK  111

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADCQFW R L ++CRL+EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  112  VIEINPYLLGTMAGGAADCQFWERVLAMECRLYELRNKERISVAAASKLLANMVYQYKGM  171

Query  519  GLS  527
            GLS
Sbjct  172  GLS  174



>emb|CDH56820.1| 20s proteasome subunit [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS14360.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=277

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 97/129 (75%), Gaps = 6/129 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQ------MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            P+F IP++ +   F +           +K   GTTTLAF F+ GV+VA DSRA+MG YI 
Sbjct  37   PTFDIPDVHNPVDFLRSVTDEDSPDYKIKIQHGTTTLAFQFQGGVIVAVDSRATMGNYIG  96

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASKLL N++
Sbjct  97   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKLLGNMV  156

Query  501  YSYRGMGLS  527
            YSY+GMGLS
Sbjct  157  YSYKGMGLS  165



>ref|XP_006957104.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
 gb|EIM23071.1| 20S proteasome subunit, partial [Wallemia sebi CBS 633.66]
Length=288

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +P+  +PN  D  GF       Q+D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  29   IPTLDLPNTADPTGFLRTYTDDQQDPSCRIKINHGTTTLAFKFKGGVIVAVDSRATAGSY  88

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK L+N
Sbjct  89   VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKYLSN  148

Query  495  ILYSYRGMGLS  527
            I YSY+G GLS
Sbjct  149  ITYSYKGKGLS  159



>ref|XP_009038619.1| hypothetical protein AURANDRAFT_28593 [Aureococcus anophagefferens]
 gb|EGB06876.1| hypothetical protein AURANDRAFT_28593 [Aureococcus anophagefferens]
Length=287

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +3

Query  195  GFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q VK AKGTTTLAF F  GV+++ DSR++MG YI+SQ+VKK+IEINP++LGTM
Sbjct  53   GYGTDHHQDVKFAKGTTTLAFKFNGGVIISVDSRSTMGPYIASQTVKKVIEINPFLLGTM  112

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            AGGAADC FW RNLG +CR+ EL NKRR+SVA ASK+LAN +YSYRG GLS
Sbjct  113  AGGAADCSFWERNLGTQCRMFELRNKRRVSVAAASKMLANTMYSYRGRGLS  163



>ref|XP_002290272.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92024.1| proteasome subunit beta type 5 precursor [Thalassiosira pseudonana 
CCMP1335]
Length=276

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 96/121 (79%), Gaps = 8/121 (7%)
 Frame = +3

Query  165  FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKII  344
            F++PN+ D  G        VK AKGTTTLAF F  G++V+ DSR++MG YI+S +VKK+I
Sbjct  50   FEVPNVADVSG--------VKFAKGTTTLAFKFNGGIIVSVDSRSTMGAYIASGTVKKVI  101

Query  345  EINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGL  524
            EINP++LGTMAGGAADC FW RNLG++CRL+EL NK+RI+VA ASKLLAN + SYRG GL
Sbjct  102  EINPFLLGTMAGGAADCSFWERNLGMQCRLYELRNKKRITVASASKLLANTMSSYRGYGL  161

Query  525  S  527
            S
Sbjct  162  S  162



>ref|XP_005537552.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81516.1| 20S core proteasome subunit beta 5 [Cyanidioschyzon merolae strain 
10D]
Length=299

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
             +PR  S   P + D    ++++  +VK   GTTTLAF+F++G++VA DSRASMG YI S
Sbjct  41   RVPRGASIA-PRLRDVLRDEQNS-SLVKFLHGTTTLAFVFRDGIIVAVDSRASMGQYIGS  98

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILY  503
             +VKKIIEINPY+LGTMAGGAADC FW R LG++CRLHEL ++ RISVA ASKLLANI+Y
Sbjct  99   GTVKKIIEINPYLLGTMAGGAADCSFWERYLGMRCRLHELQHRERISVAAASKLLANIVY  158

Query  504  SYRGMGLS  527
             Y+GMGLS
Sbjct  159  EYKGMGLS  166



>emb|CAC43326.1| putative beta5 proteasome subunit [Nicotiana tabacum]
Length=174

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRR SVAGA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRTSVAGA  60

Query  477  SKLLANILYSYRGMGLS  527
            SKLLANILYSYRGMGLS
Sbjct  61   SKLLANILYSYRGMGLS  77



>ref|XP_009265754.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
 gb|EOR04743.1| Proteasome component PRE2 [Wallemia ichthyophaga EXF-994]
Length=287

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 102/148 (69%), Gaps = 11/148 (7%)
 Frame = +3

Query  117  RGESSELFDEIPR----VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIF  263
            RG  + L D+       +P+ Q+PN  D  GF       Q D    +K   GTTTLAF +
Sbjct  12   RGIDAALHDDFEGGSGGMPTLQLPNTADPTGFLREYTDEQNDPSCRIKINHGTTTLAFKY  71

Query  264  KEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHEL  443
            K GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL
Sbjct  72   KGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHEL  131

Query  444  ANKRRISVAGASKLLANILYSYRGMGLS  527
             N+ RISVA ASK L+NI YSY+G GLS
Sbjct  132  RNRERISVAAASKYLSNITYSYKGKGLS  159



>gb|KFH71396.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=278

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 5/129 (4%)
 Frame = +3

Query  156  VPSFQIP---NITDFDGFQKDAI--QMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            +P+F IP   N TDF     DA     ++   GTTTLAF F+ G++VA DSRAS G YI+
Sbjct  38   LPAFDIPMVANPTDFLRAHTDASAENRIRIQHGTTTLAFKFQGGIIVAVDSRASGGSYIA  97

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            SQ+VKK+IEINPY+LGTMAGGAADCQ+W R LG +CRL+EL NK RISVA ASK+L+N++
Sbjct  98   SQTVKKVIEINPYLLGTMAGGAADCQYWERELGRRCRLYELRNKERISVAAASKILSNMV  157

Query  501  YSYRGMGLS  527
            Y Y+GMGLS
Sbjct  158  YDYKGMGLS  166



>gb|EJU05281.1| proteasome-domain-containing protein [Dacryopinax sp. DJM-731 
SS1]
Length=315

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 99/131 (76%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF++P++ D   F +       D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  49   IPSFKVPSLADPSAFLRMHTDDYADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIECRLHELRNRERISVAAASKFLSN  168

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  169  LVYSYKGMGLS  179



>ref|XP_001730616.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
 gb|EDP43402.1| hypothetical protein MGL_2412 [Malassezia globosa CBS 7966]
Length=295

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 2/123 (2%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            PS  +   TD D  + DA   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PSRFLAQYTDVDSTRPDA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+GM
Sbjct  95   VIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGM  154

Query  519  GLS  527
            GLS
Sbjct  155  GLS  157



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 81/93 (87%), Gaps = 8/93 (9%)
 Frame = +3

Query  273  VMVAADSR--------ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            VM AA  R        ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KC
Sbjct  10   VMAAAGFRLADTFHTGASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKC  69

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            RLHELANKRRISV GASKLLANILYSYRGMGLS
Sbjct  70   RLHELANKRRISVTGASKLLANILYSYRGMGLS  102



>ref|XP_008036606.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
 gb|EIW60150.1| proteasome component pts1 [Trametes versicolor FP-101664 SS1]
Length=310

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 97/131 (74%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF+IP + D   F         D    +K   GTTTLAF +K GV+VA DSRA+ G Y
Sbjct  48   VPSFKIPAVADPSSFLRMHTDDHADPSCRIKIKHGTTTLAFRYKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  168  LVYSYKGMGLS  178



>emb|CCM00020.1| predicted protein [Fibroporia radiculosa]
Length=302

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 105/155 (68%), Gaps = 7/155 (5%)
 Frame = +3

Query  84   DFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGT  242
            + SG E  + +   S    +    +P+F IP++ D   F         D    +K   GT
Sbjct  22   EISGDEDVSDVMWGSEGFGNLAKEIPTFAIPSVPDPAAFLRLHTDDHADPSCRIKIKHGT  81

Query  243  TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGV  422
            TTLAF +K GV+VA DSRA+ G Y++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+
Sbjct  82   TTLAFRYKGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQYWETFLGI  141

Query  423  KCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            +CRLHEL N+ RISVA ASK L+N++YSY+GMGLS
Sbjct  142  ECRLHELRNRERISVAAASKFLSNLVYSYKGMGLS  176



>gb|KIY65291.1| proteasome-domain-containing protein [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=308

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F         D    +K A GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  47   VPTFTVPNLPDPSAFLRLHTDDHADPNCKIKIAHGTTTLAFRFKGGVIVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  107  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKFLSN  166

Query  495  ILYSYRGMGLS  527
            ++Y Y+GMGLS
Sbjct  167  LVYGYKGMGLS  177



>emb|CCU99044.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=268

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P   +   TD D   ++A   +K   GTTTLAF +K GV+VA DSRAS G YI+S SVKK
Sbjct  37   PGRFLAQFTDVDSTNQNA--RIKLNHGTTTLAFRYKGGVVVAVDSRASAGSYIASGSVKK  94

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+N++YSY+GM
Sbjct  95   VIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKILSNLVYSYKGM  154

Query  519  GLS  527
            GLS
Sbjct  155  GLS  157



>ref|XP_007863011.1| 20S proteasome subunit [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58001.1| 20S proteasome subunit [Gloeophyllum trabeum ATCC 11539]
Length=312

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P + D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPSFSVPAVHDPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  168  LVYSYKGMGLS  178



>ref|XP_007006996.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
 gb|EIW67092.1| hypothetical protein TREMEDRAFT_34309 [Tremella mesenterica DSM 
1558]
Length=287

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 98/138 (71%), Gaps = 8/138 (6%)
 Frame = +3

Query  138  FDEIPRVPSFQIPNITD--------FDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADS  293
             DE+ R+   QIP + D         D    +    +K A GTTTLAF FK G++VA DS
Sbjct  28   LDEMGRIKGMQIPRVPDPTAFLNLYTDSMSSNPEAKIKLAHGTTTLAFRFKGGIIVAVDS  87

Query  294  RASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAG  473
            RA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRL+EL NK RISVA 
Sbjct  88   RATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMRCRLYELRNKERISVAA  147

Query  474  ASKLLANILYSYRGMGLS  527
            ASK+L+NI+Y Y+G GLS
Sbjct  148  ASKILSNIVYGYKGRGLS  165



>ref|XP_002111558.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
 gb|EDV25525.1| hypothetical protein TRIADDRAFT_55706 [Trichoplax adhaerens]
Length=276

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 6/137 (4%)
 Frame = +3

Query  132  ELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAK-----GTTTLAFIFKEGVMVAADSR  296
            EL   + +  SFQ+P + D   F K   +     K     GTTTLAF FK GV+VAADSR
Sbjct  34   ELRTHLSKELSFQVPPM-DPQVFLKSINERENGVKIQFLHGTTTLAFKFKNGVIVAADSR  92

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMG YI SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  93   ASMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSFWERVLAERCRVYELRNKERISVAAA  152

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN++Y Y+GMGLS
Sbjct  153  SKLLANMVYYYKGMGLS  169



>gb|KDQ60928.1| hypothetical protein JAAARDRAFT_125152 [Jaapia argillacea MUCL 
33604]
Length=318

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 97/131 (74%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  46   IPSFSVPSVHDPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  105

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  165

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  166  LVYSYKGMGLS  176



>gb|AAM18885.1|AF391293_2 unknown [Branchiostoma floridae]
Length=275

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 102/140 (73%), Gaps = 5/140 (4%)
 Frame = +3

Query  123  ESSELFDEIPRVPSFQIPNITDFDGFQK-----DAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            + S++ + +  +  F IP +TD   F K     +    ++   GTTTLAF F+ GV+VA 
Sbjct  28   DESDVLNNLWSLDKFSIPAVTDPAEFLKPFTTGEGNVKIEFDHGTTTLAFKFQHGVIVAV  87

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  88   DSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLAEQCRIYELRNKERISV  147

Query  468  AGASKLLANILYSYRGMGLS  527
            A ASKLLANI+Y+Y+GMGLS
Sbjct  148  AAASKLLANIVYNYKGMGLS  167



>ref|XP_007395513.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55176.1| hypothetical protein PHACADRAFT_255622 [Phanerochaete carnosa 
HHB-10118-sp]
Length=300

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP F IP + D   F +       D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  43   VPKFNIPAVPDPSAFLRLHTDDFADPSCRIKIKHGTTTLAFRFRGGVIVAVDSRATAGSY  102

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  103  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  162

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  163  LVYSYKGMGLS  173



>ref|XP_002162379.2| PREDICTED: proteasome subunit beta type-5-like [Hydra vulgaris]
Length=277

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAIQ---MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSV  332
            +F +PN++D   F  +       ++   GTTTLAF FK GV+VA DSRAS G YI+SQ+V
Sbjct  44   NFPLPNVSDVSQFLNEYTNGDTKIQFHHGTTTLAFKFKHGVIVAVDSRASAGSYIASQTV  103

Query  333  KKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYR  512
            KK+IEINPY+LGTMAGGAADC FW R L  +CRL++L NK RISVA ASKLLAN++Y Y+
Sbjct  104  KKVIEINPYLLGTMAGGAADCAFWQRVLAKECRLYQLRNKERISVAAASKLLANMVYQYK  163

Query  513  GMGLS  527
            GMGLS
Sbjct  164  GMGLS  168



>ref|XP_007385467.1| N-terminal nucleophile aminohydrolase [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN07174.1| N-terminal nucleophile aminohydrolase [Punctularia strigosozonata 
HHB-11173 SS5]
Length=317

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPNFSVPNVPDPAAFLRLHTDDHADPSCRIKIKHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLS  527
            ++Y Y+GMGLS
Sbjct  168  LVYGYKGMGLS  178



>gb|KDE05583.1| proteasome component PRE2 [Microbotryum violaceum p1A1 Lamole]
Length=308

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF +P + D   F         D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  46   MPSFDLPTLQDPTAFLQLHTDDSSDPSCRIKINHGTTTLAFRFKGGIIVAVDSRATAGSY  105

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  106  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  165

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  166  LVYSYKGMGLS  176



>emb|CCF49354.1| probable PRE2-20S core proteasome subunit (beta5) [Ustilago hordei]
Length=325

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 12/148 (8%)
 Frame = +3

Query  114  IRGESSELFDEIPRVP-SFQIPNI---------TDFDGFQKDAIQMVKPAKGTTTLAFIF  263
            + G +   +D++   P  F +PN+         TD D    +    +K A GTTTLAF F
Sbjct  21   MHGSTGAAYDQLMGAPGQFDLPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRF  78

Query  264  KEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHEL  443
            K G++V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL
Sbjct  79   KGGIIVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHEL  138

Query  444  ANKRRISVAGASKLLANILYSYRGMGLS  527
             NK RISVA ASK L+N++YSY+GMGLS
Sbjct  139  RNKERISVAAASKYLSNLVYSYKGMGLS  166



>gb|EIF47547.1| proteasome component pre2 precursor [Brettanomyces bruxellensis 
AWRI1499]
Length=284

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 99/130 (76%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQK----DAIQ---MVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            PS  +P I+    F +    D++     +K A GTTTLAF FKEG++VA DSRA+ G ++
Sbjct  39   PSISLPPISKPTAFLRANTDDSVNPDCKIKIAHGTTTLAFRFKEGIIVAVDSRATAGSWV  98

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +SQ+VKK+IEINP +LGTMAGGAADCQ+W   LG +CRLHEL NK RISVA ASK+L+N+
Sbjct  99   ASQTVKKVIEINPMLLGTMAGGAADCQYWETWLGTQCRLHELRNKERISVAAASKILSNL  158

Query  498  LYSYRGMGLS  527
            +YSY+GMGLS
Sbjct  159  VYSYKGMGLS  168



>gb|EKD04801.1| proteasome component [Trichosporon asahii var. asahii CBS 8904]
Length=275

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
            E+P VP          D    +    +K A GTTTLAF FK G++VA DSRA+ G YI+S
Sbjct  34   EVPGVPDPLAFLSLHTDSMSTNPAAKIKLAHGTTTLAFRFKGGIIVAVDSRATAGSYIAS  93

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILY  503
             +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+NI+Y
Sbjct  94   GTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRNKERISVAAASKILSNIVY  153

Query  504  SYRGMGLS  527
             Y+GMGLS
Sbjct  154  QYKGMGLS  161



>gb|EJT45706.1| proteasome component [Trichosporon asahii var. asahii CBS 2479]
Length=275

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
            E+P VP          D    +    +K A GTTTLAF FK G++VA DSRA+ G YI+S
Sbjct  34   EVPGVPDPLAFLSLHTDSMSTNPAAKIKLAHGTTTLAFRFKGGIIVAVDSRATAGSYIAS  93

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILY  503
             +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK+L+NI+Y
Sbjct  94   GTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRNKERISVAAASKILSNIVY  153

Query  504  SYRGMGLS  527
             Y+GMGLS
Sbjct  154  QYKGMGLS  161



>ref|XP_007326468.1| hypothetical protein AGABI1DRAFT_111072 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM82453.1| hypothetical protein AGABI1DRAFT_111072 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=311

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 97/134 (72%), Gaps = 7/134 (5%)
 Frame = +3

Query  147  IPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            I  +P+F++P + D   F         D    +K   GTTTLAF FK GV+VA DSRA+ 
Sbjct  46   IKGIPAFKVPAVADPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATA  105

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  485
            G Y++S +VKK+IEINPY+LGTMAGGAADCQFW   LG+ CRLHEL N+ RISV+ ASK 
Sbjct  106  GSYVASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHELRNRERISVSAASKY  165

Query  486  LANILYSYRGMGLS  527
            L+N++YSY+GMGLS
Sbjct  166  LSNLVYSYKGMGLS  179



>gb|EJK48257.1| hypothetical protein THAOC_32963 [Thalassiosira oceanica]
Length=248

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  207  DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGA  386
            D  Q VK AKGTTTLAF F  G++V+ DSR++MG YI+S +VKK+IEINP++LGTMAGGA
Sbjct  28   DQGQEVKFAKGTTTLAFKFNGGIIVSVDSRSTMGAYIASGTVKKVIEINPFLLGTMAGGA  87

Query  387  ADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            ADC FW RNLG++CR++EL NK+RISVA ASKLLAN + SYRG GLS
Sbjct  88   ADCSFWERNLGIQCRMYELRNKKRISVAAASKLLANTMRSYRGYGLS  134



>ref|XP_003332961.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP88542.2| 20S proteasome subunit beta 5 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=289

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 96/130 (74%), Gaps = 6/130 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            VP F +P + D   F       + A   +K   GTTTLAF F+ G++VA DSRA+ G YI
Sbjct  41   VPRFDLPGVKDPVSFLRTHTDDRSADAKIKIKHGTTTLAFRFQHGIIVAVDSRATAGSYI  100

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINP++LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK L+N+
Sbjct  101  ASGTVKKVIEINPFLLGTMAGGAADCQYWETYLGIQCRLHELRNKSRISVAAASKYLSNL  160

Query  498  LYSYRGMGLS  527
            +YSY+GMGLS
Sbjct  161  VYSYKGMGLS  170



>ref|XP_005713380.1| 20S core proteasome subunit beta 5 [Chondrus crispus]
 emb|CDF33577.1| 20S core proteasome subunit beta 5 [Chondrus crispus]
Length=286

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = +3

Query  162  SFQIPNITDFDGFQKDAI------QMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISS  323
            S  +P +     F +DA         ++ A GTTTLAF FK G++VA DSRASMG YI S
Sbjct  35   SLVVPQVDRPSSFLRDAFANVPEKDRIRFAHGTTTLAFSFKGGIIVAVDSRASMGQYIGS  94

Query  324  QSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILY  503
             +VKKIIEINPY+LGTMAGGAADC FW R+LG +C+L+EL NK RISVA ASKLLAN +Y
Sbjct  95   GTVKKIIEINPYLLGTMAGGAADCSFWERDLGRRCKLYELRNKERISVAAASKLLANTVY  154

Query  504  SYRGMGLS  527
             Y+GMGLS
Sbjct  155  YYKGMGLS  162



>ref|XP_006457891.1| 20S proteasome subunit [Agaricus bisporus var. bisporus H97]
 gb|EKV49845.1| 20S proteasome subunit [Agaricus bisporus var. bisporus H97]
Length=311

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 97/134 (72%), Gaps = 7/134 (5%)
 Frame = +3

Query  147  IPRVPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            I  +P+F++P + D   F         D    +K   GTTTLAF FK GV+VA DSRA+ 
Sbjct  46   IKGIPAFKVPAVADPTAFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATA  105

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  485
            G Y++S +VKK+IEINPY+LGTMAGGAADCQFW   LG+ CRLHEL N+ RISV+ ASK 
Sbjct  106  GSYVASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHELRNRERISVSAASKY  165

Query  486  LANILYSYRGMGLS  527
            L+N++YSY+GMGLS
Sbjct  166  LSNLVYSYKGMGLS  179



>gb|KII89158.1| hypothetical protein PLICRDRAFT_109139 [Plicaturopsis crispa 
FD-325 SS-3]
Length=318

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 94/131 (72%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +PN+ D   F         D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  48   VPTFSVPNVPDPSSFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N  RISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNHERISVSAASKYLSN  167

Query  495  ILYSYRGMGLS  527
            ++Y Y+GMGLS
Sbjct  168  LVYGYKGMGLS  178



>emb|CCO27714.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
 emb|CEL51643.1| 20S proteasome subunit beta 5 [Rhizoctonia solani AG-1 IB]
Length=302

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 95/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF IP + D   F         D    +K   GTTTLAF FK G++VA DSRA+ G Y
Sbjct  45   VPSFTIPRVPDPTAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGIIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  165  LVYSYKGMGLS  175



>gb|KDQ33416.1| hypothetical protein PLEOSDRAFT_1110569 [Pleurotus ostreatus 
PC15]
Length=307

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP++ D   F +       D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  48   VPTFSIPSVADPTAFLRLHTDDSSDPNCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNRERISVSAASKYLSN  167

Query  495  ILYSYRGMGLS  527
            ++Y Y+GMGLS
Sbjct  168  LVYGYKGMGLS  178



>gb|KDR73611.1| hypothetical protein GALMADRAFT_124865 [Galerina marginata CBS 
339.88]
Length=314

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 95/130 (73%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            P+F +PN+ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G YI
Sbjct  49   PTFSVPNVADPTSFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSYI  108

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N+
Sbjct  109  ASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSNL  168

Query  498  LYSYRGMGLS  527
            +YSY+GMGLS
Sbjct  169  VYSYKGMGLS  178



>gb|AAS01050.1| putative proteasome 20S beta5 subunit [Brassica napus]
Length=150

 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            ASMGGYISSQSVKKIIEINPYMLGTMAGGAAD QFWHRNLG+KCRLHELANKRRISV+GA
Sbjct  1    ASMGGYISSQSVKKIIEINPYMLGTMAGGAADRQFWHRNLGIKCRLHELANKRRISVSGA  60

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN+LYSYRGMGLS
Sbjct  61   SKLLANMLYSYRGMGLS  77



>ref|XP_002730946.1| PREDICTED: proteasome subunit beta type-5-like [Saccoglossus 
kowalevskii]
Length=277

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 106/152 (70%), Gaps = 15/152 (10%)
 Frame = +3

Query  87   FSGLESTAPIRGESSELFDEIPRVPSFQIPNITD----FDGFQK-DAIQMVKPAKGTTTL  251
            F  L++  P      E ++E    P F +P + D       F+K D+   ++   GTTTL
Sbjct  26   FEALDNVEP------EFYNE----PKFTLPQVADPAEYLKQFEKEDSDVKIRFHHGTTTL  75

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF F+ GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR
Sbjct  76   AFKFQHGVIVAVDSRATAGPFIASQTVKKVIEINPYLLGTMAGGAADCSFWERVLSQQCR  135

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            ++EL NK RISVA ASKLLAN++Y+Y+GMGLS
Sbjct  136  IYELRNKERISVAAASKLLANMVYNYKGMGLS  167



>gb|KIK08153.1| hypothetical protein K443DRAFT_672633 [Laccaria amethystina LaAM-08-1]
Length=302

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  37   VPTFSIPDVADPTSFLQMHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  96

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  97   VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  156

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  157  LVYSYKGMGLS  167



>gb|KIK59625.1| hypothetical protein GYMLUDRAFT_201809 [Gymnopus luxurians FD-317 
M1]
Length=303

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  47   VPNFTVPSVPDPSAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LGV CRLHEL N+ RISV+ ASK L+N
Sbjct  107  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGVHCRLHELRNRERISVSAASKYLSN  166

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  167  LVYSYKGMGLS  177



>ref|XP_002179855.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48841.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=283

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +3

Query  144  EIPRVPSFQIPNITDFDGF--QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            ++P VP   +   ++F       DA Q VK AKGTTTLAF F  G++V+ DSR++MG YI
Sbjct  41   DVPNVPDPALYCRSNFASACGNADAGQEVKFAKGTTTLAFKFNGGIIVSVDSRSTMGYYI  100

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINP++LGTMAGGAADC FW RNLG++CRL+EL N RRI+VA ASKLLAN+
Sbjct  101  ASGTVKKVIEINPFLLGTMAGGAADCSFWERNLGMECRLYELRNGRRITVAAASKLLANV  160

Query  498  LYSYRGMGLS  527
            + +YRG GLS
Sbjct  161  MSAYRGYGLS  170



>ref|XP_001875479.1| 20S proteasome subunit [Laccaria bicolor S238N-H82]
 gb|EDR14920.1| 20S proteasome subunit [Laccaria bicolor S238N-H82]
Length=307

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  41   VPTFSIPDVADPTSFLQLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  100

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  101  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  160

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  161  LVYSYKGMGLS  171



>ref|XP_007418509.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
 gb|EGF98220.1| 20S proteasome subunit [Melampsora larici-populina 98AG31]
Length=296

 Score =   158 bits (400),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 96/130 (74%), Gaps = 6/130 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            VP+F+ P + D   F       +     +K   GTTTLAF FK G++VA DSRA+ G YI
Sbjct  44   VPTFEFPAVDDPAAFLRAHTDDRSPDSRIKIRHGTTTLAFRFKHGIVVAVDSRATAGSYI  103

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINP++LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK L+N+
Sbjct  104  ASGTVKKVIEINPFLLGTMAGGAADCQYWETYLGMQCRLHELRNKSRISVAAASKHLSNL  163

Query  498  LYSYRGMGLS  527
            +YSY+GMGLS
Sbjct  164  VYSYKGMGLS  173



>gb|ESA00717.1| hypothetical protein GLOINDRAFT_338395 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64892.1| proteasome core particle subunit beta 5 [Rhizophagus irregularis 
DAOM 197198w]
Length=288

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 107/152 (70%), Gaps = 13/152 (9%)
 Frame = +3

Query  84   DFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKD----AIQMVKPAKGTTTL  251
            DF G ++    +G S   FD    VPS   PN T+F     D    A   +K   GTTTL
Sbjct  23   DFVGFDAA---KGFSLPTFD----VPS--CPNPTEFLKAHTDENSTAEYQIKLEHGTTTL  73

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            +F F+ G++VA DSRAS G +I++Q+VKK+IEINPY+LGTMAGGAADC FW R LG +CR
Sbjct  74   SFKFQGGIIVAVDSRASAGSFIATQTVKKVIEINPYLLGTMAGGAADCIFWQRELGRRCR  133

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            L+EL NK RISVA ASKLLAN++Y+Y+GMGLS
Sbjct  134  LYELRNKERISVAAASKLLANMVYAYKGMGLS  165



>gb|KIJ17479.1| hypothetical protein PAXINDRAFT_168130 [Paxillus involutus ATCC 
200175]
Length=315

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  49   VPSFMVPSVPDPAAFLRLHTDDHADPSCKIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  109  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNRERISVSAASKYLSN  168

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  169  LVYSYKGMGLS  179



>ref|XP_007100520.1| PREDICTED: proteasome subunit beta type-5 isoform X4 [Physeter 
catodon]
Length=199

 Score =   155 bits (392),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 4/137 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  I    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLIAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN++Y Y+GMGLS
Sbjct  139  SKLLANMVYQYKGMGLS  155



>ref|XP_006746559.1| PREDICTED: proteasome subunit beta type-5, partial [Leptonychotes 
weddellii]
Length=160

 Score =   154 bits (389),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 100/137 (73%), Gaps = 10/137 (7%)
 Frame = +3

Query  129  SELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            ++L D  P  PS       PN   +   ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  25   ADLLDLGPGSPSDGLSLAAPN---WGVAEEPRIEMLH---GTTTLAFKFQHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN++Y Y+GMGLS
Sbjct  139  SKLLANMVYQYKGMGLS  155



>gb|KIM65350.1| hypothetical protein SCLCIDRAFT_542814 [Scleroderma citrinum 
Foug A]
Length=306

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 108/172 (63%), Gaps = 25/172 (15%)
 Frame = +3

Query  87   FSGLESTAPIRGESSELFDEIPRV------------------PSFQIPNITDFDGF----  200
            F+GL S   +R  ++ + D+   +                  PSF +P++ D   F    
Sbjct  8    FTGLSSNVELRRRNATVVDDDEDISDAMWGSLGGFGSLASGAPSFTVPSVPDPAAFLRLH  67

Query  201  ---QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGT  371
                 D    +K   GTTTLAF ++ GV+VA DSRA+ G YI+S +VKK+IEINPY+LGT
Sbjct  68   TDDHADPSCRIKIQHGTTTLAFRYQGGVIVAVDSRATAGNYIASGTVKKVIEINPYLLGT  127

Query  372  MAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            MAGGAADCQFW   LG+ CRLHEL N+ RISV+ ASK L+N++YSY+GMGLS
Sbjct  128  MAGGAADCQFWETYLGMHCRLHELRNRERISVSAASKYLSNLVYSYKGMGLS  179



>ref|XP_007361365.1| N-terminal nucleophile aminohydrolase [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF66103.1| N-terminal nucleophile aminohydrolase [Dichomitus squalens LYAD-421 
SS1]
Length=314

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 97/131 (74%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP F++P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPMFKLPSVPDPTSFLRMHTDDHADPSCRIKIKHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  168  LVYSYKGMGLS  178



>ref|XP_007764597.1| 20S proteasome subunit [Coniophora puteana RWD-64-598 SS2]
 gb|EIW84942.1| 20S proteasome subunit [Coniophora puteana RWD-64-598 SS2]
Length=314

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 95/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF++P + D   F         D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  48   VPSFEVPAVPDPSAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  167

Query  495  ILYSYRGMGLS  527
            ++Y Y+GMGLS
Sbjct  168  LVYGYKGMGLS  178



>ref|XP_007880004.1| hypothetical protein PFL1_04286 [Pseudozyma flocculosa PF-1]
 gb|EPQ27959.1| hypothetical protein PFL1_04286 [Pseudozyma flocculosa PF-1]
Length=331

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 3/129 (2%)
 Frame = +3

Query  144  EIPRV-PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            E+P V P+  +   TD D     A   +K + GTTTLAF F+ G++VA DSRA+ G YI+
Sbjct  47   ELPNVDPATFLSQYTDVDSSNPGA--KIKLSHGTTTLAFRFRGGIIVAVDSRATAGSYIA  104

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK RISVA ASK L+N++
Sbjct  105  SGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKERISVAAASKYLSNLV  164

Query  501  YSYRGMGLS  527
            YSY+GMGLS
Sbjct  165  YSYKGMGLS  173



>ref|XP_007850837.1| proteasome component pre2 precursor [Moniliophthora roreri MCA 
2997]
 gb|ESK89859.1| proteasome component pre2 precursor [Moniliophthora roreri MCA 
2997]
Length=297

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  45   VPTFGVPSVPDPSAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  105  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIHCRLHELRNRERISVSAASKYLSN  164

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  165  LVYSYKGMGLS  175



>gb|EMS25821.1| 20S proteasome subunit beta 5 [Rhodosporidium toruloides NP11]
 emb|CDR38163.1| RHTO0S03e04852g1_1 [Rhodosporidium toruloides]
Length=298

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGFQK-------DAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F++P   D   F +       D    +K   GTTTLAF F+ G++VA DSRA+ G Y
Sbjct  47   VPNFEMPATIDPTSFLQLHTDDASDPSCRIKINHGTTTLAFKFQGGIVVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N  RISVA ASK LAN
Sbjct  107  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNHERISVAAASKYLAN  166

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  167  LVYSYKGMGLS  177



>ref|XP_003801967.1| PREDICTED: proteasome subunit beta type-5 [Otolemur garnettii]
Length=263

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P+ PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPKSPSDGLSLVAPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN++Y Y+GMGLS
Sbjct  139  SKLLANMVYQYKGMGLS  155



>gb|KIW62885.1| proteasome subunit beta type-5 [Capronia semiimmersa]
Length=283

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 104/143 (73%), Gaps = 8/143 (6%)
 Frame = +3

Query  123  ESSELFDEIPRVP-SFQIPNITDFDGFQKDAIQ-------MVKPAKGTTTLAFIFKEGVM  278
            E +++ + +P +   F +P I     F + A          +K A GTTTLAF FK G++
Sbjct  22   EQNDICETVPPLSLKFALPPIPRPSAFLRAATDDHSNPNCPIKIAHGTTTLAFRFKGGII  81

Query  279  VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRR  458
            VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+W   LGV+CRLHEL +KRR
Sbjct  82   VATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQYWLAYLGVQCRLHELHHKRR  141

Query  459  ISVAGASKLLANILYSYRGMGLS  527
            ISVA ASK+LAN++YSY+GMGLS
Sbjct  142  ISVAAASKILANLVYSYKGMGLS  164



>gb|KIL00906.1| hypothetical protein PAXRUDRAFT_821100 [Paxillus rubicundulus 
Ve08.2h10]
Length=314

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  48   VPSFMVPSVPDPAAFLRLHTDDHADPSCKIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  167

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  168  LVYSYKGMGLS  178



>emb|CBN74512.1| conserved unknown protein [Ectocarpus siliculosus]
Length=286

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  195  GFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q +K AKGTTTLAF F+ G++V+ DSR++MG YI+S +VKK+IEINPY+LGTM
Sbjct  54   GYGTDHAQDIKFAKGTTTLAFKFQGGIIVSVDSRSTMGPYIASGTVKKVIEINPYLLGTM  113

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            AGGAADC FW RNLG++CR++EL NK RISVA ASKLL+N +  YRG GLS
Sbjct  114  AGGAADCSFWERNLGIQCRMYELRNKERISVAAASKLLSNTMSQYRGYGLS  164



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 99/131 (76%), Gaps = 8/131 (6%)
 Frame = +3

Query  156  VPSFQIP-------NITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
              +F+IP       ++  F     D I+ ++ A GTTTLAF FK GV+VA DSRA+ G +
Sbjct  38   TETFEIPQNFNPGEDLKQFTEGNDDNIK-IRIAHGTTTLAFKFKHGVIVAVDSRATAGDW  96

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +  +CR++EL NK RISVA ASKLLAN
Sbjct  97   IASQTVKKVIEINPYLLGTMAGGAADCQYWERVVARQCRIYELRNKERISVAAASKLLAN  156

Query  495  ILYSYRGMGLS  527
            I+Y+Y+GMGLS
Sbjct  157  IVYNYKGMGLS  167



>ref|XP_007723577.1| proteasome component PRE2 [Capronia coronata CBS 617.96]
 gb|EXJ91383.1| proteasome component PRE2 [Capronia coronata CBS 617.96]
Length=283

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 103/143 (72%), Gaps = 8/143 (6%)
 Frame = +3

Query  123  ESSELFDEIPRVP-SFQIPNITDFDGFQKDAIQ-------MVKPAKGTTTLAFIFKEGVM  278
            E  +  D +P +   F +P ++    F + A          +K A GTTTLAF FK G++
Sbjct  22   EQDDYTDTLPPLSLKFALPPVSRPSAFLRAATDDYSNPNCPIKIAHGTTTLAFRFKGGII  81

Query  279  VAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRR  458
            VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+W   LG++CRLHEL +KRR
Sbjct  82   VATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQYWLAYLGIQCRLHELRHKRR  141

Query  459  ISVAGASKLLANILYSYRGMGLS  527
            ISVA ASK+LAN++YSY+GMGLS
Sbjct  142  ISVAAASKILANLVYSYKGMGLS  164



>gb|EUC61688.1| proteasome subunit beta type-5 protein [Rhizoctonia solani AG-3 
Rhs1AP]
Length=302

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP + D  GF         D    +K   GTTTLAF FK G++V  DSRA+ G Y
Sbjct  45   VPAFNIPRVPDPIGFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGIIVCVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  165  LVYSYKGMGLS  175



>gb|KEP54479.1| proteasome subunit beta type-5 protein [Rhizoctonia solani 123E]
Length=302

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F IP + D  GF         D    +K   GTTTLAF FK G++V  DSRA+ G Y
Sbjct  45   VPAFNIPRVPDPIGFLRLHTDDHADPNCRIKIQHGTTTLAFRFKGGIIVCVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  165  LVYSYKGMGLS  175



>ref|XP_007449603.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Lipotes 
vexillifer]
Length=203

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 4/137 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN++Y Y+GMGLS
Sbjct  139  SKLLANMVYQYKGMGLS  155



>gb|KJA27011.1| hypothetical protein HYPSUDRAFT_35526 [Hypholoma sublateritium 
FD-334 SS-4]
Length=319

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  PSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYI  317
            PSF +P+I D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G YI
Sbjct  49   PSFNVPDIPDPTSFLRLHTDDHADPSCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSYI  108

Query  318  SSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANI  497
            +S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N+
Sbjct  109  ASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSNL  168

Query  498  LYSYRGMGLS  527
            +YSY+GMGLS
Sbjct  169  VYSYKGMGLS  178



>ref|XP_002911819.1| proteasome component pts1 [Coprinopsis cinerea okayama7#130]
 gb|EFI28325.1| proteasome component pts1 [Coprinopsis cinerea okayama7#130]
Length=313

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P + D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  49   VPTFTVPALPDPTAFLRLHTDDHADPSCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL NK RISV+ ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNKERISVSAASKFLSN  168

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  169  LVYSYKGMGLS  179



>emb|CDO73558.1| hypothetical protein BN946_scf185014.g28 [Trametes cinnabarina]
Length=311

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 97/131 (74%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F++P + D   F         D    +K   GTTTLAF ++ GV+VA DSRA+ G Y
Sbjct  48   VPTFKVPAVPDPTSFLRMHTDDHADPSCRIKIKHGTTTLAFRYQGGVIVAVDSRATAGSY  107

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  108  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMQCRLHELRNRERISVAAASKYLSN  167

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  168  LVYSYKGMGLS  178



>ref|XP_004283229.1| PREDICTED: proteasome subunit beta type-5 isoform 2 [Orcinus 
orca]
Length=203

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 4/137 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  +    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLVAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN++Y Y+GMGLS
Sbjct  139  SKLLANMVYQYKGMGLS  155



>gb|KIJ69319.1| hypothetical protein HYDPIDRAFT_79749 [Hydnomerulius pinastri 
MD-312]
Length=315

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 95/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
             PSF +P++ D   F         D    +K   GTTTLAF FK GV+VA DSRA+ G Y
Sbjct  52   TPSFMVPSVPDPAAFLRLHTDDHADPSCRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSY  111

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  112  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  171

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  172  LVYSYKGMGLS  182



>gb|ELU16739.1| hypothetical protein CAPTEDRAFT_41193, partial [Capitella teleta]
Length=131

 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF FK GV+VA DSRA+ G +I+SQ+VKK+IEINPY+LGTMAGGAADCQ+W R +
Sbjct  2    GTTTLAFKFKHGVIVAVDSRATAGDWIASQTVKKVIEINPYLLGTMAGGAADCQYWERVV  61

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
              +CR++EL NK RISVA ASKLLANI+Y+Y+GMGLS
Sbjct  62   ARQCRIYELRNKERISVAAASKLLANIVYNYKGMGLS  98



>ref|XP_008731643.1| proteasome component PRE2 [Cladophialophora carrionii CBS 160.54]
 gb|ETI19284.1| proteasome component PRE2 [Cladophialophora carrionii CBS 160.54]
Length=283

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LGV+CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSYKGMGLS  164



>gb|KFH47961.1| Proteasome subunit beta type-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=283

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 105/152 (69%), Gaps = 8/152 (5%)
 Frame = +3

Query  96   LESTAPIRGESSELFDEIPRVP-SFQIPNITDFDGFQKDAIQ-------MVKPAKGTTTL  251
            LE   P   E+ EL +    +   F +P +T    + + A          +K A GTTTL
Sbjct  13   LEQNDPFEDEAKELMNPADHLSMKFAMPPVTQPASWLRAATDDRSNPNCPIKIAHGTTTL  72

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF F+ G++VA DSRAS G +I+SQ+VKK+IEIN  +LGTMAGGAADCQFW   LG++CR
Sbjct  73   AFRFQGGIIVATDSRASAGDWIASQTVKKVIEINSVLLGTMAGGAADCQFWLAWLGMQCR  132

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  133  LHELRHKRRISVAAASKILANLIYSYKGMGLS  164



>gb|KIW59603.1| proteasome subunit beta type-5 [Exophiala xenobiotica]
Length=282

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 102/146 (70%), Gaps = 11/146 (8%)
 Frame = +3

Query  123  ESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQ-------MVKPAKGTTTLAFIFKE  269
            +S E  D    VPS    F +P +     F +            +K A GTTTLAF FK 
Sbjct  19   DSEEQNDYTDTVPSLSLKFALPPVARPSAFLRATTDDHANPNCPIKIAHGTTTLAFRFKG  78

Query  270  GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELAN  449
            G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+W   LG++CRLHEL +
Sbjct  79   GIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQYWLAYLGIQCRLHELRH  138

Query  450  KRRISVAGASKLLANILYSYRGMGLS  527
            KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  139  KRRISVAAASKILANLVYSYKGMGLS  164



>gb|KIW29970.1| proteasome subunit beta type-5 [Cladophialophora immunda]
Length=283

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LGV+CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSYKGMGLS  164



>ref|XP_007739562.1| proteasome component PRE2 [Cladophialophora psammophila CBS 110553]
 gb|EXJ76245.1| proteasome component PRE2 [Cladophialophora psammophila CBS 110553]
 gb|KIW99083.1| proteasome subunit beta type-5 [Cladophialophora bantiana CBS 
173.52]
Length=283

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LGV+CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSYKGMGLS  164



>gb|KIX98319.1| proteasome subunit beta type-5 [Fonsecaea multimorphosa CBS 102226]
Length=283

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LGV+CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSYKGMGLS  164



>ref|XP_008156743.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Eptesicus 
fuscus]
Length=201

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 105/153 (69%), Gaps = 9/153 (6%)
 Frame = +3

Query  90   SGLESTAPIR-------GESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTT  248
            S LES+ P+        G  ++L D  P  PS  +       G  ++    ++   GTTT
Sbjct  5    SVLESSVPVNRHGFFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEEP--KIEILHGTTT  62

Query  249  LAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKC  428
            LAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +C
Sbjct  63   LAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC  122

Query  429  RLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            R++EL NK RISVA ASKLLAN++Y Y+GMGLS
Sbjct  123  RIYELRNKERISVAAASKLLANMVYQYKGMGLS  155



>gb|KIW80298.1| hypothetical protein Z517_06913 [Fonsecaea pedrosoi CBS 271.37]
Length=283

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LGV+CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSYKGMGLS  164



>ref|XP_007761346.1| proteasome component PRE2 [Cladophialophora yegresii CBS 114405]
 gb|EXJ53831.1| proteasome component PRE2 [Cladophialophora yegresii CBS 114405]
Length=283

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LGV+CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGVQCRLHELHHKRRISVAAASKILANLVYSYKGMGLS  164



>gb|EST08741.1| 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 
[Pseudozyma brasiliensis GHG001]
Length=344

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 12/144 (8%)
 Frame = +3

Query  126  SSELFDEIPRVP-SFQIPNI---------TDFDGFQKDAIQMVKPAKGTTTLAFIFKEGV  275
            SS   D++   P  F +PN+         TD D    +    +K A GTTTLAF FK G+
Sbjct  44   SSSAHDQMMGAPGQFDLPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRFKGGI  101

Query  276  MVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKR  455
            +V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL NK 
Sbjct  102  IVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNKE  161

Query  456  RISVAGASKLLANILYSYRGMGLS  527
            RISVA ASK L+N++YSY+GMGLS
Sbjct  162  RISVAAASKYLSNLVYSYKGMGLS  185



>ref|XP_011276949.1| Proteasome subunit beta type-5 [Wickerhamomyces ciferrii]
 emb|CCH41235.1| Proteasome subunit beta type-5 [Wickerhamomyces ciferrii]
Length=285

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 98/134 (73%), Gaps = 7/134 (5%)
 Frame = +3

Query  147  IPRVPSFQIPNI---TDFDGFQKDAIQ----MVKPAKGTTTLAFIFKEGVMVAADSRASM  305
            +P  PS  +P I   TDF     D  +     +K A GTTTLAF FK G++VA DSRA+ 
Sbjct  36   LPLAPSLSMPPISQPTDFLRAHTDDSKNPDCKIKIAHGTTTLAFRFKGGIVVAVDSRATA  95

Query  306  GGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKL  485
            G +I+SQ+VKK+IEINP++LGTMAGGAADCQ+W   LG +CRLHEL  K RISVA ASK+
Sbjct  96   GNWIASQTVKKVIEINPFLLGTMAGGAADCQYWETWLGTQCRLHELREKSRISVAAASKI  155

Query  486  LANILYSYRGMGLS  527
            L+N++Y Y+GMGLS
Sbjct  156  LSNLVYQYKGMGLS  169



>ref|XP_004474611.1| PREDICTED: proteasome subunit beta type-5 [Dasypus novemcinctus]
Length=262

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 101/140 (72%), Gaps = 10/140 (7%)
 Frame = +3

Query  120  GESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            G  ++L D  P  PS       PN+   D  ++  I+M+    GTTTLAF F+ GV+VA 
Sbjct  22   GGRADLLDLGPGSPSDGMSLAAPNL---DVSEEPGIEMLH---GTTTLAFKFRHGVIVAV  75

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  76   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISV  135

Query  468  AGASKLLANILYSYRGMGLS  527
            A ASKLLAN++Y Y+GMGLS
Sbjct  136  AAASKLLANMVYQYKGMGLS  155



>gb|EAW66194.1| proteasome (prosome, macropain) subunit, beta type, 5, isoform 
CRA_b [Homo sapiens]
Length=148

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  237  GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNL  416
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L
Sbjct  4    GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLL  63

Query  417  GVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
              +CR++EL NK RISVA ASKLLAN++Y Y+GMGLS
Sbjct  64   ARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLS  100



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 109/159 (69%), Gaps = 14/159 (9%)
 Frame = +3

Query  72   MVRIDFSGLESTAPI-----RGESSELFDEIPRV--PSFQIPNITDFDGFQKDAIQMVKP  230
            M  I+   L++ AP+     R +  E   +IP V  P+  +  +TD         + +K 
Sbjct  1    MAMIEECSLDAFAPLSLKAPRDDGVEF--QIPEVINPALHLRELTD-----SKYGKGIKF  53

Query  231  AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHR  410
              GTTTLAF F+ GV+VA DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R
Sbjct  54   NHGTTTLAFKFQHGVVVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMFWER  113

Query  411  NLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
             L  +CR++EL NK RISVA ASK+LAN++Y+Y+GMGLS
Sbjct  114  VLAKQCRIYELRNKERISVAAASKILANMVYNYKGMGLS  152



>ref|XP_006696296.1| hypothetical protein CTHT_0059780 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS17965.1| hypothetical protein CTHT_0059780 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=283

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 104/152 (68%), Gaps = 17/152 (11%)
 Frame = +3

Query  123  ESSELFDEI----------PRVPSFQIPNITDFDGFQKDAIQ-------MVKPAKGTTTL  251
            + +ELFDE+          P    F +P +T    + +            +K A GTTTL
Sbjct  14   QQTELFDELEQQDLVTTNPPLSLKFAMPPVTHPSAWLRAVTDDRSNPSCPIKIAHGTTTL  73

Query  252  AFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCR  431
            AF FKEG++VA DSRA+ G +I+SQ+VKK+IEIN  +LGTMAGGAADCQ+W   LG++CR
Sbjct  74   AFRFKEGIIVATDSRATAGNWIASQTVKKVIEINSELLGTMAGGAADCQYWLAWLGMQCR  133

Query  432  LHELANKRRISVAGASKLLANILYSYRGMGLS  527
            LHEL +KRRISVA ASK+LAN++Y Y+GMGLS
Sbjct  134  LHELRHKRRISVAAASKILANLVYQYKGMGLS  165



>ref|XP_009160370.1| proteasome component PRE2 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59909.1| proteasome component PRE2 [Exophiala dermatitidis NIH/UT8656]
Length=283

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LG++CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGIQCRLHELRHKRRISVAAASKILANLVYSYKGMGLS  164



>ref|XP_008564788.1| PREDICTED: proteasome subunit beta type-5 [Galeopterus variegatus]
Length=263

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 103/150 (69%), Gaps = 18/150 (12%)
 Frame = +3

Query  78   RIDFSGLESTAPIRGESSELFDEIPRVPSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAF  257
            R D   L   +PI G S          PS+ +P        ++  I+M+    GTTTLAF
Sbjct  24   RTDLLDLGPGSPIDGLSLA-------APSWGVP--------EEPGIEMLH---GTTTLAF  65

Query  258  IFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLH  437
             F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++
Sbjct  66   KFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIY  125

Query  438  ELANKRRISVAGASKLLANILYSYRGMGLS  527
            EL NK RISVA ASKLLAN++Y Y+GMGLS
Sbjct  126  ELRNKERISVAAASKLLANMVYQYKGMGLS  155



>ref|XP_007321997.1| hypothetical protein SERLADRAFT_475676 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN95513.1| hypothetical protein SERLA73DRAFT_186558 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO21040.1| hypothetical protein SERLADRAFT_475676 [Serpula lacrymans var. 
lacrymans S7.9]
Length=317

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VPSF +P+++D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y
Sbjct  47   VPSFTVPSVSDPAAFLRLHTDDHADPNCKIKIQHGTTTLAFRFQGGVIVAVDSRATAGSY  106

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            ++S +VKK+IEINPY+LGTMAGGAADCQ+W   LG+ CRLHEL N+ RISV+ ASK L+N
Sbjct  107  VASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGMHCRLHELRNRERISVSAASKYLSN  166

Query  495  ILYSYRGMGLS  527
            ++Y Y+GMGLS
Sbjct  167  LVYGYKGMGLS  177



>emb|CDI55907.1| probable PRE2-20S core proteasome subunit (beta5) (C-terminal 
fragment) [Melanopsichium pennsylvanicum 4]
Length=324

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 102/146 (70%), Gaps = 12/146 (8%)
 Frame = +3

Query  120  GESSELFDEIPRVP-SFQIPNI---------TDFDGFQKDAIQMVKPAKGTTTLAFIFKE  269
            G SS   D++   P  F +PN+         TD D    +    +K A GTTTLAF F+ 
Sbjct  22   GGSSAAQDQLMGAPGQFALPNMDPATFLSQYTDVD--SSNPAAKIKLAHGTTTLAFRFRG  79

Query  270  GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELAN  449
            G++V  DSRA+ G YI+S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N
Sbjct  80   GIIVCVDSRATAGSYIASGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRN  139

Query  450  KRRISVAGASKLLANILYSYRGMGLS  527
            K RISVA ASK L+N++YSY+GMGLS
Sbjct  140  KERISVAAASKYLSNLVYSYKGMGLS  165



>gb|KIW10869.1| proteasome subunit beta type-5 [Exophiala spinifera]
Length=283

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LG++CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGIQCRLHELRHKRRISVAAASKILANLVYSYKGMGLS  164



>ref|XP_007730075.1| proteasome component PRE2 [Capronia epimyces CBS 606.96]
 gb|EXJ93185.1| proteasome component PRE2 [Capronia epimyces CBS 606.96]
Length=283

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LG++CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGIQCRLHELRHKRRISVAAASKILANLVYSYKGMGLS  164



>gb|KIW41006.1| proteasome subunit beta type-5 [Exophiala oligosperma]
Length=283

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LG++CRLHEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  123  WLAYLGIQCRLHELRHKRRISVAAASKILANLVYSYKGMGLS  164



>gb|KIO13433.1| hypothetical protein M404DRAFT_122218 [Pisolithus tinctorius 
Marx 270]
Length=304

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 95/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            VP+F +P++ D   F         D    +K   GTTTLAF ++ GV+VA DSRA+ G Y
Sbjct  49   VPTFTVPSVPDPAAFLRLHTDDHADPSCRIKIQHGTTTLAFRYQGGVIVAVDSRATAGNY  108

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEINPY+LGTMAGGAADCQFW   LG+ CRLHEL N  RISV+ ASK L+N
Sbjct  109  IASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHELRNHERISVSAASKYLSN  168

Query  495  ILYSYRGMGLS  527
            ++YSY+GMGLS
Sbjct  169  LVYSYKGMGLS  179



>ref|XP_006682354.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF76856.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=267

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K  KGTTTLAF F +GV+VA DSRA+MG YI SQ+VKK+IEINPY+LGTMAGGAADC F
Sbjct  1    IKLEKGTTTLAFKFAKGVVVAVDSRATMGSYIGSQTVKKVIEINPYLLGTMAGGAADCSF  60

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W R LG + RL+EL NK RISVA ASKLL+N++Y Y+GMGLS
Sbjct  61   WERELGRRARLYELRNKERISVAAASKLLSNMVYGYKGMGLS  102



>gb|KDQ18004.1| hypothetical protein BOTBODRAFT_104582 [Botryobasidium botryosum 
FD-172 SS1]
Length=308

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 7/131 (5%)
 Frame = +3

Query  156  VPSFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY  314
            +PSF+IP + D   F       + D    +K   GTTTLAF F+ G++VA DSRA+ G Y
Sbjct  45   IPSFEIPRVPDPTNFLRMHTDDRNDPSCRIKIQHGTTTLAFRFQGGIIVAVDSRATAGSY  104

Query  315  ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLAN  494
            I+S +VKK+IEIN Y+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N
Sbjct  105  IASGTVKKVIEINKYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSN  164

Query  495  ILYSYRGMGLS  527
            ++Y Y+GMGLS
Sbjct  165  LVYGYKGMGLS  175



>ref|XP_009541838.1| subunit beta type peptidase T1A, 20S proteasome [Heterobasidion 
irregulare TC 32-1]
 gb|ETW85983.1| subunit beta type peptidase T1A, 20S proteasome [Heterobasidion 
irregulare TC 32-1]
Length=313

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 95/129 (74%), Gaps = 7/129 (5%)
 Frame = +3

Query  162  SFQIPNITDFDGF-------QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYIS  320
            SF +P++ D   F         D    +K   GTTTLAF F+ GV+VA DSRA+ G Y++
Sbjct  50   SFDVPSVADPAAFLRLHTDDHADPNCRIKIQHGTTTLAFRFQGGVIVAVDSRATAGSYVA  109

Query  321  SQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANIL  500
            S +VKK+IEINPY+LGTMAGGAADCQ+W   LG++CRLHEL N+ RISVA ASK L+N++
Sbjct  110  SGTVKKVIEINPYLLGTMAGGAADCQYWETYLGIQCRLHELRNRERISVAAASKYLSNLV  169

Query  501  YSYRGMGLS  527
            YSY+GMGLS
Sbjct  170  YSYKGMGLS  178



>gb|ACP43316.1| 20S proteasome beta subunit 5 [Citrus maxima]
Length=194

 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/73 (97%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = +3

Query  309  GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLL  488
            GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLG+KCRLHELANKRRISV GASKLL
Sbjct  1    GYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLL  60

Query  489  ANILYSYRGMGLS  527
            ANILYSYRGMGLS
Sbjct  61   ANILYSYRGMGLS  73



>ref|XP_007821942.1| hypothetical protein MAA_05753 [Metarhizium robertsii ARSEF 23]
 gb|EFY98614.1| hypothetical protein MAA_05753 [Metarhizium robertsii ARSEF 23]
 gb|EXV04235.1| proteasome subunit [Metarhizium robertsii]
 gb|KFG81833.1| proteasome component PRE2 precursor [Metarhizium anisopliae]
 gb|KID68564.1| Proteasome B-type subunit, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID80098.1| hypothetical protein MBR_01410, partial [Metarhizium brunneum 
ARSEF 3297]
 gb|KID91131.1| hypothetical protein MGU_02085 [Metarhizium guizhouense ARSEF 
977]
 gb|KIE00047.1| Proteasome B-type subunit, partial [Metarhizium majus ARSEF 297]
Length=283

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = +3

Query  99   ESTAPIRGESSELFDEIPRVPS-FQIPNITDFDGFQKDAIQ-------MVKPAKGTTTLA  254
            E   P   E+ E+ D    + + F +P I+    + + A          +K A GTTTLA
Sbjct  14   EQNEPFENEAQEMMDATSSLTTKFAMPPISQPSSWLRAATDDRSNPDCPIKIAHGTTTLA  73

Query  255  FIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRL  434
            F F+ G++VA DSRA+ G +I+SQ+VKK+IEIN  +LGTMAGGAADCQ+W   LG++CRL
Sbjct  74   FRFQGGIIVATDSRATAGNWIASQTVKKVIEINSVLLGTMAGGAADCQYWLAWLGMQCRL  133

Query  435  HELANKRRISVAGASKLLANILYSYRGMGLS  527
            HEL +KRRISVA ASK+LAN++YSY+GMGLS
Sbjct  134  HELRHKRRISVAAASKILANLVYSYKGMGLS  164



>ref|XP_007100517.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Physeter 
catodon]
Length=263

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 4/137 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGFQKDA-IQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +  I    G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLIAPSWGVPEEPRIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN++Y Y+GMGLS
Sbjct  139  SKLLANMVYQYKGMGLS  155



>gb|EWM22648.1| proteasome subunit beta type 5 [Nannochloropsis gaditana]
Length=278

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +3

Query  195  GFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM  374
            G+  D  Q +K AKGTTTLAF F  G++VA DSR++ G Y++S +VKK+IEINPY+LGTM
Sbjct  55   GYGTDQHQELKFAKGTTTLAFKFDGGIVVAVDSRSTQGAYVASGTVKKVIEINPYLLGTM  114

Query  375  AGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            AGGAADC FW RNLG++CRL+EL +K RISVA ASKLLAN +  YRG GLS
Sbjct  115  AGGAADCSFWERNLGIQCRLYELRHKERISVAAASKLLANTVMQYRGYGLS  165



>gb|KIV81807.1| proteasome subunit beta type-5 [Exophiala sideris]
Length=283

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +3

Query  222  VKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQF  401
            +K A GTTTLAF FK G++VA DSRA+ G +I+SQ+VKK+IEINP +LGTMAGGAADCQ+
Sbjct  63   IKIAHGTTTLAFRFKGGIIVATDSRATAGNWIASQTVKKVIEINPMLLGTMAGGAADCQY  122

Query  402  WHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGMGLS  527
            W   LGV+CRLHEL +KRRISVA ASK+L+N++YSY+GMGLS
Sbjct  123  WLAYLGVQCRLHELRHKRRISVAAASKILSNLVYSYKGMGLS  164



>ref|XP_004755395.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Mustela 
putorius furo]
 ref|XP_004801214.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Mustela 
putorius furo]
Length=204

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 101/140 (72%), Gaps = 10/140 (7%)
 Frame = +3

Query  120  GESSELFDEIPRVPS----FQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAA  287
            G  ++L D  P  PS       PN   +   ++  I+M+    GTTTLAF F+ GV+VAA
Sbjct  22   GGRADLLDLGPGSPSDGLTLAAPN---WGVAEEPRIEMLH---GTTTLAFKFQHGVIVAA  75

Query  288  DSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISV  467
            DSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV
Sbjct  76   DSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISV  135

Query  468  AGASKLLANILYSYRGMGLS  527
            A ASKLLAN++Y Y+GMGLS
Sbjct  136  AAASKLLANMVYQYKGMGLS  155



>ref|XP_005267928.1| PREDICTED: proteasome subunit beta type-5 isoform X1 [Homo sapiens]
Length=169

 Score =   152 bits (384),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 11/123 (9%)
 Frame = +3

Query  159  PSFQIPNITDFDGFQKDAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKK  338
            P + +P        ++  I+M+    GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK
Sbjct  44   PGWGVP--------EEPGIEMLH---GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKK  92

Query  339  IIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGASKLLANILYSYRGM  518
            +IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA ASKLLAN++Y Y+GM
Sbjct  93   VIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGM  152

Query  519  GLS  527
            GLS
Sbjct  153  GLS  155



>ref|XP_007989006.1| PREDICTED: proteasome subunit beta type-5 isoform X3 [Chlorocebus 
sabaeus]
Length=197

 Score =   153 bits (386),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 100/137 (73%), Gaps = 4/137 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +       G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGSPSDGLSLAAPGWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN++Y Y+GMGLS
Sbjct  139  SKLLANMVYQYKGMGLS  155



>ref|XP_008065987.1| PREDICTED: proteasome subunit beta type-5 [Tarsius syrichta]
Length=263

 Score =   155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 4/137 (3%)
 Frame = +3

Query  120  GESSELFDEIPRVPSFQIPNITDFDGF-QKDAIQMVKPAKGTTTLAFIFKEGVMVAADSR  296
            G  ++L D  P  PS  +   T   G  ++  I+M+    GTTTLAF F+ GV+VAADSR
Sbjct  22   GGRADLLDLGPGNPSDGLSLATPSWGVPEEPGIEMLH---GTTTLAFKFRHGVIVAADSR  78

Query  297  ASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGVKCRLHELANKRRISVAGA  476
            A+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISVA A
Sbjct  79   ATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAA  138

Query  477  SKLLANILYSYRGMGLS  527
            SKLLAN++Y Y+GMGLS
Sbjct  139  SKLLANMVYQYKGMGLS  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600