BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005G05

Length=472
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP29212.1|  hypothetical protein JCGZ_16601                         206   4e-62   Jatropha curcas
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      207   4e-62   Cucumis melo [Oriental melon]
ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      206   7e-62   Fragaria vesca subsp. vesca
gb|KJB62321.1|  hypothetical protein B456_009G411600                    198   3e-60   Gossypium raimondii
gb|KJB62324.1|  hypothetical protein B456_009G411600                    199   3e-60   Gossypium raimondii
gb|KJB62322.1|  hypothetical protein B456_009G411600                    198   6e-60   Gossypium raimondii
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       200   2e-59   Cucumis sativus [cucumbers]
gb|KJB62323.1|  hypothetical protein B456_009G411600                    199   3e-59   Gossypium raimondii
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    200   4e-59   
gb|KJB62320.1|  hypothetical protein B456_009G411600                    199   5e-59   Gossypium raimondii
ref|XP_007027514.1|  O-methyltransferase family protein                 198   6e-59   
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      198   7e-59   Gossypium arboreum [tree cotton]
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    196   2e-58   Cicer arietinum [garbanzo]
ref|XP_006594705.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    194   4e-58   Glycine max [soybeans]
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    196   4e-58   Sesamum indicum [beniseed]
gb|AFK33955.1|  unknown                                                 191   6e-58   Medicago truncatula
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    194   1e-57   
ref|XP_008361606.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    192   1e-57   
gb|KEH38506.1|  caffeic acid O-methyltransferase                        194   1e-57   Medicago truncatula
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    194   4e-57   Pyrus x bretschneideri [bai li]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             193   7e-57   Prunus persica
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    192   1e-56   Solanum tuberosum [potatoes]
ref|XP_006428524.1|  hypothetical protein CICLE_v10013655mg             187   6e-56   
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    190   9e-56   Solanum tuberosum [potatoes]
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      190   1e-55   Prunus mume [ume]
ref|XP_008361604.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    187   2e-55   
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             189   2e-55   Phaseolus vulgaris [French bean]
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    189   3e-55   Glycine max [soybeans]
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    188   5e-55   Pyrus x bretschneideri [bai li]
ref|XP_006381360.1|  hypothetical protein POPTR_0006s12160g             185   6e-55   
emb|CAN65776.1|  hypothetical protein VITISV_030414                     186   2e-54   Vitis vinifera
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      186   2e-54   Populus euphratica
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      186   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    186   3e-54   Eucalyptus grandis [rose gum]
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      186   3e-54   Vitis vinifera
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             185   6e-54   Capsella rubella
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             185   9e-54   
ref|XP_002519426.1|  o-methyltransferase, putative                      184   1e-53   Ricinus communis
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    185   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    184   2e-53   Solanum lycopersicum
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    184   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    184   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             184   3e-53   Eutrema salsugineum [saltwater cress]
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             183   5e-53   Eutrema salsugineum [saltwater cress]
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        181   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_010271244.1|  PREDICTED: uncharacterized protein LOC104607...    177   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010271241.1|  PREDICTED: uncharacterized protein LOC104607...    177   4e-52   Nelumbo nucifera [Indian lotus]
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              179   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        177   6e-51   Nicotiana tomentosiformis
emb|CDX76223.1|  BnaA04g04870D                                          174   2e-50   
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 176   4e-50   Morus notabilis
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    174   9e-50   Arabis alpina [alpine rockcress]
ref|XP_009774776.1|  PREDICTED: caffeic acid 3-O-methyltransferase      171   2e-49   Nicotiana sylvestris
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      173   2e-49   Brassica rapa
emb|CDX95399.1|  BnaC04g27590D                                          172   6e-49   
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    172   8e-49   Sesamum indicum [beniseed]
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    172   1e-48   Cicer arietinum [garbanzo]
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    167   5e-47   
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 164   1e-45   
gb|AAP03054.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    156   1e-44   Limonium latifolium
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        157   4e-43   Medicago sativa subsp. x varia
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      156   6e-43   Glycine soja [wild soybean]
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    155   2e-42   Limonium latifolium
gb|AFK47565.1|  unknown                                                 149   3e-41   Medicago truncatula
ref|XP_003602596.1|  Caffeic acid 3-O-methyltransferase                 149   7e-41   
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 149   7e-40   Medicago truncatula
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      146   7e-39   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ96291.1|  predicted protein                                      137   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010935842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    135   7e-35   
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    135   2e-34   Elaeis guineensis
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    133   4e-34   Setaria italica
ref|XP_011101495.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    127   5e-34   
gb|AAP03053.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    129   6e-34   Limonium latifolium
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      132   1e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|AGW45465.1|  beta-alanine n-methyltransferase                        127   4e-33   Reaumuria trigyna
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   129   6e-33   Citrus sinensis [apfelsine]
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          130   8e-33   Sorghum bicolor [broomcorn]
gb|ACN25427.1|  unknown                                                 130   1e-32   Zea mays [maize]
ref|NP_001149617.1|  LOC100283243                                       129   1e-32   
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             128   1e-32   
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   128   1e-32   Citrus sinensis [apfelsine]
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             125   1e-31   
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             125   1e-31   Citrus clementina [clementine]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    125   2e-31   Citrus sinensis [apfelsine]
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      126   2e-31   Brachypodium distachyon [annual false brome]
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    123   5e-31   
gb|EEC74273.1|  hypothetical protein OsI_09508                          121   8e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001048569.1|  Os02g0823400                                       121   1e-29   
gb|AES72848.2|  caffeic acid O-methyltransferase                        113   1e-26   Medicago truncatula
ref|XP_010243879.1|  PREDICTED: uncharacterized protein LOC104587837    108   1e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010275846.1|  PREDICTED: uncharacterized protein LOC104610771    104   6e-24   
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410        91.3    6e-19   Amborella trichopoda
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg           89.4    6e-19   
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                   90.5    8e-19   Eucalyptus grandis [rose gum]
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase    87.4    9e-18   
gb|KDO38695.1|  hypothetical protein CISIN_1g037818mg                 86.3    1e-17   Citrus sinensis [apfelsine]
ref|XP_002986521.1|  hypothetical protein SELMODRAFT_124205           85.1    4e-17   
ref|XP_002986612.1|  hypothetical protein SELMODRAFT_124122           85.1    4e-17   
ref|XP_002965284.1|  hypothetical protein SELMODRAFT_83100            84.7    7e-17   
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg           85.1    7e-17   
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...  84.3    2e-16   Selaginella moellendorffii
ref|XP_002963872.1|  caffeic acid O-methyltransferase                 82.0    1e-15   Selaginella moellendorffii
ref|XP_002988275.1|  caffeic acid O-methyltransferase                 82.0    1e-15   Selaginella moellendorffii
gb|KDO39478.1|  hypothetical protein CISIN_1g036218mg                 76.6    4e-15   Citrus sinensis [apfelsine]
ref|XP_002962074.1|  hypothetical protein SELMODRAFT_76630            80.5    6e-15   
ref|XP_002971011.1|  hypothetical protein SELMODRAFT_94918            80.5    7e-15   
gb|KHF97637.1|  Caffeic acid 3-O-methyltransferase                    78.2    2e-14   Gossypium arboreum [tree cotton]
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  76.6    8e-14   
gb|KJB16304.1|  hypothetical protein B456_002G222400                  77.0    1e-13   Gossypium raimondii
gb|KHF97352.1|  Caffeic acid 3-O-methyltransferase                    74.3    3e-13   Gossypium arboreum [tree cotton]
gb|ABO41840.1|  putative caffeic acid methyltransferase               74.7    6e-13   Gossypium arboreum [tree cotton]
gb|ABO41846.1|  putative caffeic acid methyltransferase               74.3    7e-13   Gossypium hirsutum [American cotton]
gb|ABO41845.1|  putative caffeic acid methyltransferase               74.3    8e-13   Gossypium hirsutum [American cotton]
gb|ABO41834.1|  putative caffeic acid methyltransferase               73.9    1e-12   Gossypium raimondii
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                   72.8    2e-12   Eucalyptus grandis [rose gum]
gb|ACD56610.1|  putative caffeic acid protein                         72.8    3e-12   Gossypioides kirkii
gb|AFM73596.1|  caffeate O-methyltransferase                          71.6    4e-12   Populus simonii
gb|AFK39562.1|  unknown                                               72.0    6e-12   Lotus japonicus
gb|AET00984.2|  caffeic acid O-methyltransferase                      71.6    8e-12   Medicago truncatula
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase               71.6    8e-12   
gb|AFK40372.1|  unknown                                               71.6    9e-12   Lotus japonicus
gb|AFK41218.1|  unknown                                               71.6    9e-12   Medicago truncatula
gb|KDO40925.1|  hypothetical protein CISIN_1g0357381mg                69.7    1e-11   Citrus sinensis [apfelsine]
ref|XP_006431772.1|  hypothetical protein CICLE_v10001661mg           71.2    1e-11   Citrus clementina [clementine]
gb|KDO44005.1|  hypothetical protein CISIN_1g018576mg                 70.9    1e-11   Citrus sinensis [apfelsine]
gb|AFK45226.1|  unknown                                               70.9    2e-11   Lotus japonicus
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                   70.9    2e-11   Rosa chinensis var. spontanea
gb|ABO41852.1|  putative caffeic acid methyltransferase               70.5    2e-11   Gossypium hirsutum [American cotton]
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...  70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAB96879.1|  O-methyltransferase 1                                 70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  70.1    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg           70.1    3e-11   Capsella rubella
ref|XP_002864309.1|  O-methyltransferase 1                            70.1    3e-11   
dbj|BAD83867.1|  Caffeic acid O-methyltransferase                     70.1    3e-11   Iris x hollandica [Dutch iris]
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  70.1    4e-11   
dbj|BAD87408.1|  O-diphenol-O-methyl transferase-like                 65.9    7e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g           68.9    7e-11   Phaseolus vulgaris [French bean]
ref|XP_010069184.1|  PREDICTED: uncharacterized protein LOC104456144  66.6    7e-11   Eucalyptus grandis [rose gum]
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                    68.9    8e-11   Populus deltoides
prf||1906376A  O-methyltransferase                                    68.9    8e-11
ref|XP_002525818.1|  o-methyltransferase, putative                    68.9    8e-11   Ricinus communis
gb|AAF60951.1|  O-methyltransferase                                   68.6    9e-11   Populus trichocarpa x Populus deltoides
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.2    1e-10   
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg           68.2    1e-10   Eutrema salsugineum [saltwater cress]
dbj|BAJ34520.1|  unnamed protein product                              68.2    1e-10   Eutrema halophilum
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg           68.2    1e-10   Citrus clementina [clementine]
ref|XP_006478225.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  66.6    2e-10   
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                 66.6    2e-10   Citrus sinensis [apfelsine]
gb|AEV93478.1|  caffeic acid O-methyltransferase                      67.8    2e-10   Caragana korshinskii
gb|KDP36008.1|  hypothetical protein JCGZ_10407                       67.8    2e-10   Jatropha curcas
ref|XP_006478224.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  66.2    2e-10   
gb|ACN41351.2|  putative caffeic acid O-methyltransferase             67.8    2e-10   Betula pendula [white birch]
ref|XP_006401618.1|  hypothetical protein EUTSA_v10013896mg           67.8    2e-10   Eutrema salsugineum [saltwater cress]
gb|AAV36348.1|  caffeate O-methyltransferase                          65.5    2e-10   Pinus taeda
ref|XP_002320237.1|  eugenol O-methyltransferase family protein       67.4    2e-10   
gb|EPS67212.1|  hypothetical protein M569_07558                       67.4    2e-10   Genlisea aurea
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  67.4    3e-10   Citrus sinensis [apfelsine]
prf||2119166A  caffeic acid O-methyltransferase                       67.4    3e-10
emb|CDX78145.1|  BnaA09g33400D                                        68.2    3e-10   
gb|AFZ78575.1|  caffeic acid O-methyltransferase                      67.4    3e-10   Populus tomentosa [Chinese white poplar]
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  67.0    3e-10   Populus euphratica
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...  67.0    3e-10   Populus tremuloides
ref|XP_006478243.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.5    3e-10   
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                    67.0    3e-10   Populus tomentosa [Chinese white poplar]
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  67.0    4e-10   Populus sieboldii x Populus grandidentata
ref|XP_002317838.1|  Chain A family protein                           67.0    4e-10   Populus trichocarpa [western balsam poplar]
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                    67.0    4e-10   Betula platyphylla [Asian white birch]
dbj|BAK42963.1|  caffeic acid O-methylltransferase                    66.6    4e-10   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011039447.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  66.6    4e-10   Populus euphratica
gb|KDP28404.1|  hypothetical protein JCGZ_14175                       66.6    6e-10   Jatropha curcas
ref|NP_001242325.1|  uncharacterized protein LOC100805999             66.2    6e-10   
gb|AHY28755.1|  caffeate O-methyltransferase                          64.3    6e-10   Pinus palustris [longleaf pine]
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                    66.2    6e-10   Glycine soja [wild soybean]
gb|AAV36304.1|  caffeate O-methyltransferase                          64.3    6e-10   Pinus taeda
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg           66.2    7e-10   Prunus persica
gb|KDP24164.1|  hypothetical protein JCGZ_25821                       65.9    7e-10   Jatropha curcas
gb|ABI54119.1|  caffeic acid O-methyltransferase                      66.2    7e-10   Malus domestica [apple tree]
ref|XP_008219627.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  65.9    8e-10   
gb|AHM25237.1|  noraucuparin O-methyltransferase                      65.9    9e-10   Sorbus aucuparia [European mountain ash]
gb|KDO44721.1|  hypothetical protein CISIN_1g036188mg                 63.9    9e-10   Citrus sinensis [apfelsine]
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.9    1e-09   Glycine max [soybeans]
gb|EAY75657.1|  hypothetical protein OsI_03563                        62.0    1e-09   Oryza sativa Indica Group [Indian rice]
gb|AAV36308.1|  caffeate O-methyltransferase                          63.5    1e-09   Pinus taeda
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                    65.5    1e-09   Gossypium arboreum [tree cotton]
gb|AAV36346.1|  caffeate O-methyltransferase                          63.5    1e-09   Pinus taeda
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...  65.5    1e-09   Ginkgo biloba [ginkgo]
gb|AHA44835.1|  caffeate O-methyltransferase                          65.5    1e-09   Larix kaempferi [karamatsu]
gb|AAV36354.1|  caffeate O-methyltransferase                          63.5    1e-09   Pinus taeda
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  65.5    1e-09   Medicago sativa [alfalfa]
gb|ABR18380.1|  unknown                                               65.5    1e-09   Picea sitchensis
ref|XP_008347322.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.8    1e-09   
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  65.1    1e-09   Brassica rapa
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                    65.5    1e-09   Gossypium hirsutum [American cotton]
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1      65.1    1e-09   Tarenaya hassleriana [spider flower]
gb|ADP00412.1|  putative methyltransferase                            65.1    1e-09   Catharanthus roseus [chatas]
gb|AGR85824.1|  caffeic acid O-methyltransferase                      64.7    1e-09   Hibiscus cannabinus [bimli-jute]
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  65.1    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIJ28474.1|  O-methyltransferase                                   65.1    1e-09   Vaccinium corymbosum [American blueberry]
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  65.1    2e-09   Phoenix dactylifera
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...  65.1    2e-09   Catharanthus roseus [chatas]
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  65.1    2e-09   Cicer arietinum [garbanzo]
ref|NP_001240003.1|  uncharacterized protein LOC100780100             65.1    2e-09   Glycine max [soybeans]
ref|XP_008364894.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.4    2e-09   
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                   64.7    2e-09   Pinus pinaster [cluster pine]
ref|XP_010103059.1|  Caffeic acid 3-O-methyltransferase               63.5    2e-09   
gb|KDP30064.1|  hypothetical protein JCGZ_18389                       64.7    2e-09   Jatropha curcas
gb|AFD61598.1|  caffeic acid 3-O-methyltransferase                    64.7    2e-09   Hevea brasiliensis [jebe]
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.7    2e-09   Eucalyptus grandis [rose gum]
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg           64.7    2e-09   Citrus clementina [clementine]
gb|KDP35860.1|  hypothetical protein JCGZ_10599                       64.7    2e-09   Jatropha curcas
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                64.7    2e-09   Thalictrum tuberosum
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.7    2e-09   Citrus sinensis [apfelsine]
emb|CAI30878.1|  caffeate O-methyltransferase                         64.7    2e-09   Picea abies
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase               64.7    2e-09   Pyrus x bretschneideri [bai li]
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                  64.7    3e-09   Arabis alpina [alpine rockcress]
gb|ACT87981.1|  caffeic acid O-methyltransferase                      64.3    3e-09   Jatropha curcas
ref|XP_011084578.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.0    3e-09   Sesamum indicum [beniseed]
ref|XP_011025357.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  64.3    3e-09   Populus euphratica
gb|AAD29845.1|AF064697_1  O-methyltransferase                         64.3    3e-09   Thalictrum tuberosum
gb|ABK22490.1|  unknown                                               64.3    3e-09   Picea sitchensis
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg           64.3    3e-09   Citrus clementina [clementine]
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase    64.3    3e-09   Prunus mume [ume]
ref|XP_007032646.1|  Caffeic acid 3-O-methyltransferase 1             64.3    3e-09   
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...  64.3    3e-09   Eucalyptus gunnii
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                 64.3    3e-09   Citrus sinensis [apfelsine]
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...  64.3    3e-09   Medicago sativa [alfalfa]
ref|XP_009352092.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.2    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_006401615.1|  hypothetical protein EUTSA_v10013908mg           64.3    3e-09   
gb|KHN23295.1|  Caffeic acid 3-O-methyltransferase                    64.3    3e-09   Glycine soja [wild soybean]
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  64.3    3e-09   Elaeis guineensis
gb|AAF28353.1|AF220491_1  O-methyltransferase                         64.3    3e-09   Fragaria x ananassa
ref|XP_006436417.1|  hypothetical protein CICLE_v10031953mg           63.2    3e-09   
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  64.3    3e-09   Phoenix dactylifera
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase             64.3    3e-09   Hibiscus cannabinus [bimli-jute]
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                64.3    3e-09   Thalictrum tuberosum
ref|XP_002864307.1|  O-methyltransferase 1                            63.9    4e-09   Arabidopsis lyrata subsp. lyrata
gb|KJB23956.1|  hypothetical protein B456_004G125600                  62.8    4e-09   Gossypium raimondii
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase    63.9    4e-09   Beta vulgaris subsp. vulgaris [field beet]
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...  63.9    4e-09   Rosa chinensis [China rose]
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.9    4e-09   Glycine max [soybeans]
gb|EEC84528.1|  hypothetical protein OsI_31257                        64.7    4e-09   Oryza sativa Indica Group [Indian rice]
gb|AFK39235.1|  unknown                                               63.9    4e-09   Medicago truncatula
dbj|BAC78827.1|  caffeic acid O-methyltransferase                     63.9    4e-09   Rosa chinensis var. spontanea
ref|XP_006425206.1|  hypothetical protein CICLE_v100108602mg          61.2    4e-09   
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                    63.9    4e-09   Gossypium hirsutum [American cotton]
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                 63.9    4e-09   Medicago truncatula
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                    63.9    4e-09   Gossypium arboreum [tree cotton]
gb|KJB23955.1|  hypothetical protein B456_004G125600                  62.8    5e-09   Gossypium raimondii
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.9    5e-09   
ref|XP_002302676.2|  eugenol O-methyltransferase family protein       63.5    5e-09   
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    5e-09   Malus domestica [apple tree]
gb|ABK23795.1|  unknown                                               63.5    5e-09   Picea sitchensis
gb|ABK25932.1|  unknown                                               63.5    5e-09   Picea sitchensis
gb|AHY28752.1|  caffeate O-methyltransferase                          63.5    5e-09   Pinus echinata [shortleaf pine]
gb|ADB82906.1|  caffeic O-methyltransferase1                          63.5    5e-09   Eucalyptus camaldulensis
ref|XP_006436320.1|  hypothetical protein CICLE_v10031951mg           62.4    5e-09   
gb|ACY66932.1|  caffeic O-methyltransferase 1                         63.5    5e-09   Eucalyptus camaldulensis
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1             63.5    5e-09   
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase    63.5    5e-09   Eucalyptus grandis [rose gum]
gb|ABK21417.1|  unknown                                               63.5    5e-09   Picea sitchensis
ref|XP_006485684.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  63.5    5e-09   
ref|XP_006436416.1|  hypothetical protein CICLE_v10031953mg           63.5    5e-09   Citrus clementina [clementine]
gb|AAD29843.1|AF064695_1  catechol O-methyltransferase                63.5    6e-09   Thalictrum tuberosum
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...  63.5    6e-09   
ref|XP_006495276.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.0    6e-09   
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg           63.5    6e-09   Citrus clementina [clementine]
gb|KJB23957.1|  hypothetical protein B456_004G125600                  62.8    6e-09   Gossypium raimondii
gb|KJB52493.1|  hypothetical protein B456_008G264900                  62.4    6e-09   Gossypium raimondii
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                63.2    6e-09   Thalictrum tuberosum
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase       63.2    6e-09   Anthriscus sylvestris
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                   63.5    6e-09   Eucalyptus grandis [rose gum]
emb|CDY43839.1|  BnaC03g14720D                                        63.2    7e-09   Brassica napus [oilseed rape]
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1      63.2    7e-09   Brassica rapa
gb|AHY28754.1|  caffeate O-methyltransferase                          63.2    7e-09   Pinus elliottii [American pitch pine]
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  63.2    8e-09   Glycine max [soybeans]
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1             63.2    8e-09   
gb|ACO90249.1|  scoulerine 9-O-methyltransferase                      61.2    8e-09   Thalictrum flavum [yellow meadow-rue]
gb|AHY28757.1|  caffeate O-methyltransferase                          62.8    9e-09   Pinus taeda
dbj|BAO79382.1|  hypothetical plant O-methyltransferase               62.8    9e-09   Anthriscus sylvestris
ref|XP_004509701.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.8    9e-09   
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...  62.8    9e-09   
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.8    9e-09   
gb|KDP37670.1|  hypothetical protein JCGZ_06898                       62.8    9e-09   
gb|AAY86361.1|  caffeic acid O-methyltransferase                      62.8    9e-09   
ref|XP_002515087.1|  o-methyltransferase, putative                    62.8    9e-09   
ref|XP_008362805.1|  PREDICTED: caffeic acid 3-O-methyltransferase    62.8    1e-08   
ref|XP_006386660.1|  hypothetical protein POPTR_0002s18130g           62.8    1e-08   
ref|XP_006386659.1|  hypothetical protein POPTR_0002s18120g           62.8    1e-08   
gb|KJB23954.1|  hypothetical protein B456_004G125600                  62.8    1e-08   
gb|AAS64572.1|  caffeic acid O-methyltransferase                      62.8    1e-08   
gb|ABK23414.1|  unknown                                               62.8    1e-08   
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase    62.8    1e-08   
gb|ABG27066.1|  caffeic acid O-methyltransferase                      62.8    1e-08   
gb|ABR18103.1|  unknown                                               62.8    1e-08   
gb|AFR39730.1|  caffeate O-methyltransferase                          59.7    1e-08   
gb|AFR39750.1|  caffeate O-methyltransferase                          59.7    1e-08   
gb|AFR39749.1|  caffeate O-methyltransferase                          59.7    1e-08   
ref|XP_006434355.1|  hypothetical protein CICLE_v10003445mg           60.5    1e-08   
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase    62.4    1e-08   
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                   62.4    1e-08   
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  62.4    1e-08   
ref|XP_006436319.1|  hypothetical protein CICLE_v10031951mg           62.4    1e-08   
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                   62.4    1e-08   
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  62.4    1e-08   
ref|XP_009386768.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-08   
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase    62.4    1e-08   
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...  62.4    2e-08   
ref|XP_007015113.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1   62.4    2e-08   
gb|AET34455.1|  putative S-adenosyl-L-methionine: flavonoid O-met...  61.2    2e-08   
ref|XP_007015114.1|  Caffeic acid 3-O-methyltransferase 1 isoform 2   62.4    2e-08   
gb|KDP32877.1|  hypothetical protein JCGZ_12169                       62.0    2e-08   
ref|XP_006436317.1|  hypothetical protein CICLE_v10031952mg           61.2    2e-08   
gb|AEQ59236.1|  putative S-adenosyl-L-methionine:flavonoid O-meth...  61.6    2e-08   
gb|KJB52492.1|  hypothetical protein B456_008G264900                  62.0    2e-08   
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  62.0    2e-08   
ref|XP_006441607.1|  hypothetical protein CICLE_v10020880mg           62.0    2e-08   
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  62.0    2e-08   
ref|XP_006441606.1|  hypothetical protein CICLE_v10023994mg           61.6    2e-08   
ref|XP_006494834.1|  PREDICTED: anthranilate N-methyltransferase-...  61.6    2e-08   
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1      61.6    2e-08   
ref|XP_003626615.1|  Caffeic acid 3-O-methyltransferase               60.5    2e-08   
ref|XP_006436316.1|  hypothetical protein CICLE_v10031952mg           61.2    3e-08   
ref|XP_006494578.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.2    3e-08   
gb|AFO69477.1|  caffeic acid O-methyltransferase                      61.2    3e-08   
gb|AAO43609.1|  caffeic acid O-methyltransferase                      61.2    3e-08   
ref|XP_010107139.1|  Caffeic acid 3-O-methyltransferase               61.2    3e-08   
ref|XP_006441605.1|  hypothetical protein CICLE_v10024367mg           58.9    3e-08   
gb|EYU19261.1|  hypothetical protein MIMGU_mgv1a026228mg              60.1    3e-08   
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.2    3e-08   
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  61.2    3e-08   
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...  61.2    3e-08   
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  61.2    3e-08   
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  61.2    4e-08   
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase    61.2    4e-08   
gb|AFR39721.1|  caffeate O-methyltransferase                          58.2    4e-08   
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase            60.8    4e-08   
emb|CDP19753.1|  unnamed protein product                              60.8    4e-08   
gb|ABS57468.1|  caffeic acid O-methyl transferase                     60.8    4e-08   
gb|EYU35612.1|  hypothetical protein MIMGU_mgv1a021833mg              59.7    4e-08   
gb|KDO40748.1|  hypothetical protein CISIN_1g0470001mg                57.8    5e-08   
sp|Q43239.1|COMT1_ZINVI  RecName: Full=Caffeic acid 3-O-methyltra...  60.8    5e-08   
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like    60.8    5e-08   
ref|XP_002300513.1|  eugenol O-methyltransferase family protein       60.8    5e-08   
dbj|BAM05584.1|  caffeic acid O-methyltransferase 2                   60.5    5e-08   
gb|AFR39717.1|  caffeate O-methyltransferase                          57.8    5e-08   
gb|AAN03726.1|  caffeic acid O-methyltransferase                      60.5    5e-08   
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...  60.5    5e-08   
ref|XP_010107138.1|  Caffeic acid 3-O-methyltransferase               59.7    5e-08   
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.8    5e-08   
ref|XP_006436309.1|  hypothetical protein CICLE_v10031949mg           59.7    5e-08   
ref|XP_003626614.1|  Caffeic acid 3-O-methyltransferase               60.5    5e-08   
ref|XP_006436307.1|  hypothetical protein CICLE_v10031949mg           60.5    5e-08   
gb|AFK42771.1|  unknown                                               60.5    6e-08   
gb|ABP94018.1|  O-methyltransferase                                   60.5    6e-08   
ref|XP_006436308.1|  hypothetical protein CICLE_v10031949mg           60.5    6e-08   
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.5    7e-08   
gb|ACJ84924.1|  unknown                                               58.9    7e-08   
dbj|BAO31650.1|  O-methyltransferase                                  60.1    7e-08   
gb|AAU20770.1|  (S)-scoulerine 9-O-methyltransferase                  60.1    7e-08   
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250        60.1    7e-08   
ref|XP_006441263.1|  hypothetical protein CICLE_v100208142mg          58.9    7e-08   
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  60.1    8e-08   
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  60.1    8e-08   
ref|XP_010541235.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.3    8e-08   
ref|XP_010112212.1|  Caffeic acid 3-O-methyltransferase               60.1    8e-08   
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  60.1    8e-08   
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860        60.1    8e-08   
ref|XP_010267679.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.1    8e-08   
ref|XP_009386883.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  60.1    8e-08   
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  60.1    9e-08   
gb|AAL57301.1|AF387790_1  O-methyltransferase                         60.1    9e-08   
emb|CDY18306.1|  BnaC09g30560D                                        60.1    9e-08   
ref|XP_010107137.1|  Caffeic acid 3-O-methyltransferase               59.7    9e-08   
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
gb|AAZ32409.1|  S-methyltransferase                                   59.7    1e-07   
ref|XP_007143654.1|  hypothetical protein PHAVU_007G090100g           59.7    1e-07   
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
ref|XP_011038013.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.7    1e-07   
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  59.3    1e-07   
dbj|BAO31651.1|  O-methyltransferase                                  59.3    1e-07   
gb|KDP32878.1|  hypothetical protein JCGZ_12170                       59.7    1e-07   
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                    59.3    1e-07   
ref|XP_010534702.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.3    1e-07   
ref|XP_009418618.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  59.3    1e-07   
gb|AAQ01670.1|  catechol O-methyltransferase                          59.3    1e-07   
dbj|BAM05583.1|  caffeic acid O-methyltransferase 2                   58.9    2e-07   
ref|XP_010428832.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.3    2e-07   
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  59.3    2e-07   
ref|XP_002302677.1|  eugenol O-methyltransferase family protein       58.9    2e-07   
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...  58.9    2e-07   
dbj|BAM05582.1|  caffeic acid O-methyltransferase 2                   58.9    2e-07   
sp|A9X7L0.1|ANMT_RUTGR  RecName: Full=Anthranilate N-methyltransf...  58.9    2e-07   
ref|XP_010660322.1|  PREDICTED: caffeic acid 3-O-methyltransferase    58.9    2e-07   
ref|XP_010107135.1|  Caffeic acid 3-O-methyltransferase               58.9    2e-07   
gb|KJB26629.1|  hypothetical protein B456_004G251200                  58.9    2e-07   
gb|AGO50639.1|  caffeic acid O-methyltransferase                      58.9    2e-07   
ref|XP_010048410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.9    2e-07   
gb|AAD50440.1|AF168777_1  caffeic acid O-methyltransferase            58.5    2e-07   
gb|ADK97702.1|  putative caffeic acid O-methyltransferase             58.5    2e-07   
gb|ABI54118.1|  caffeic acid O-methyltransferase                      58.5    2e-07   
emb|CDX73580.1|  BnaC08g24230D                                        59.3    2e-07   
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.5    3e-07   
gb|AFK35470.1|  unknown                                               58.5    3e-07   
ref|XP_003626617.1|  Caffeic acid 3-O-methyltransferase               58.5    3e-07   
gb|AEO14870.1|  caffeic acid O-methyltransferase                      58.5    3e-07   
gb|AEO14871.1|  caffeic acid O-methyltransferase                      58.2    3e-07   
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg           58.2    3e-07   
ref|XP_004164570.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.2    3e-07   
ref|XP_008358297.1|  PREDICTED: anthranilate N-methyltransferase-...  58.2    3e-07   
ref|XP_004150934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  58.2    3e-07   
emb|CDP19755.1|  unnamed protein product                              58.2    3e-07   
gb|ABI54120.1|  caffeic acid O-methyltransferase                      58.2    4e-07   
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase    58.2    4e-07   
ref|XP_008348753.1|  PREDICTED: anthranilate N-methyltransferase-...  58.2    4e-07   
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase    58.2    4e-07   
gb|ADA61114.1|  caffeic acid o-methyltransferase                      57.8    4e-07   
emb|CAA52461.1|  catechol O-methyltransferase                         57.8    4e-07   
gb|AFX98069.1|  caffeic acid O-methyltransferase                      57.8    5e-07   
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                   57.8    5e-07   
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase    57.8    5e-07   
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  57.8    5e-07   
gb|AGS49216.1|  O-methyltransferase                                   57.8    5e-07   
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase    57.8    5e-07   
gb|ADN27527.1|  caffeic acid O-methyltransferase                      57.8    6e-07   
ref|XP_002321948.1|  Chain A family protein                           57.4    6e-07   
emb|CAA52462.1|  catechol O-methyltransferase                         57.4    6e-07   
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  57.4    6e-07   
ref|XP_010671879.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.4    6e-07   
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                  57.4    6e-07   
ref|XP_008352782.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.4    6e-07   
ref|XP_006413044.1|  hypothetical protein EUTSA_v10027501mg           57.4    6e-07   
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.4    7e-07   
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.4    7e-07   
sp|Q39522.1|SMT_COPJA  RecName: Full=(S)-scoulerine 9-O-methyltra...  57.4    7e-07   
ref|XP_002520291.1|  o-methyltransferase, putative                    57.4    7e-07   
ref|XP_011069564.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.0    8e-07   
gb|AAA80579.1|  3' flavonoid O-methyltransferase                      57.0    8e-07   
ref|XP_009395003.1|  PREDICTED: flavone O-methyltransferase 1-like    57.4    8e-07   
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                    57.0    9e-07   
ref|XP_007015116.1|  Caffeic acid 3-O-methyltransferase 1             57.0    9e-07   
gb|KHN06374.1|  Anthranilate N-methyltransferase                      57.0    9e-07   
gb|AGI97942.1|  caffeic acid O-methyltransferase-like protein         57.0    9e-07   
ref|XP_002268308.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.0    9e-07   
ref|XP_008353353.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  57.0    1e-06   
gb|ADO16247.1|  caffeic acid O-methyltransferase                      57.0    1e-06   
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  56.6    1e-06   
gb|KDO36328.1|  hypothetical protein CISIN_1g036971mg                 55.5    1e-06   
ref|XP_010230425.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  56.6    1e-06   
ref|XP_007139026.1|  hypothetical protein PHAVU_009G258700g           56.6    1e-06   
ref|XP_006428970.1|  hypothetical protein CICLE_v10013542mg           56.6    1e-06   
ref|XP_010539891.1|  PREDICTED: anthranilate N-methyltransferase-...  56.6    1e-06   
ref|XP_006493515.1|  PREDICTED: anthranilate N-methyltransferase-...  56.6    1e-06   
ref|XP_010261275.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-scouleri...  56.6    1e-06   
emb|CDY41780.1|  BnaC02g13760D                                        55.8    1e-06   
ref|XP_009343067.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  56.6    1e-06   
ref|XP_008244204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  56.6    1e-06   
ref|XP_009366585.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  56.6    1e-06   
ref|XP_009137685.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  56.6    1e-06   
ref|XP_007015118.1|  Caffeic acid 3-O-methyltransferase 1 isoform 2   55.8    1e-06   
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...  56.6    1e-06   
emb|CDP21556.1|  unnamed protein product                              55.8    1e-06   
ref|XP_007211258.1|  hypothetical protein PRUPE_ppa021447mg           56.2    1e-06   
ref|XP_009418619.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.1    1e-06   
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                     56.2    1e-06   
ref|XP_010247681.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  54.3    1e-06   
gb|AFZ78574.1|  caffeic acid O-methyltransferase                      56.2    1e-06   
ref|XP_001762717.1|  predicted protein                                56.2    2e-06   
ref|XP_007099684.1|  Caffeic acid 3-O-methyltransferase 1             56.2    2e-06   
ref|XP_011470872.1|  PREDICTED: caffeic acid 3-O-methyltransferase    56.2    2e-06   
ref|XP_010068758.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  56.2    2e-06   
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...  56.2    2e-06   
ref|XP_002520292.1|  o-methyltransferase, putative                    56.2    2e-06   
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                56.2    2e-06   
ref|XP_003528760.1|  PREDICTED: anthranilate N-methyltransferase      56.2    2e-06   
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3  56.2    2e-06   
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                    55.8    2e-06   
ref|XP_008364840.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.8    2e-06   
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                    55.8    2e-06   
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)            55.8    2e-06   
ref|XP_004509702.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.8    2e-06   
ref|XP_008367482.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.8    2e-06   
ref|XP_006472905.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.8    2e-06   
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  55.5    3e-06   
gb|KCW89065.1|  hypothetical protein EUGRSUZ_A01392                   55.1    3e-06   
ref|XP_006421071.1|  hypothetical protein CICLE_v10005251mg           55.5    3e-06   
sp|A8J6X1.1|BMT_GLELI  RecName: Full=Bergaptol O-methyltransferas...  55.5    3e-06   
ref|XP_007015117.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1   55.5    3e-06   
ref|XP_003634428.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.5    3e-06   
gb|ABR17930.1|  unknown                                               55.5    3e-06   
ref|XP_009419467.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.5    3e-06   
gb|EYU31467.1|  hypothetical protein MIMGU_mgv1a019670mg              55.5    3e-06   
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.5    3e-06   
ref|XP_004169230.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  54.7    3e-06   
ref|XP_009384375.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.5    3e-06   
gb|AAZ95246.1|  putative caffeic acid O-methyltransferase             55.5    3e-06   
ref|XP_006413045.1|  hypothetical protein EUTSA_v10025522mg           55.5    3e-06   
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  55.5    3e-06   
gb|AGS49199.1|  O-methyltransferase                                   55.1    4e-06   
ref|XP_008449019.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  54.7    4e-06   



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            SES N ARL I+ELANMISVPMSL A++RLNVAD IWQGG+NAPLSASEIL+ V PSGG 
Sbjct  8    SESRNRARLAILELANMISVPMSLNAIVRLNVADVIWQGGANAPLSASEILARVHPSGG-  66

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            D  NL+R+LRMLTSY +F EH+N+DA+ERRYS+ E+GKTLVTD +GLSY +YVLQHHQ A
Sbjct  67   DPENLQRILRMLTSYDVFTEHVNSDATERRYSLTEIGKTLVTDSEGLSYASYVLQHHQDA  126

Query  422  MMKAWPLVHEA  454
            +M+AWPLVHEA
Sbjct  127  LMRAWPLVHEA  137



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            SE  N ARL I+ELANMISVPMSL A++RLNVADAIWQ GSN+PLSASEIL+ V+PSGGG
Sbjct  21   SEIQNKARLAILELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGGG  80

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NLER+LRMLTSYG+F EH++ ++S  RYS+ +VGKTLVTD DGLSY  YVLQHHQ A
Sbjct  81   DAHNLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDTDGLSYAPYVLQHHQDA  140

Query  422  MMKAWPLVHEAG  457
            +M+AWP VHEA 
Sbjct  141  LMRAWPRVHEAA  152



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   206 bits (523),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +2

Query  65   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  244
            E+ N AR+ I+ELANMISVPMSL AV+RLNVADAIWQ GSN PLSAS+IL  VLP+G GD
Sbjct  9    EASNEARIAILELANMISVPMSLNAVVRLNVADAIWQKGSNTPLSASQILERVLPTGSGD  68

Query  245  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  424
            A NL+R+LRMLTSYG+F EH NAD SER++S+ EVG+TLVT++DGLSYG YVLQHHQ  +
Sbjct  69   AENLQRILRMLTSYGVFSEHFNADGSERKFSLTEVGQTLVTNQDGLSYGDYVLQHHQDVL  128

Query  425  MKAWPLVHEA  454
            M AWPLVHEA
Sbjct  129  MGAWPLVHEA  138



>gb|KJB62321.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=248

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 111/136 (82%), Gaps = 5/136 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  242  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVHEA
Sbjct  127  HHQDALMRAWPLVHEA  142



>gb|KJB62324.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=269

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 111/136 (82%), Gaps = 5/136 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  242  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVHEA
Sbjct  127  HHQDALMRAWPLVHEA  142



>gb|KJB62322.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=258

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 111/136 (82%), Gaps = 5/136 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  242  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVHEA
Sbjct  127  HHQDALMRAWPLVHEA  142



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            SE  N ARL I+ELANMISVPMSL A++RLNVADAIWQ GSN+PLSASEIL+ V+PSGG 
Sbjct  21   SEIQNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-  79

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NLER+LRMLTSYG+F EH++ ++S  RYS+ +VGKTLVTD DGLSY  YVLQHHQ A
Sbjct  80   DAHNLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDA  139

Query  422  MMKAWPLVHEAG  457
            +M+AWP VHEA 
Sbjct  140  LMRAWPRVHEAA  151



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 111/136 (82%), Gaps = 5/136 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  242  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVHEA
Sbjct  127  HHQDALMRAWPLVHEA  142



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            SE  N ARL I+ELANMISVPMSL A++RLNVADAIWQ GSN+PLSASEIL+ V+PSGG 
Sbjct  58   SEIQNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-  116

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NLER+LRMLTSYG+F EH++ ++S  RYS+ +VGKTLVTD DGLSY  YVLQHHQ A
Sbjct  117  DAHNLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDA  176

Query  422  MMKAWPLVHEAG  457
            +M+AWP VHEA 
Sbjct  177  LMRAWPRVHEAA  188



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 111/136 (82%), Gaps = 5/136 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  242  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVHEA
Sbjct  127  HHQDALMRAWPLVHEA  142



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   198 bits (503),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            ++S N ARL I+ELANM+SVPMSL AV+RLNV DAIWQGG+N PLSA++ILS VLPSGGG
Sbjct  6    ADSRNKARLAILELANMMSVPMSLNAVVRLNVPDAIWQGGANTPLSATQILSRVLPSGGG  65

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            D  NL+R+LRMLTSYG+F EH++++  ERR+S+ ++GKTLVTD DGLS   YVLQHHQ A
Sbjct  66   DPENLQRILRMLTSYGVFAEHLDSECPERRFSLTDIGKTLVTDADGLSCAPYVLQHHQDA  125

Query  422  MMKAWPLVHEA  454
            +M+ WPL+HEA
Sbjct  126  LMRVWPLMHEA  136



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   198 bits (504),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 111/136 (82%), Gaps = 5/136 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLSA +ILS VLP GGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSAVQILSRVLPYGGG  66

Query  242  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVHEA
Sbjct  127  HHQDALMRAWPLVHEA  142



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            ++S   ARL I+ELANMISVPMSL AV+RLNVADAIW+GGSNAPLSA +IL  VLP GGG
Sbjct  5    TDSRKQARLSILELANMISVPMSLNAVVRLNVADAIWEGGSNAPLSADQILKRVLPGGGG  64

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NL+R+LRMLTSY +F EH+     ER+YS+ +VGKTLVTD+ GLSYG+YVLQHHQ A
Sbjct  65   DAENLQRVLRMLTSYDVFEEHLG--GGERKYSLTDVGKTLVTDEQGLSYGSYVLQHHQDA  122

Query  422  MMKAWPLVHEA  454
            +M+AWPLVHEA
Sbjct  123  LMRAWPLVHEA  133



>ref|XP_006594705.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Glycine max]
Length=298

 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E    ARL IMELANMISVPM+L AV+RLNVADAIWQGG+N PLSA+EIL  +LP+GGG
Sbjct  7    TEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPAGGG  66

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NL+RLLRML SYG+F EH++  A ER+YS+ +VGKTLVTD+ GLSY  YVLQHHQ A
Sbjct  67   DAENLQRLLRMLASYGVFYEHLS--AGERKYSLTDVGKTLVTDEQGLSYAHYVLQHHQDA  124

Query  422  MMKAWPLVHEA  454
            +M+AWP+VHEA
Sbjct  125  LMRAWPMVHEA  135



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  235
            M +   N     IMELANMISVPM+L AV+RLNVADAIWQGGSN PLSA+EILS+     
Sbjct  1    MENSQTNSPTTAIMELANMISVPMALNAVVRLNVADAIWQGGSNNPLSAAEILSAAAVGP  60

Query  236  GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            GGDA NL+R+LR+LTS+G+F EH+NADA++RRYS+ EVGKTL TD++GLSYGAYVLQHHQ
Sbjct  61   GGDAENLQRILRLLTSFGVFEEHLNADATKRRYSLTEVGKTLATDENGLSYGAYVLQHHQ  120

Query  416  AAMMKAWPLVHEA  454
             A+M+AW LVHEA
Sbjct  121  DALMRAWTLVHEA  133



>gb|AFK33955.1| unknown [Medicago truncatula]
Length=201

 Score =   191 bits (484),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E+   ARL I+ELANMIS+PMSL AV+RLNVADAIW+GG+NAPLSA++IL+ V+P GGG
Sbjct  6    TEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVVPGGGG  65

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NL+R+LRML SYG+F EHI     ER+YS+  VGKTLV+D++G+SYGAYVLQ HQ A
Sbjct  66   DAENLQRVLRMLASYGVFEEHIG--DGERKYSLTNVGKTLVSDENGVSYGAYVLQLHQDA  123

Query  422  MMKAWPLVHEA  454
            +M+AWPLVHEA
Sbjct  124  LMRAWPLVHEA  134



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E    ARL IMELANMISVPM+L AV+RLNVADAIWQGG+N PLSA+EIL  +LP+GGG
Sbjct  7    TEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPAGGG  66

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NL+RLLRML SYG+F EH++  A ER+YS+ +VGKTLVTD+ GLSY  YVLQHHQ A
Sbjct  67   DAENLQRLLRMLASYGVFYEHLS--AGERKYSLTDVGKTLVTDEQGLSYAHYVLQHHQDA  124

Query  422  MMKAWPLVHEA  454
            +M+AWP+VHEA
Sbjct  125  LMRAWPMVHEA  135



>ref|XP_008361606.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Malus domestica]
Length=278

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 117/143 (82%), Gaps = 3/143 (2%)
 Frame = +2

Query  35   KLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEIL  214
            ++  + A  S S+N ARL I+ELANMISVPMSL AV+RLNV DAIWQGG N PLSAS++L
Sbjct  6    QVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLSASDVL  65

Query  215  SSVLPSGGGDAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLS  385
            + V+P+GGGDA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLS
Sbjct  66   ARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLS  125

Query  386  YGAYVLQHHQAAMMKAWPLVHEA  454
            YG YVLQHHQ  +M AWP+VHEA
Sbjct  126  YGPYVLQHHQDVLMGAWPMVHEA  148



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E+   ARL I+ELANMIS+PMSL AV+RLNVADAIW+GG+NAPLSA++IL+ V+P GGG
Sbjct  6    TEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVVPGGGG  65

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NL+R+LRML SYG+F EHI     ER+YS+  VGKTLV+D++G+SYGAYVLQHHQ A
Sbjct  66   DAENLQRVLRMLASYGVFEEHIG--DGERKYSLTNVGKTLVSDENGVSYGAYVLQHHQDA  123

Query  422  MMKAWPLVHEA  454
            +M+AWPLVHEA
Sbjct  124  LMRAWPLVHEA  134



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   194 bits (492),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 113/134 (84%), Gaps = 3/134 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            S S N ARL I+ELANMISVPMSL AV+RLNVADAIWQGG N PLSAS+IL+ VLP+GGG
Sbjct  16   SSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGGG  75

Query  242  DAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
            DA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLSYG YVLQHH
Sbjct  76   DAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHH  135

Query  413  QAAMMKAWPLVHEA  454
            Q  +M AWP+VHEA
Sbjct  136  QDVLMGAWPMVHEA  149



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   193 bits (491),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 5/144 (3%)
 Frame = +2

Query  38   LKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILS  217
            +  +     +  N ARL I+ELANMISVPMSL AV+RLNV DAIWQGGSN+PLSAS ILS
Sbjct  5    VSHVTTTAEQPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQGGSNSPLSASAILS  64

Query  218  SVLPSGGGDAPNLERLLRMLTSYGIFREH-INAD----ASERRYSVDEVGKTLVTDKDGL  382
             VLP GGGDA NL+R+LRMLTSYG+F EH ++AD    + +R++S+ E+GKTLVTD++GL
Sbjct  65   HVLPDGGGDAENLQRILRMLTSYGVFAEHLVSADDDGGSHQRKFSLTEIGKTLVTDQNGL  124

Query  383  SYGAYVLQHHQAAMMKAWPLVHEA  454
            SYG Y+LQHHQ  +M AWP+VHEA
Sbjct  125  SYGPYILQHHQDVLMGAWPMVHEA  148



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGGGDAPNL  256
            ARL IMELANMISVPMSL AV++L VADAIWQ GSNAPLS  EIL+ +  P GGGDA NL
Sbjct  15   ARLAIMELANMISVPMSLNAVVKLKVADAIWQNGSNAPLSPVEILAKIRGPQGGGDAENL  74

Query  257  ERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  436
            +R+LRMLTSYG+F+EH+  D+S+RRYS+ EVGKTLVTD++GLS+G+YVLQHHQ A+M+AW
Sbjct  75   QRILRMLTSYGVFKEHVVDDSSQRRYSLTEVGKTLVTDENGLSHGSYVLQHHQDALMRAW  134

Query  437  PLVHEA  454
             +VHEA
Sbjct  135  TMVHEA  140



>ref|XP_006428524.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
 gb|ESR41764.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
Length=261

 Score =   187 bits (476),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  262
            RL IMELANMISVPMSL A IRL+V DAIWQGG+N PLSAS+IL+ +LPSGGGDA NL+R
Sbjct  14   RLAIMELANMISVPMSLTAAIRLHVPDAIWQGGANTPLSASQILTRILPSGGGDAENLQR  73

Query  263  LLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            +LR+LTSYG+F EH      ER+YS+ E+GK+LVTD +GLSY  YVLQHHQ A+M AWPL
Sbjct  74   ILRLLTSYGVFSEH-REFGGERKYSLTEIGKSLVTDAEGLSYAPYVLQHHQDALMSAWPL  132

Query  443  VHEA  454
            VHEA
Sbjct  133  VHEA  136



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   190 bits (482),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL IMELANMISVPMSL A+I+L VADAIW+GGSNAPLS +EIL+ + P GGGDA NL+
Sbjct  16   ARLAIMELANMISVPMSLNAIIKLKVADAIWEGGSNAPLSPAEILAKIRPQGGGDAENLQ  75

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
            R+LRMLTSY +F EH+  D S+RRYS+ EVGKTLVTD++GLS+G YVLQHHQ A+M+ W 
Sbjct  76   RILRMLTSYRVFEEHVVDDGSQRRYSLTEVGKTLVTDENGLSHGLYVLQHHQDALMRVWT  135

Query  440  LVHEA  454
            +VHE 
Sbjct  136  MVHET  140



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 5/135 (4%)
 Frame = +2

Query  65   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  244
            +  N ARL I+ELANMISVPMSL AV+RLNV DAIWQ GSN PLSAS IL+ VLP GGGD
Sbjct  14   QPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQAGSNTPLSASAILARVLPDGGGD  73

Query  245  APNLERLLRMLTSYGIFREHI-----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
            A NL+R+LRMLTSYG+F EH+     +  + +R++S+ E+GKTLVTD++GLSYG Y+LQH
Sbjct  74   AENLQRILRMLTSYGVFEEHLIKEDDDGGSQQRKFSLTEIGKTLVTDQNGLSYGPYILQH  133

Query  410  HQAAMMKAWPLVHEA  454
            HQ  +M AWP+VHEA
Sbjct  134  HQDVLMGAWPMVHEA  148



>ref|XP_008361604.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X1 [Malus domestica]
Length=281

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 117/146 (80%), Gaps = 6/146 (4%)
 Frame = +2

Query  35   KLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEIL  214
            ++  + A  S S+N ARL I+ELANMISVPMSL AV+RLNV DAIWQGG N PLSAS++L
Sbjct  6    QVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLSASDVL  65

Query  215  SSVLPSGGGDAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLS  385
            + V+P+GGGDA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLS
Sbjct  66   ARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLS  125

Query  386  YGAYVLQHHQA---AMMKAWPLVHEA  454
            YG YVLQHHQ     +M AWP+VHEA
Sbjct  126  YGPYVLQHHQLFKDVLMGAWPMVHEA  151



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            ++S   +RL IMELANMISVPM+L AV+RLNVADAIW GG+NAPLSA++IL  +LP G G
Sbjct  6    TDSRKQSRLAIMELANMISVPMALNAVVRLNVADAIWNGGANAPLSAAQILPRILPVGDG  65

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NL+RLLR+LTSYG+F EH+   A ER+YS+ +VGK LVTD+ GLSYGAYVLQHHQ A
Sbjct  66   DAENLQRLLRILTSYGVFHEHLA--AGERKYSLTDVGKALVTDEQGLSYGAYVLQHHQDA  123

Query  422  MMKAWPLVHEA  454
            +M+AW LVHEA
Sbjct  124  LMRAWTLVHEA  134



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP-SGG  238
            +E    A L IMELANMISVPM+L AV+RLNVADA+WQGG+NAPLSASEIL  +LP + G
Sbjct  7    TEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPGADG  66

Query  239  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
             DA NL+RLLRML SYG+FREH+   A ER YS+ EVGKTLVTD+ GLSY  YVLQHHQ 
Sbjct  67   ADAENLQRLLRMLASYGVFREHLA--AGERNYSLTEVGKTLVTDEQGLSYAHYVLQHHQD  124

Query  419  AMMKAWPLVHEA  454
            A+M+AWPLVHEA
Sbjct  125  ALMRAWPLVHEA  136



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 6/137 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            S S N ARL I+ELANMISVPMSL AV+RLNVADAIWQGG N PLSAS+IL+ VLP+GGG
Sbjct  16   SSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGGG  75

Query  242  DAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
            DA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLSYG YVLQHH
Sbjct  76   DAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHH  135

Query  413  QA---AMMKAWPLVHEA  454
            Q     +M AWP+VHEA
Sbjct  136  QLFKDVLMGAWPMVHEA  152



>ref|XP_006381360.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59157.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=270

 Score =   185 bits (470),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 107/138 (78%), Gaps = 8/138 (6%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E    ARL I ELANMISVPMSL A++RL VADAIWQGGSNAPLSAS+IL  +  S G 
Sbjct  8    AEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRIA-STGS  66

Query  242  DAPNLERLLRMLTSYGIFREHINADAS-------ERRYSVDEVGKTLVTDKDGLSYGAYV  400
            D  NL+R+LRMLTSYG+F EH+  ++S       ER+YS+ EVGKTLVTD +GLSY  YV
Sbjct  67   DPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGLSYAPYV  126

Query  401  LQHHQAAMMKAWPLVHEA  454
            LQHHQ A+MKAWPLVHEA
Sbjct  127  LQHHQDALMKAWPLVHEA  144



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 108/134 (81%), Gaps = 6/134 (4%)
 Frame = +2

Query  65   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  244
            ES N ARL I+EL NMISVPM L A++RLNV DAIWQGGSNAPLSAS+IL+ VLPS  GD
Sbjct  7    ESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVLPS--GD  64

Query  245  APNLERLLRMLTSYGIFREHINADASE----RRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
              NL+R+LR+LT+YG+F EH+  D S     R+YS+ ++GKTLVTD DGLSYGAYVLQH+
Sbjct  65   PHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGAYVLQHY  124

Query  413  QAAMMKAWPLVHEA  454
            Q  +M AWPLVHEA
Sbjct  125  QEELMTAWPLVHEA  138



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 108/138 (78%), Gaps = 8/138 (6%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E    ARL I+ELANMISVPMSL A++RL VADAIWQGGSNAPLSAS+IL  +  S G 
Sbjct  8    AEKRKSARLAILELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRIA-STGS  66

Query  242  DAPNLERLLRMLTSYGIFREHI-------NADASERRYSVDEVGKTLVTDKDGLSYGAYV  400
            D  NL+R+LRMLTSYG+F EH+       +  ASER+YS+ EVGKTLVTD +GLSY  YV
Sbjct  67   DPENLQRILRMLTSYGVFEEHLTNESSPLDGSASERKYSLTEVGKTLVTDTEGLSYAPYV  126

Query  401  LQHHQAAMMKAWPLVHEA  454
            LQHHQ A+MKAWPLVHEA
Sbjct  127  LQHHQDALMKAWPLVHEA  144



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 107/131 (82%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E  N ARL I+ELANMISVPMSL A++RL V DAIWQ GSN PLSASEIL+  LP+G  
Sbjct  6    TEIRNNARLAILELANMISVPMSLNAIVRLKVPDAIWQSGSNVPLSASEILARALPTG--  63

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            D  NL+R+LRMLT+Y +F EHI   +SER+YS+ E+GKTLVTD +GLSY AYVLQHHQ A
Sbjct  64   DPENLQRILRMLTTYDVFSEHIADGSSERKYSLTEIGKTLVTDGEGLSYAAYVLQHHQDA  123

Query  422  MMKAWPLVHEA  454
            +MKAWP++HEA
Sbjct  124  LMKAWPILHEA  134



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 111/135 (82%), Gaps = 4/135 (3%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            S++ N ARLRI+ELANMISVPMSL AV+RL V DA+WQGGSNAPLSASEIL+    +  G
Sbjct  6    SDARNAARLRILELANMISVPMSLNAVVRLGVPDALWQGGSNAPLSASEILARSPAAPAG  65

Query  242  DAPNLERLLRMLTSYGIFREHI----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
            DA NL+RLLRML S+G+F EH+    ++ +SERRYS+ EVGKTLVTD +GLSY  YVLQH
Sbjct  66   DAENLQRLLRMLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAPYVLQH  125

Query  410  HQAAMMKAWPLVHEA  454
            HQ A+M+AWPLVHEA
Sbjct  126  HQDALMRAWPLVHEA  140



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 108/134 (81%), Gaps = 6/134 (4%)
 Frame = +2

Query  65   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  244
            ES N ARL I+EL NMISVPM L A++RLNV DAIWQGGSNAPLSAS+IL+ VLPS  GD
Sbjct  7    ESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVLPS--GD  64

Query  245  APNLERLLRMLTSYGIFREHINADASE----RRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
              NL+R+LR+LT+YG+F EH+  D S     R+YS+ ++GKTLVTD DGLSYGAYVLQH+
Sbjct  65   PHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGAYVLQHY  124

Query  413  QAAMMKAWPLVHEA  454
            Q  +M AWPLVHEA
Sbjct  125  QEELMTAWPLVHEA  138



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 110/135 (81%), Gaps = 5/135 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSG-  235
            SES N ARL IMELANMISVPMSL A +RL +ADAIW GG+N+PLSASEIL  +L PS  
Sbjct  6    SESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSASEILPRLLIPSAT  65

Query  236  --GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
              GGD  NL+R+LRMLTSYG+F EH+   +SER++S+ +VGKTLVTD DGLSY AY+LQH
Sbjct  66   TTGGDPENLQRILRMLTSYGVFSEHL-VGSSERKFSLTDVGKTLVTDSDGLSYAAYILQH  124

Query  410  HQAAMMKAWPLVHEA  454
            HQ A+M+AWPLVH A
Sbjct  125  HQEALMRAWPLVHTA  139



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   185 bits (469),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 107/138 (78%), Gaps = 8/138 (6%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E    ARL I ELANMISVPMSL A++RL VADAIWQGGSNAPLSAS+IL  +  S G 
Sbjct  8    AEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRIA-STGS  66

Query  242  DAPNLERLLRMLTSYGIFREHINADAS-------ERRYSVDEVGKTLVTDKDGLSYGAYV  400
            D  NL+R+LRMLTSYG+F EH+  ++S       ER+YS+ EVGKTLVTD +GLSY  YV
Sbjct  67   DPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGLSYAPYV  126

Query  401  LQHHQAAMMKAWPLVHEA  454
            LQHHQ A+MKAWPLVHEA
Sbjct  127  LQHHQDALMKAWPLVHEA  144



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 111/133 (83%), Gaps = 3/133 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            SE+   A+L I+ELANMISVPMSL AV++LNVADAIWQ G N+PLSASEILS +  SGG 
Sbjct  6    SETRKNAKLAIIELANMISVPMSLNAVVQLNVADAIWQNGVNSPLSASEILSRINLSGG-  64

Query  242  DAPNLERLLRMLTSYGIFREHINA--DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            D  NL+R+LRML+SY +F EH++A    +ERRYS+ E+GKTLVTD +GLSYGAYVLQHHQ
Sbjct  65   DPDNLQRILRMLSSYNVFTEHLSAVDGVTERRYSLTEIGKTLVTDVNGLSYGAYVLQHHQ  124

Query  416  AAMMKAWPLVHEA  454
             A+M+AWPLVHEA
Sbjct  125  DALMRAWPLVHEA  137



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 116/147 (79%), Gaps = 2/147 (1%)
 Frame = +2

Query  17   QKQITGKLKE-IGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAP  193
            +++IT K K+ +    SES N ARL I+ELANMISVPMSL A ++L +ADAIW GG+N+P
Sbjct  20   EEKITNKQKKKMEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNGGANSP  79

Query  194  LSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDK  373
            LSA+EILS +L   GGD  NL+R+LR LTSYG+F EH+   ++ER+YS+ +VGKTLVTD 
Sbjct  80   LSAAEILSRLLLQSGGDPENLQRILRTLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDS  138

Query  374  DGLSYGAYVLQHHQAAMMKAWPLVHEA  454
             GLSY AYVLQHHQ A+M+AWPLVH A
Sbjct  139  GGLSYAAYVLQHHQDALMRAWPLVHTA  165



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 108/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGGGDAPNLE  259
            RL IMELANMISVPMSL AV++L V DA+W+ GSNAPLS  EIL+ +  P GGGDA NL+
Sbjct  17   RLAIMELANMISVPMSLNAVVKLKVTDAVWENGSNAPLSPVEILAKIRGPQGGGDAENLQ  76

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
            R+LRMLTSYG+F+EH++ D S+RRYS+ +VGKTLVTD++GLS+G+YVLQHHQ A+MKAW 
Sbjct  77   RILRMLTSYGVFKEHVD-DGSQRRYSLTKVGKTLVTDENGLSHGSYVLQHHQDALMKAWT  135

Query  440  LVHEA  454
            +VHEA
Sbjct  136  MVHEA  140



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSS-VLPSGG  238
            SES N ARL I+ELANMISVPMSL A ++L +ADAIW  G+N+PLSA+EIL   +LPSGG
Sbjct  6    SESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNDGTNSPLSAAEILPRLLLPSGG  65

Query  239  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
            GD  NL+R+LRMLTSYG+F EH+   ++ER+YS+ +VGKTLVTD  GLSY AYVLQHHQ 
Sbjct  66   GDPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVLQHHQD  124

Query  419  AMMKAWPLVHEA  454
            A+M+AWPLVH A
Sbjct  125  ALMRAWPLVHTA  136



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            SES N ARL I+ELANMISVPMSL A ++L +ADA+W GG+N+PLSA+EIL+ +L   GG
Sbjct  6    SESRNRARLAILELANMISVPMSLNAAVKLGIADAVWNGGTNSPLSAAEILTRLLLPSGG  65

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            D  NL+R+LRMLTSYG+F EH+   ++ER+YS+ +VGKTLVTD  GLSY AYVLQHHQ A
Sbjct  66   DPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVLQHHQDA  124

Query  422  MMKAWPLVHEA  454
            +M+AWPLVH A
Sbjct  125  LMRAWPLVHTA  135



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--  235
            SES N ARL IMELANMISVPMSL A ++L +ADAIW  G+N+PLSA+EIL  +L S   
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVKLGIADAIWNAGANSPLSAAEILPRLLLSSST  65

Query  236  ---GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
                GD  NL+R+LRMLTSYG+F EHIN  + ER+YS+ +VGKTLVTD  GLSY AYVLQ
Sbjct  66   TTIAGDPENLQRILRMLTSYGVFSEHINGSSVERKYSLTDVGKTLVTDSGGLSYAAYVLQ  125

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVH A
Sbjct  126  HHQEALMRAWPLVHTA  141



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   183 bits (464),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 108/138 (78%), Gaps = 7/138 (5%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSS-VLPSG-  235
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G+N+PLSASEIL   +LPS  
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGIADAIWNSGANSPLSASEILPRLLLPSRD  65

Query  236  ---GGDAPNLERLLRMLTSYGIFREHINADAS--ERRYSVDEVGKTLVTDKDGLSYGAYV  400
               GGD  NL+R+LRMLTSYG+F EH+N DA   ER+YS+  VGKTLVTD  GLSY AYV
Sbjct  66   STIGGDPENLQRILRMLTSYGVFSEHLNGDAGSVERKYSLTNVGKTLVTDSGGLSYAAYV  125

Query  401  LQHHQAAMMKAWPLVHEA  454
            LQHHQ ++M+AWPLVH A
Sbjct  126  LQHHQESLMRAWPLVHTA  143



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 106/131 (81%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            SE  N ARL IMELANMISVPMSL A ++L VADAIW GG+N+P+SA+EILS     G G
Sbjct  6    SERRNRARLAIMELANMISVPMSLNAAVKLGVADAIWCGGANSPISAAEILSRCC-GGAG  64

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
               NL+R+LRMLTSYG+F EH + D SER+YS+ +VGKTLVTD DGLSYG+YVLQHHQ A
Sbjct  65   GPENLQRILRMLTSYGVFSEHFSGD-SERKYSLTDVGKTLVTDSDGLSYGSYVLQHHQEA  123

Query  422  MMKAWPLVHEA  454
            +M+AWPLVH A
Sbjct  124  LMRAWPLVHTA  134



>ref|XP_010271244.1| PREDICTED: uncharacterized protein LOC104607311 isoform X2 [Nelumbo 
nucifera]
Length=210

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E+ N ARL I+ELANMISVPMSL A++ L V DAIWQG SN PLSASE+L+ VLP+G  
Sbjct  6    TETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVLPTGNS  65

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            +  NL R+LRM TSY +F EHI    SER+YS+ E+GK LVTD +GLSY  YVLQHHQ  
Sbjct  66   E--NLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQHHQDT  123

Query  422  MMKAWPLVHEA  454
            ++KAWPL HEA
Sbjct  124  LVKAWPLQHEA  134



>ref|XP_010271241.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271242.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271243.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
Length=248

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E+ N ARL I+ELANMISVPMSL A++ L V DAIWQG SN PLSASE+L+ VLP+G  
Sbjct  6    TETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVLPTGNS  65

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            +  NL R+LRM TSY +F EHI    SER+YS+ E+GK LVTD +GLSY  YVLQHHQ  
Sbjct  66   E--NLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQHHQDT  123

Query  422  MMKAWPLVHEA  454
            ++KAWPL HEA
Sbjct  124  LVKAWPLQHEA  134



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 108/135 (80%), Gaps = 5/135 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV-LPSG-  235
            SES N ARL IMELANMISVPMSL A +RL +ADAIW GG+N+PLSA+EIL  + LPS  
Sbjct  6    SESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSAAEILPRLHLPSHT  65

Query  236  --GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
              GGD  NL+R+LRMLTSYG+F EH+   + ER+YS+ +VGKTLVTD  GLSY AYVLQH
Sbjct  66   TIGGDPENLQRILRMLTSYGVFSEHL-VGSIERKYSLTDVGKTLVTDSGGLSYAAYVLQH  124

Query  410  HQAAMMKAWPLVHEA  454
            HQ A+M+AWPLVH A
Sbjct  125  HQEALMRAWPLVHTA  139



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   177 bits (450),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 107/131 (82%), Gaps = 6/131 (5%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPS------GGG  241
            ARL IMELANMISVPMSL A++RL VADAIW+GGSNAPLS +EILS +  S      GGG
Sbjct  15   ARLAIMELANMISVPMSLNAIVRLKVADAIWEGGSNAPLSPTEILSKIRASEGGGGGGGG  74

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
            DA NL+R+LRMLTSY +F EHI  D S+RRYS+ EVGKTLVTD++GLSYG+YVLQHHQ A
Sbjct  75   DAENLQRILRMLTSYDVFAEHIVDDGSQRRYSLTEVGKTLVTDENGLSYGSYVLQHHQDA  134

Query  422  MMKAWPLVHEA  454
            +M AW +V EA
Sbjct  135  LMSAWTMVDEA  145



>emb|CDX76223.1| BnaA04g04870D [Brassica napus]
Length=268

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 105/136 (77%), Gaps = 7/136 (5%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV---LPS  232
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G N+PLSA+EIL  +     +
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSATEILPRLHLTYQN  65

Query  233  G--GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
            G  GGD  NL+R+LRMLTSYG+F EH+    + R+YS+ +VGKTLVTD DGLSY AYVLQ
Sbjct  66   GTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYAAYVLQ  123

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVH A
Sbjct  124  HHQEALMRAWPLVHTA  139



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 106/136 (78%), Gaps = 7/136 (5%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP----  229
            SE  N ARL+++ELANMISVPMSL AV+RL V DAIWQ GSN+PLSAS+IL+ VLP    
Sbjct  6    SEKRNQARLKVLELANMISVPMSLNAVVRLGVPDAIWQSGSNSPLSASQILTRVLPSSSS  65

Query  230  -SGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
             +   D  NL+RLLR LTSYG+F EHI+ +   R+YS+ +VGKTLVTD DGLSY  YVLQ
Sbjct  66   SAASADPDNLQRLLRTLTSYGVFSEHISGEI--RKYSLTDVGKTLVTDSDGLSYAPYVLQ  123

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AW L+HEA
Sbjct  124  HHQDALMRAWSLLHEA  139



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 103/135 (76%), Gaps = 4/135 (3%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGG  238
            SE  N ARL IMELANMISVPMSL A +RL +AD IW  G N+PLSA+EIL  +L PS  
Sbjct  6    SERRNKARLAIMELANMISVPMSLNAAVRLGIADVIWNDGENSPLSAAEILPRLLLPSDT  65

Query  239  ---GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
               GD  NL+R+LRMLTSY +F EH+ A + ER+YS+ +VGKTLVTD  GLSY AYVLQH
Sbjct  66   TITGDPENLQRILRMLTSYDVFSEHLAAGSVERKYSLTDVGKTLVTDSGGLSYAAYVLQH  125

Query  410  HQAAMMKAWPLVHEA  454
            HQ A+M+AWPLVH A
Sbjct  126  HQEALMRAWPLVHTA  140



>ref|XP_009774776.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=252

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 103/131 (79%), Gaps = 6/131 (5%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP---  250
            ARL IMELANMISVPMSL AV+RL VADAIW+GGSNAPLS +EIL+ +  S GG      
Sbjct  15   ARLAIMELANMISVPMSLNAVVRLKVADAIWEGGSNAPLSPTEILAKISGSEGGGGAGGG  74

Query  251  ---NLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
               NL+R+LRMLTSY +F EHI  D  +RRYS+ EVGKTLVTDK+GLSYG+Y+LQHHQ A
Sbjct  75   DAENLQRILRMLTSYDVFAEHIVDDGPQRRYSLTEVGKTLVTDKNGLSYGSYILQHHQDA  134

Query  422  MMKAWPLVHEA  454
            +M AW +V EA
Sbjct  135  LMSAWTMVDEA  145



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 105/136 (77%), Gaps = 7/136 (5%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV---LPS  232
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G N+PLSA+EIL  +     +
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSAAEILPRLHLTYQN  65

Query  233  G--GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
            G  GGD  NL+R+LRMLTSYG+F EH+    + R+YS+ +VGKTLVTD DGLSY AYVLQ
Sbjct  66   GTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYAAYVLQ  123

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVH A
Sbjct  124  HHQEALMRAWPLVHTA  139



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   172 bits (436),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 105/136 (77%), Gaps = 7/136 (5%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV---LPS  232
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G N+P+SA+EIL  +     +
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPVSAAEILPRLHLTYQN  65

Query  233  G--GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
            G  GGD  NL+R+LRMLTSYG+F EH+    + R+YS+ +VGKTLVTD DGLSY AYVLQ
Sbjct  66   GTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYAAYVLQ  123

Query  407  HHQAAMMKAWPLVHEA  454
            HHQ A+M+AWPLVH A
Sbjct  124  HHQEALMRAWPLVHTA  139



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   172 bits (435),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  74   NGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN  253
            N   L IMELAN++SVPMSL AVI+L V D IWQ GSN PLSA+EILS++     GDA N
Sbjct  7    NSPILAIMELANLVSVPMSLNAVIKLKVLDTIWQDGSNNPLSAAEILSAIALGPAGDAEN  66

Query  254  LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKA  433
            L+R+LR+LTSYG+F EHI  D  ERRYS+ EVGK L  D++GLSY  Y+LQHHQ A+M A
Sbjct  67   LQRILRLLTSYGVFDEHIGKDGRERRYSLTEVGKALAADENGLSYAPYILQHHQDALMLA  126

Query  434  WPLVHEA  454
            WP VHEA
Sbjct  127  WPRVHEA  133



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  262
            RL I+E+A+M+SVPMSL AV+ + V DAIWQGG+N PLSASEIL+ V P+GGGDA NL+R
Sbjct  19   RLAILEVAHMMSVPMSLVAVLNMKVPDAIWQGGNNTPLSASEILAVVRPNGGGDAENLQR  78

Query  263  LLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            +LR+LT+Y IF E +N+   ER+YS+ +VGKTL+ D DGLSY AYVLQHHQ A+M+AW L
Sbjct  79   ILRLLTTYDIFDEQLNSKG-ERKYSLSDVGKTLIADADGLSYAAYVLQHHQEALMRAWAL  137

Query  443  VHEA  454
            V EA
Sbjct  138  VGEA  141



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MELAN++SVPMSL AVI+L V D IWQ G N PLSA+EILS+V      DA NL+R+LR+
Sbjct  1    MELANLVSVPMSLNAVIKLKVLDTIWQDGFNNPLSAAEILSAVAVGPHADAENLQRILRL  60

Query  275  LTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            LTSYG+F EHI  D S RRYS+ EVGK L TD++GLSY  YVLQHHQ A+M AWPLVHEA
Sbjct  61   LTSYGVFNEHIAGDGSGRRYSLTEVGKALATDENGLSYAPYVLQHHQDAIMLAWPLVHEA  120



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +2

Query  65   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  244
            +S + ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  245  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  424
            A NL+R+LR+LT+Y IF E ++++  +R+YS+ EVGK LV D DGLSYG YVLQH+Q   
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTEVGKALVPDDDGLSYGTYVLQHYQDQY  128

Query  425  MKAWPLVHEA  454
            ++AWPLV EA
Sbjct  129  LRAWPLVGEA  138



>gb|AAP03054.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=181

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 10/140 (7%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPS--G  235
            SE+ N ARL+I+ELAN+ISVPMSL A++RL V +AIW  GSN P+SA+EILS  LP    
Sbjct  16   SEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPA  74

Query  236  GGDAPNLERLLRMLTSYGIFREHIN------ADASERRYSVDEVGKTLVT-DKDGLSYGA  394
              DA NL+RLLR+LTS+G+F EH++      +  SERRY + EVG+TLV+ D+   S+GA
Sbjct  75   TADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGA  134

Query  395  YVLQHHQAAMMKAWPLVHEA  454
            YVLQHHQ  ++KAWP +H A
Sbjct  135  YVLQHHQETLLKAWPFLHTA  154



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
            R+LR+LT+Y IF E ++++  +R+YS+ ++GK LV D DGLSY  YVLQH+Q   ++AWP
Sbjct  75   RILRLLTTYAIFAEDLSSNG-KRKYSLTDIGKALVPDDDGLSYATYVLQHYQDQYLRAWP  133

Query  440  LVHEA  454
            LV +A
Sbjct  134  LVGDA  138



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 93/131 (71%), Gaps = 20/131 (15%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +E    A L IMELANMISVPM+L AV+RLNVADA+WQGG+NAPLSASEIL  +LP    
Sbjct  7    TEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPG---  63

Query  242  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  421
                           G+FREH+   A ER YS+ EVGKTLVTD+ GLSY  YVLQHHQ A
Sbjct  64   ---------------GVFREHLA--AGERNYSLTEVGKTLVTDEQGLSYAHYVLQHHQDA  106

Query  422  MMKAWPLVHEA  454
            +M+AWPLVHEA
Sbjct  107  LMRAWPLVHEA  117



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 10/140 (7%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPS--G  235
            SE+ N ARL+I+ELAN+ISVPMSL A++RL V +AIW  GSN P+SA+EILS  LP    
Sbjct  16   SEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPA  74

Query  236  GGDAPNLERLLRMLTSYGIFREHIN------ADASERRYSVDEVGKTLVT-DKDGLSYGA  394
              DA NL+RLLR+LTS+G+F EH++      +  SERRY + EVG+TLV+ D+   S+GA
Sbjct  75   TADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGA  134

Query  395  YVLQHHQAAMMKAWPLVHEA  454
            YVLQHHQ  ++KAWP +H A
Sbjct  135  YVLQHHQETLLKAWPFLHTA  154



>gb|AFK47565.1| unknown [Medicago truncatula]
Length=224

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
            R+LR+LT+Y IF E ++++  ER+YS+ +VGK LV D  GL+  ++ +QHHQ   ++AWP
Sbjct  75   RILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLRAWP  133

Query  440  LVHEA  454
            LV +A
Sbjct  134  LVGDA  138



>ref|XP_003602596.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|AES72847.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=264

 Score =   149 bits (375),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
            R+LR+LT+Y IF E ++++  ER+YS+ +VGK LV D  GL+  ++ +QHHQ   ++AWP
Sbjct  75   RILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLRAWP  133

Query  440  LVHEA  454
            LV +A
Sbjct  134  LVGDA  138



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   149 bits (375),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
            R+LR+LT+Y IF E ++++  ER+YS+ +VGK LV D  GL+  ++ +QHHQ   ++AWP
Sbjct  75   RILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLRAWP  133

Query  440  LVHEA  454
            LV +A
Sbjct  134  LVGDA  138



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            SE     RL +MELANMISVPM+L AV+RLNV DAIWQ GSN+PL+A+EIL+ + P    
Sbjct  14   SEVGKQGRLAMMELANMISVPMALNAVVRLNVPDAIWQSGSNSPLTAAEILALLRPPPPS  73

Query  242  DAPN--LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
             +    L+RLLR+L S+G+F E+  A +  RRYS+ +VG+TLV   DG SY AYVLQHHQ
Sbjct  74   SSDPSVLQRLLRLLASHGVFAENRCATSGARRYSLTDVGRTLVPSGDGASYAAYVLQHHQ  133

Query  416  AAMMKAWPLVHEA  454
             A+++AWP +HEA
Sbjct  134  DALVRAWPRLHEA  146



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL +MELANMI+VPM+L AVIRL V  A+W GG+N PLSA+E+    LP+G  D   LE
Sbjct  23   ARLAMMELANMIAVPMALTAVIRLGVPAAVWAGGANLPLSAAEL----LPAGHPDPSVLE  78

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLV-TDKDGLSYGAYVLQHHQAAMMKAW  436
            RLLR+L S G+F EH      ERRY++  VG+TLV +   G SY  YVLQHHQ A++ AW
Sbjct  79   RLLRLLASRGVFSEHAADGGRERRYALTAVGRTLVPSAPSGASYADYVLQHHQDALVLAW  138

Query  437  PLVHEA  454
            P +HEA
Sbjct  139  PRLHEA  144



>ref|XP_010935842.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Elaeis 
guineensis]
Length=346

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 97/139 (70%), Gaps = 10/139 (7%)
 Frame = +2

Query  65   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI--LSSVLPSGG  238
            E    A L +MEL+NMI+VPMSL AV+RLNV  AIWQ G+N+PLSA+EI  L    P   
Sbjct  49   EVQKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPS  108

Query  239  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVT-------DKDGLSYGAY  397
             D  NL+RLLR+L S+G+F EH++  +  RR+S+  VG+TLV+        +DG SY AY
Sbjct  109  TDPGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAY  167

Query  398  VLQHHQAAMMKAWPLVHEA  454
            VLQHHQ A+++AWP +HEA
Sbjct  168  VLQHHQDALVRAWPRLHEA  186



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 97/139 (70%), Gaps = 10/139 (7%)
 Frame = +2

Query  65   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI--LSSVLPSGG  238
            E    A L +MEL+NMI+VPMSL AV+RLNV  AIWQ G+N+PLSA+EI  L    P   
Sbjct  49   EVQKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPS  108

Query  239  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVT-------DKDGLSYGAY  397
             D  NL+RLLR+L S+G+F EH++  +  RR+S+  VG+TLV+        +DG SY AY
Sbjct  109  TDPGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAY  167

Query  398  VLQHHQAAMMKAWPLVHEA  454
            VLQHHQ A+++AWP +HEA
Sbjct  168  VLQHHQDALVRAWPRLHEA  186



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 87/123 (71%), Gaps = 6/123 (5%)
 Frame = +2

Query  92   IMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLR  271
            +MELANMISVPM+L AVIRL V  A+W GG+NAPLSA+E+    LP G  D   LERLLR
Sbjct  1    MMELANMISVPMALTAVIRLGVPSAVWAGGANAPLSAAEL----LPEGHPDPSVLERLLR  56

Query  272  MLTSYGIFREHINADA-SERRYSVDEVGKTLV-TDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            +L S G+F EH    A S RR+++  VG+TLV +   G SY  YVLQHHQ A++ AWP +
Sbjct  57   LLASRGVFSEHGGGSAGSPRRFALTAVGRTLVPSGPSGASYADYVLQHHQDALVSAWPRL  116

Query  446  HEA  454
            HEA
Sbjct  117  HEA  119



>ref|XP_011101495.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Sesamum 
indicum]
Length=113

 Score =   127 bits (318),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = +2

Query  74   NGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG---GGD  244
            N   L IMEL N++SVPMSL AVI+L V D I Q GSN PLS +EI  S LPS      D
Sbjct  7    NSPILAIMELVNLVSVPMSLKAVIQLKVLDTIRQDGSNNPLSPAEI--SYLPSRLALARD  64

Query  245  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYG  391
            A NL+R+LR+LTSYG+F EHI AD SERRYS+ EVGK L  DK+GLSY 
Sbjct  65   AENLQRILRLLTSYGVFNEHIGADGSERRYSLKEVGKALAADKNGLSYA  113



>gb|AAP03053.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=191

 Score =   129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 10/122 (8%)
 Frame = +2

Query  116  SVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--GGDAPNLERLLRMLTSYG  289
            +VPMSL A++RL V +AIW  GSN P+SA+EILS  LP      DA NL+RLLR+LTS+G
Sbjct  6    NVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPPTADAENLQRLLRVLTSFG  64

Query  290  IFREHIN------ADASERRYSVDEVGKTLVT-DKDGLSYGAYVLQHHQAAMMKAWPLVH  448
            +F EH++      +  SERRY + EVG+TLV+ D+   S+GAYVLQHHQ  ++KAWP +H
Sbjct  65   VFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGAYVLQHHQETLLKAWPFLH  124

Query  449  EA  454
             A
Sbjct  125  TA  126



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 13/143 (9%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-  238
            SE+ N ARL IMELANMISVPM+L AV+RL V  AIW  G+N PL+A+ I+S +LP+   
Sbjct  20   SETRNKARLAIMELANMISVPMALNAVVRLKVPAAIWSCGANTPLTAAAIISLILPNNPE  79

Query  239  GDAPNLERLLRMLTSYGIFREH--INADASERRYSVDEVGKTLVTDKDGL---------S  385
             DA NL RLLR+L++YG+F EH  +  D   RRYS+ EVG+TLV    G          S
Sbjct  80   ADADNLARLLRLLSTYGVFSEHPPLYGDIF-RRYSLTEVGRTLVAGDGGGGGGDDGGGSS  138

Query  386  YGAYVLQHHQAAMMKAWPLVHEA  454
            +G YVLQHHQ A+++AW  V  A
Sbjct  139  HGEYVLQHHQEALVRAWLQVDRA  161



>gb|AGW45465.1| beta-alanine n-methyltransferase, partial [Reaumuria trigyna]
Length=204

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +2

Query  149  LNVADAIWQGGSNAPLSASEILSSVLP-SGGGDAPNLERLLRMLTSYGIFREHI-NADAS  322
            L V +AIW  GSN PL+A+EILS +LP S   D  NL+R+LR+LT+Y IF EH+ +    
Sbjct  1    LKVPEAIWAHGSNKPLTATEILSHILPNSPTADPENLQRMLRLLTTYNIFVEHLSDTTPV  60

Query  323  ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            +RRYS+ EVG+TLV D DGLSYG Y++QHHQ A++++WPLVH A
Sbjct  61   QRRYSLTEVGETLVPDSDGLSYGDYIMQHHQDALVRSWPLVHMA  104



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +2

Query  182  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  361
            +N PLSAS+IL+ +LPSGGGDA NL+R+LR+LT+YG+F EH      ER+YS+ E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTNYGVFSEH-REFGGERKYSLTEIGKSL  74

Query  362  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            VTD +G SY  YVLQHHQ A+M AWPLVHEA
Sbjct  75   VTDAEGQSYAPYVLQHHQDALMSAWPLVHEA  105



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 9/130 (7%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL +MELANM+SVPM+L AVIRL V  AIW GG+NAP SA+E+    LP+G  D   LE
Sbjct  27   ARLAMMELANMVSVPMALTAVIRLGVPAAIWAGGANAPRSAAEL----LPAGHPDPSVLE  82

Query  260  RLLRMLTSYGIFREHINAD----ASERRYSVDEVGKTLVTD-KDGLSYGAYVLQHHQAAM  424
            RLLR+L S G+F E  +       + RR+++  VG+TLV +   G SY  YVLQHHQ A+
Sbjct  83   RLLRLLASRGVFSESTSTSEDRTTTTRRFALTAVGRTLVPEGASGASYADYVLQHHQDAL  142

Query  425  MKAWPLVHEA  454
            + AWP +HEA
Sbjct  143  VAAWPRLHEA  152



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 88/128 (69%), Gaps = 7/128 (5%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL +MELANM+SVPM+L AVIRL V  A+W GG+NAP+SA+++    LP G  D   LE
Sbjct  25   ARLAMMELANMVSVPMALAAVIRLGVPAAVWAGGANAPMSAADL----LPPGHPDPSVLE  80

Query  260  RLLRMLTSYGIFREHINADASERR--YSVDEVGKTLVT-DKDGLSYGAYVLQHHQAAMMK  430
            RLLR+L S G+F E   +  + RR  +++  VG+TLV     G SY  YVLQHHQ A++ 
Sbjct  81   RLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALVA  140

Query  431  AWPLVHEA  454
            AWP +HEA
Sbjct  141  AWPRLHEA  148



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 88/128 (69%), Gaps = 7/128 (5%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL +MELANM+SVPM+L AVIRL V  A+W GG+NAP+SA+++    LP G  D   LE
Sbjct  25   ARLAMMELANMVSVPMALAAVIRLGVPXAVWAGGANAPMSAADL----LPPGHPDPSVLE  80

Query  260  RLLRMLTSYGIFREHINADASERR--YSVDEVGKTLVT-DKDGLSYGAYVLQHHQAAMMK  430
            RLLR+L S G+F E   +  + RR  +++  VG+TLV     G SY  YVLQHHQ A++ 
Sbjct  81   RLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALVA  140

Query  431  AWPLVHEA  454
            AWP +HEA
Sbjct  141  AWPRLHEA  148



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  182  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  361
            +N PLS S+IL+ +LPSGGGDA NL+ +LR+LTSYG+F EH      ER+YS+ E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  362  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            VTD +GLSY  YVLQHHQ A M AWPLVHEA
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEA  105



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  182  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  361
            +N PLS S+IL+ +LPSGGGDA NL+ +LR+LTSYG+F EH      ER+YS+ E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  362  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            VTD +GLSY  YVLQHHQ A M AWPLVHEA
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEA  105



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  182  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  361
            +N PLSAS+IL+ +LPSG GDA NL+R+LR+LTSYG+F EH      + +YS+ E+GK+L
Sbjct  4    ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  62

Query  362  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            VTD +GLSY  YVLQHHQ A+M  WPLVHEA
Sbjct  63   VTDAEGLSYAPYVLQHHQDALMSMWPLVHEA  93



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  182  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  361
            +N PLSAS+IL+ +LPSGGGDA NL+R+LR+LTSYG+F EH      +R YS+ E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  362  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            VTD +GLSY  YVLQHHQ A+M  WPLVH+A
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKA  105



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  182  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  361
            +N PLSAS+IL+ +LPSGGGDA NL+R+LR+LTSYG+F EH      +R YS+ E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  362  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            VTD +GLSY  YVLQHHQ A+M  WPLVH+A
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKA  105



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 87/128 (68%), Gaps = 7/128 (5%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL +MELANMISVPM+L A IRL V  AIW  G+NAPLSA+++    LP+   D   LE
Sbjct  16   ARLAMMELANMISVPMALTAAIRLGVPGAIWADGANAPLSAADL----LPADHPDPSVLE  71

Query  260  RLLRMLTSYGIFREHINADASE--RRYSVDEVGKTLV-TDKDGLSYGAYVLQHHQAAMMK  430
            R+LR+L S G+F EH     +E  RR+++  VG+TLV     G SY  YVLQHHQ A++ 
Sbjct  72   RVLRLLASRGVFSEHHGPGPAEPTRRFALTAVGRTLVPAGPSGASYADYVLQHHQDALVL  131

Query  431  AWPLVHEA  454
            AWP +HEA
Sbjct  132  AWPRLHEA  139



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +2

Query  182  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  361
            +N PLSAS+IL+ +LPSG GDA NL+R+LR+LTSYG+F EH      + +YS+ E+GK+L
Sbjct  16   ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  74

Query  362  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            VTD +GLSY  YVLQHHQ A+M  WPLV+EA
Sbjct  75   VTDAEGLSYAPYVLQHHQDALMSMWPLVYEA  105



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 94/142 (66%), Gaps = 11/142 (8%)
 Frame = +2

Query  50   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  229
            G  G  S   ARL +MELANMISVPM+L AVIRL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLTAADL----LP  59

Query  230  SGGGDAPNLERLLRMLTSYGIFREHIN-ADASERRYSVDEVGKTLVTDKDGL------SY  388
            +G  D   LERLLR+L S G+F EH   +  S RR+S+  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  389  GAYVLQHHQAAMMKAWPLVHEA  454
              YVLQHHQ A+++AWPL+HEA
Sbjct  120  ADYVLQHHQDALVRAWPLLHEA  141



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 94/142 (66%), Gaps = 11/142 (8%)
 Frame = +2

Query  50   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  229
            G  G  S   ARL +MELANMISVPM+L AVIRL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLAAADL----LP  59

Query  230  SGGGDAPNLERLLRMLTSYGIFREHIN-ADASERRYSVDEVGKTLVTDKDGL------SY  388
            +G  D   LERLLR+L S G+F EH   +  S RR+S+  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  389  GAYVLQHHQAAMMKAWPLVHEA  454
              YVLQHHQ A+++AWPL+HEA
Sbjct  120  ADYVLQHHQDALVRAWPLLHEA  141



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 86/130 (66%), Gaps = 24/130 (18%)
 Frame = +2

Query  65   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  244
            +S + ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  245  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  424
            A NL+R+LR+LT+Y IF E ++++  +R+YS+ E                          
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTE-----------------------DQY  105

Query  425  MKAWPLVHEA  454
            ++AWPLV EA
Sbjct  106  LRAWPLVGEA  115



>ref|XP_010243879.1| PREDICTED: uncharacterized protein LOC104587837 [Nelumbo nucifera]
Length=130

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 69/89 (78%), Gaps = 2/89 (2%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            +++ N  RL I+ELAN+I+VPMSL A++ L VADAI QG SN PLSASEIL+ VLP+G  
Sbjct  6    TKTQNNTRLAILELANIINVPMSLNAIVCLKVADAIQQGSSNVPLSASEILACVLPTGDP  65

Query  242  DAPNLERLLRMLTSYGIFREHINADASER  328
            D  NL+ +LRMLTSY +F EHI  D+S++
Sbjct  66   D--NLQCILRMLTSYDVFSEHIVDDSSKQ  92



>ref|XP_010275846.1| PREDICTED: uncharacterized protein LOC104610771 [Nelumbo nucifera]
Length=277

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 81/153 (53%), Gaps = 46/153 (30%)
 Frame = +2

Query  71   DNGARLRIMELANMISVP--------------MSLCA----------VIRLNVA-DAIWQ  175
            DNG RL I+ELANMI  P              +  C             R       IWQ
Sbjct  10   DNG-RLAILELANMIKSPNVPQRHHPPQASKRIKACPGQPWPGRRTGFFRCRTTLVTIWQ  68

Query  176  GGSNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGK  355
            GGSN PLSASEIL+ VLP    D  N + +L+ML+SYGIF EHI                
Sbjct  69   GGSNVPLSASEILAYVLPIS--DPENFQHILQMLSSYGIFSEHI----------------  110

Query  356  TLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
              VT+++GL Y AY+L+HHQ A++KAWP++HEA
Sbjct  111  --VTNREGLFYVAYILKHHQDALVKAWPILHEA  141



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 78/121 (64%), Gaps = 6/121 (5%)
 Frame = +2

Query  92   IMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLR  271
            +MEL N I+V MSL A+ +L+V   IWQ G N PL+A EI + +    G  + NLER+LR
Sbjct  19   MMELTNSIAVSMSLRAMAKLDVPKIIWQNGENTPLTALEIATKLGSEAG--SSNLERMLR  76

Query  272  MLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHE  451
            +LT++G+F E +   +  RR+S+  +G+ +V D+   S GA++L     A++ AW L+HE
Sbjct  77   LLTAHGVFNETMLGPSEGRRFSLTGLGREIV-DR---SMGAFILYRLDDALLDAWRLLHE  132

Query  452  A  454
            A
Sbjct  133  A  133



>ref|XP_006441597.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
 gb|ESR54837.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
Length=181

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  262
            MELANMISVPMSL A IRL+V DAI QGG+N PLSAS+IL+ +LPSGGGDA NL+R
Sbjct  1    MELANMISVPMSLTAAIRLHVPDAIRQGGANTPLSASQILTCILPSGGGDAENLQR  56



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +2

Query  272  MLTSYGIFREHINADAS----ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
            ML S+G+F EH+   AS    ERRYS+ EVGKTLVTD +GLSY  YVLQHHQ A+M+AWP
Sbjct  1    MLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAPYVLQHHQDALMRAWP  60

Query  440  LVHEA  454
            LVHEA
Sbjct  61   LVHEA  65



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = +2

Query  272  MLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            MLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLSYG YVLQHHQ  +M AWP+
Sbjct  1    MLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHHQDVLMGAWPM  60

Query  443  VHEA  454
            VHEA
Sbjct  61   VHEA  64



>gb|KDO38695.1| hypothetical protein CISIN_1g037818mg, partial [Citrus sinensis]
Length=199

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 54/91 (59%), Gaps = 29/91 (32%)
 Frame = +2

Query  182  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  361
            +N PLSAS+IL+ +LPSG GDA NL+R+LR+LTSYG                        
Sbjct  16   ANTPLSASQILTRILPSGDGDAENLQRILRLLTSYG------------------------  51

Query  362  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
                 GLSY  Y+LQHHQ A+M AWPLVHEA
Sbjct  52   -----GLSYAPYMLQHHQDALMSAWPLVHEA  77



>ref|XP_002986521.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
 gb|EFJ12378.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
Length=238

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 83/142 (58%), Gaps = 7/142 (5%)
 Frame = +2

Query  38   LKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILS  217
            +  +G+M  + D+  RLRIME   M  +P +L AVI+L + D I     +APLS++EI++
Sbjct  1    MGSLGSMVLQDDD--RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIA  57

Query  218  SVLPSGG-GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTD--KDGLSY  388
             +   G  G   NL+R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL  
Sbjct  58   QIPACGSSGSGANLDRILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNSGLPL  116

Query  389  GAYVLQHHQAAMMKAWPLVHEA  454
             ++V  +     MK W  ++++
Sbjct  117  SSWVTLNQDVVFMKTWEFLYQS  138



>ref|XP_002986612.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
 gb|EFJ12469.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
Length=235

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 76/127 (60%), Gaps = 5/127 (4%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDAPNLE  259
            RLRIME   M  +P +L AVI+L + D I     +APLS++EI++ +   G  G   NL+
Sbjct  11   RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSGANLD  69

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKD--GLSYGAYVLQHHQAAMMKA  433
            R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL   ++V+ +     MK 
Sbjct  70   RILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIANQDVVFMKT  128

Query  434  WPLVHEA  454
            W  ++++
Sbjct  129  WEFLYQS  135



>ref|XP_002965284.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
 gb|EFJ34122.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
Length=235

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 76/127 (60%), Gaps = 5/127 (4%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDAPNLE  259
            RLRIME   M  +P +L AVI+L + D I     +APLS++EI++ +   G  G   NL+
Sbjct  11   RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSGANLD  69

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKD--GLSYGAYVLQHHQAAMMKA  433
            R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL   ++V+ +     MK 
Sbjct  70   RILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVVFMKT  128

Query  434  WPLVHEA  454
            W  ++++
Sbjct  129  WEFLYQS  135



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 55/91 (60%), Gaps = 21/91 (23%)
 Frame = +2

Query  182  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  361
            +N  LSAS+IL+ +L SGGGDA NL+R+L   T                     E+GK+L
Sbjct  4    ANTHLSASQILTRILSSGGGDAENLQRILLQPT---------------------EIGKSL  42

Query  362  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            VTD +GLSY  YVLQHH  A+M AWPLVHE 
Sbjct  43   VTDAEGLSYAPYVLQHHHDALMSAWPLVHEV  73



>gb|ADE88153.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase-like 
2 [Selaginella moellendorffii]
Length=357

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 76/127 (60%), Gaps = 5/127 (4%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDAPNLE  259
            RLRIME   M  +P +L AVI+L + D I     +APLS++EI++ +   G  G   NL+
Sbjct  11   RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSGANLD  69

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKD--GLSYGAYVLQHHQAAMMKA  433
            R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL   ++V+ +     MK 
Sbjct  70   RILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVVFMKT  128

Query  434  WPLVHEA  454
            W  ++++
Sbjct  129  WEFLYQS  135



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 73/125 (58%), Gaps = 3/125 (2%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLE  259
            RL+IMELA M SVPM+L   + ++VA+ I + G    LSA+EI+S +       +P  L+
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQIPECSSPMSPIYLD  73

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
            R++R+L S  IF+E    +   R+Y +  + K L+ D+ G+S   +VL +     M+ W 
Sbjct  74   RIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETWQ  131

Query  440  LVHEA  454
             +HEA
Sbjct  132  YLHEA  136



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 73/125 (58%), Gaps = 3/125 (2%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLE  259
            RL+IMELA M SVPM+L   + ++VA+ I + G    LSA+EI+S +       +P  L+
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQIPECSSPMSPIYLD  73

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
            R++R+L S  IF+E    +   R+Y +  + K L+ D+ G+S   +VL +     M+ W 
Sbjct  74   RIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETWQ  131

Query  440  LVHEA  454
             +HEA
Sbjct  132  YLHEA  136



>gb|KDO39478.1| hypothetical protein CISIN_1g036218mg, partial [Citrus sinensis]
Length=79

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 20/83 (24%)
 Frame = +2

Query  62   SESDNGARLR--IMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  235
            ++ D G ++R  +MELANMISVPMSL A IRL+                  IL+ +LPSG
Sbjct  5    NQRDGGKKVRLAVMELANMISVPMSLTAAIRLH------------------ILTRILPSG  46

Query  236  GGDAPNLERLLRMLTSYGIFREH  304
            GGDA NL+R+L +LTSYG+F EH
Sbjct  47   GGDAENLQRILCLLTSYGVFSEH  69



>ref|XP_002962074.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
 gb|EFJ37334.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
Length=385

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 75/132 (57%), Gaps = 10/132 (8%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL----PSGGGDAP  250
            R RIMEL  + +VPM+L A IRL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIV-  77

Query  251  NLERLLRMLTSYGIFREHINAD----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
             L R+LR+L S GIFRE +  D    A+ RRY +  + + L+ D  G S   ++  +H  
Sbjct  78   -LNRILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  419  AMMKAWPLVHEA  454
             +M+ W  + +A
Sbjct  137  ILMRPWQFLADA  148



>ref|XP_002971011.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
 gb|EFJ27609.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
Length=385

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 75/132 (57%), Gaps = 10/132 (8%)
 Frame = +2

Query  83   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL----PSGGGDAP  250
            R RIMEL  + +VPM+L A IRL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIV-  77

Query  251  NLERLLRMLTSYGIFREHINAD----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
             L R+LR+L S GIFRE +  D    A+ RRY +  + + L+ D  G S   ++  +H  
Sbjct  78   -LNRILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  419  AMMKAWPLVHEA  454
             +M+ W  + +A
Sbjct  137  ILMRPWQFLADA  148



>gb|KHF97637.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=308

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 82/152 (54%), Gaps = 6/152 (4%)
 Frame = +2

Query  11   RIQKQITGKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNA  190
            ++++  TG  KE  +   + +   +L +  LAN + +PM L + + LN+ D I   G  A
Sbjct  10   KVKQPETGAEKETMSQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGA  68

Query  191  PLSASEILSSVLPSGGGDAPNL-ERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKT  358
             LS S+I +S LPS   DAP L +R+LR+L S+ I +  + A      ER Y    + K 
Sbjct  69   FLSPSQI-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKF  127

Query  359  LVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            LV ++DG S    +L HH    M++W  +++A
Sbjct  128  LVKNQDGGSIAPLLLLHHDQVFMQSWYHLNDA  159



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 60/125 (48%), Gaps = 46/125 (37%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  259
            ARL +MELANMISVPM+L AVIRL                      S  P+G G      
Sbjct  12   ARLAMMELANMISVPMALTAVIRLGF--------------------SPDPAGSG------  45

Query  260  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  439
                                S RR+++  VG+TLV    G SY  YVLQHHQ A+++AWP
Sbjct  46   --------------------SLRRFALTAVGRTLVPGPSGASYADYVLQHHQDALVRAWP  85

Query  440  LVHEA  454
             +HEA
Sbjct  86   RLHEA  90



>gb|KJB16304.1| hypothetical protein B456_002G222400 [Gossypium raimondii]
Length=404

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 82/152 (54%), Gaps = 6/152 (4%)
 Frame = +2

Query  11   RIQKQITGKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNA  190
            ++++  TG  KE  +   + +   +L +  LAN + +PM L + + LN+ D I   G  A
Sbjct  34   KVKQPETGAEKETMSQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGA  92

Query  191  PLSASEILSSVLPSGGGDAPNL-ERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKT  358
             LS S+I +S LPS   DAP L +R+LR+L S+ I +  + A      ER Y    + K 
Sbjct  93   FLSPSQI-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKF  151

Query  359  LVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            LV ++DG S    +L HH    M++W  +++A
Sbjct  152  LVKNQDGGSIAPLLLLHHDQVFMQSWYHLNDA  183



>gb|KHF97352.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG01818.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG22578.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=286

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  271
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  272  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  443  VHEA  454
            +++A
Sbjct  134  LNDA  137



>gb|ABO41840.1| putative caffeic acid methyltransferase [Gossypium arboreum]
Length=358

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  271
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  272  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  443  VHEA  454
            +++A
Sbjct  134  LNDA  137



>gb|ABO41846.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=345

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 73/130 (56%), Gaps = 7/130 (5%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  271
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVILPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  272  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    ++ HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLVLHHDQVFMQSWYH  133

Query  443  VHEA--GGGF  466
            +++A   GGF
Sbjct  134  LNDAILEGGF  143



>gb|ABO41845.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 5/124 (4%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  271
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  272  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCAVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  443  VHEA  454
            +++A
Sbjct  134  LNDA  137



>gb|ABO41834.1| putative caffeic acid methyltransferase [Gossypium raimondii]
Length=358

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 69/124 (56%), Gaps = 5/124 (4%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  271
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  272  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            +L S+ I +  + A      ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  443  VHEA  454
            +++A
Sbjct  134  LNDA  137



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 55/106 (52%), Gaps = 34/106 (32%)
 Frame = +2

Query  239  GDAPNLERLLRMLTSYGIFREHINADAS--------ERRYSVDEVGKTLVTDKDGLSYGA  394
            GDA NL+RLLRML S+G F E   A ++        ERR+S+ EV KTLVTD +GLSY A
Sbjct  20   GDAENLQRLLRMLASHGAFEERFPATSASSASSGCFERRFSLTEVRKTLVTDAEGLSYAA  79

Query  395  YV--------------------------LQHHQAAMMKAWPLVHEA  454
            YV                           +    A+M+AWPLVHEA
Sbjct  80   YVSSSTTRPKKAMERREICLPESRKKRRQKKASDALMRAWPLVHEA  125



>gb|ACD56610.1| putative caffeic acid protein [Gossypioides kirkii]
Length=358

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 68/124 (55%), Gaps = 5/124 (4%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  271
            + LAN + +PM L + + LN+ D I   G    LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTISAAGDGTFLSPSQI-ASCLPSKNPDAPVLLDRMLR  73

Query  272  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            +L S+ I +  + A      ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  443  VHEA  454
            +++A
Sbjct  134  LNDA  137



>gb|AFM73596.1| caffeate O-methyltransferase, partial [Populus simonii]
Length=300

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 67/119 (56%), Gaps = 7/119 (6%)
 Frame = +2

Query  116  SVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLRMLTSYGI  292
            +VPM+L A I L+V + I +GG  A LSA EI +  LP+   DAP  L+R+LR+L SY +
Sbjct  5    AVPMALKAAIELDVLEIIAKGGPGAHLSALEI-ARCLPTQNADAPIMLDRMLRLLASYNV  63

Query  293  FREHI-----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
                I        + ERRY +  V K L+ ++DG+S    VL +     M++W  + EA
Sbjct  64   LTCSIVSLDGGCGSIERRYGLAPVCKFLIRNQDGVSIAPLVLMNQDKVTMESWYHLKEA  122



>gb|AFK39562.1| unknown [Lotus japonicus]
Length=359

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 61/124 (49%), Gaps = 3/124 (2%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  MELA   SVPM L + + L V + I + G  A LS SEI+S +      DA
Sbjct  13   SDEEALLFAMELAGASSVPMVLKSALDLGVIETIAKAGPGAYLSPSEIVSQIPSIKNPDA  72

Query  248  PN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  424
            P+ L RLLR+L SY I          ER Y +    K  V ++DG+S  +  L  H   +
Sbjct  73   PSMLNRLLRLLASYNILT--FQGSEPERHYGLSPYAKYFVNNQDGVSMISSFLMQHDKVL  130

Query  425  MKAW  436
               W
Sbjct  131  KDMW  134



>gb|AET00984.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 4/127 (3%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A    MEL+   + PM L + + L + + I + G NA LS+S I S +      DA
Sbjct  14   SDEEALFFAMELSGASAAPMVLKSALELGIIEIIAKAGPNAHLSSSNIASQIPSIKNPDA  73

Query  248  PN-LERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P+ L+RLLR+L SY I     +H + D+ ER Y +  + K  V ++DG+S  +  L  H 
Sbjct  74   PSMLDRLLRLLASYKILTCSIQHQDGDSIERLYGLHPLAKYFVNNQDGVSMISSFLMQHD  133

Query  416  AAMMKAW  436
              +   W
Sbjct  134  KVLKDMW  140



>ref|XP_003618025.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=361

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 4/127 (3%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A    MEL+   + PM L + + L + + I + G NA LS+S I S +      DA
Sbjct  10   SDEEALFFAMELSGASAAPMVLKSALELGIIEIIAKAGPNAHLSSSNIASQIPSIKNPDA  69

Query  248  PN-LERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P+ L+RLLR+L SY I     +H + D+ ER Y +  + K  V ++DG+S  +  L  H 
Sbjct  70   PSMLDRLLRLLASYKILTCSIQHQDGDSIERLYGLHPLAKYFVNNQDGVSMISSFLMQHD  129

Query  416  AAMMKAW  436
              +   W
Sbjct  130  KVLKDMW  136



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L++ + I + G+ A LS +EI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEFIAKAGTGAQLSPAEI-ASQLPTTNPDA  73

Query  248  PN-LERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I    +  +     +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PTVLDRMLRLLACYNILTCSVRTEQDGKVQRLYGLAPVAKYLVKNEDGVSISALNLMNQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>gb|AFK41218.1| unknown [Medicago truncatula]
Length=361

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 4/127 (3%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A    MEL+   + PM L + + L + + I + G NA LS+S I S +      DA
Sbjct  10   SDEEALFFAMELSGASAAPMVLKSALELGIIEIIAKAGPNAHLSSSNIASQIPSIKNPDA  69

Query  248  PN-LERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P+ L+RLLR+L SY I     +H + D+ ER Y +  + K  V ++DG+S  +  L  H 
Sbjct  70   PSMLDRLLRLLASYKILTCSIQHQDGDSIERLYGLHPLAKYFVNNQDGVSMISSFLMQHD  129

Query  416  AAMMKAW  436
              +   W
Sbjct  130  KVLKDMW  136



>gb|KDO40925.1| hypothetical protein CISIN_1g0357381mg, partial [Citrus sinensis]
Length=235

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = +2

Query  98   ELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRM  274
            +LA  I +PM++ AV  L + + I + G  A LSAS+I ++ L +   DAP  L+R+LR+
Sbjct  18   QLARGIVLPMAMQAVYELGIFEIIDKAGPGAKLSASDI-AAQLTTKNKDAPMMLDRILRL  76

Query  275  LTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  436
            L SY +    ++A  + R YS++ V K  V +KDG+S G  +   H    ++ W
Sbjct  77   LASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVSLGPGIQITHDKVFLECW  130



>ref|XP_006431772.1| hypothetical protein CICLE_v10001661mg [Citrus clementina]
 gb|ESR45012.1| hypothetical protein CICLE_v10001661mg [Citrus clementina]
Length=353

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 7/138 (5%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMIS----VPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV  223
            MGS  D G R +    AN ++    +PM++ AV  L +   I + G  A LSAS+I ++ 
Sbjct  1    MGSIVD-GERDQSFAYANQLAMGTVLPMAMQAVYELGIFQIIDKAGPGAKLSASDI-AAQ  58

Query  224  LPSGGGDAPN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYV  400
            LP+   DAP  L+R+LR+L SY +    ++   + RRYS++ V K  V +KDG+S G  +
Sbjct  59   LPTKNKDAPTMLDRILRLLASYSVVECSLDGSGARRRYSLNSVSKYYVPNKDGVSLGPAL  118

Query  401  LQHHQAAMMKAWPLVHEA  454
                    +++W  + +A
Sbjct  119  QMIQDKVFLESWSHLKDA  136



>gb|KDO44005.1| hypothetical protein CISIN_1g018576mg [Citrus sinensis]
Length=353

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 7/138 (5%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMIS----VPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV  223
            MGS  D G R +    AN ++    +PM++ AV  L +   I + G  A LSAS+I ++ 
Sbjct  1    MGSIVD-GERDQSFAYANQLAMGTVLPMAMQAVYELGIFQIIDKAGPGAKLSASDI-AAQ  58

Query  224  LPSGGGDAPN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYV  400
            LP+   DAP  L+R+LR+L SY +    ++   + RRYS++ V K  V +KDG+S G  +
Sbjct  59   LPTKNKDAPTMLDRILRLLASYSVVECSLDGSGARRRYSLNSVSKYYVPNKDGVSLGPAL  118

Query  401  LQHHQAAMMKAWPLVHEA  454
                    +++W  + +A
Sbjct  119  QMIQDKVFLESWSHLKDA  136



>gb|AFK45226.1| unknown [Lotus japonicus]
Length=359

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 60/124 (48%), Gaps = 3/124 (2%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  MELA   SVPM L + + L V + I + G  A LS SEI S +      DA
Sbjct  13   SDEEALLFAMELAGASSVPMVLKSALDLGVIETIAKAGPGAYLSPSEIASQIPSIKNPDA  72

Query  248  PN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  424
            P+ L RLLR+L SY I          ER Y +    K  V ++DG+S  +  L  H   +
Sbjct  73   PSMLNRLLRLLASYNILT--FQGSEPERHYGLSPYAKYFVNNQDGVSMISSFLMQHDKVL  130

Query  425  MKAW  436
               W
Sbjct  131  KDMW  134



>dbj|BAD18975.1| phloroglucinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=371

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 69/126 (55%), Gaps = 7/126 (6%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLR  271
            + LAN++ +PM L + + LNV D IW  G    LS S+I ++ LP+   +AP  L+R+LR
Sbjct  30   IRLANVVILPMVLKSALELNVIDIIWGAGDGESLSPSDI-AAQLPTKNSNAPAVLDRMLR  88

Query  272  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDG--LSYGAYVLQHHQAAMMKAW  436
            +L S+ I +      +    ER YS   + K LV D++G   S G   L HH    M+ W
Sbjct  89   LLASHSILKCSARTGSDGQVERLYSAGPICKFLVKDQNGGTRSVGPLFLLHHDKVFMEGW  148

Query  437  PLVHEA  454
              +++A
Sbjct  149  FHLNDA  154



>gb|ABO41852.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 68/124 (55%), Gaps = 5/124 (4%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  271
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS    AP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI-ASALPSKNPGAPVLLDRMLR  73

Query  272  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  442
            +L S+ I +  + A      ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  443  VHEA  454
            +++A
Sbjct  134  LNDA  137



>ref|NP_200227.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
 sp|Q9FK25.1|OMT1_ARATH RecName: Full=Flavone 3'-O-methyltransferase 1; Short=AtOMT1; 
AltName: Full=Caffeate O-methyltransferase 1; AltName: Full=Quercetin 
3'-O-methyltransferase 1 [Arabidopsis thaliana]
 dbj|BAB11578.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAL32915.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM10127.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM64849.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AED96460.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
Length=363

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 75/127 (59%), Gaps = 7/127 (6%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASKLPTKNPEA  71

Query  248  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+LTSY +       ++ D  ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  416  AAMMKAW  436
              +M++W
Sbjct  132  KVLMESW  138



>gb|AAB96879.1| O-methyltransferase 1 [Arabidopsis thaliana]
Length=363

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 75/127 (59%), Gaps = 7/127 (6%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASKLPTKNPEA  71

Query  248  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+LTSY +       ++ D  ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  416  AAMMKAW  436
              +M++W
Sbjct  132  KVLMESW  138



>ref|XP_010241050.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Nelumbo nucifera]
Length=364

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 69/119 (58%), Gaps = 7/119 (6%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLR  271
            M+LA+   VPM L A I L+V + I + G+ A +S SEI +S LP+   DAP  L+R+LR
Sbjct  23   MQLASASVVPMVLKAAIELDVLEIIAEAGAGAHISTSEI-ASHLPTQNPDAPVMLDRMLR  81

Query  272  MLTSYGI----FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  436
            +L S+ I     R H +    ER Y +  V K LV ++DG+S    VL +    +M++W
Sbjct  82   LLASFSILTCSLRTHDDGRV-ERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLMESW  139



>ref|XP_006280681.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
 gb|EOA13579.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
Length=363

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 75/127 (59%), Gaps = 7/127 (6%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D+ A L  M+LA+   +PM+L A + L++ + + +  S  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKAALELDLLEIMAKNAS--PMSPTEI-ASKLPTKNPEA  71

Query  248  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+LTSY +       ++ D+ ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  416  AAMMKAW  436
              +M++W
Sbjct  132  KVLMESW  138



>ref|XP_002864309.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40568.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 75/127 (59%), Gaps = 7/127 (6%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASHLPTKNPEA  71

Query  248  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+LTSY +       ++ D  ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  416  AAMMKAW  436
              +M++W
Sbjct  132  KVLMESW  138



>dbj|BAD83867.1| Caffeic acid O-methyltransferase [Iris x hollandica]
Length=365

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (55%), Gaps = 6/128 (5%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+L +   +PM+L A I L++ + I + G  A LS +EI SS LP+   +A
Sbjct  16   SDEEACLYAMQLRSFSVLPMTLKAAIELDLLEIIAKAGPGAYLSPAEI-SSQLPTENPEA  74

Query  248  PNL-ERLLRMLTSYGIFREHINADASE----RRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
            P + +R+LR+L  Y +    ++A   +    RRY  + V K L  ++DG+S  A  L + 
Sbjct  75   PAMIDRMLRLLACYSVVSCRVDAAGDDGKPRRRYGAERVVKYLTKNEDGVSMAALTLMNQ  134

Query  413  QAAMMKAW  436
                M++W
Sbjct  135  DKVFMESW  142



>ref|XP_006478241.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=432

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (53%), Gaps = 2/146 (1%)
 Frame = +2

Query  23   QITGKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  202
            +I G L     M +E  +       EL     + M++ AVI+L + + I + G  A LSA
Sbjct  70   RILGLLASYENMANEQRDENFAYACELVTGSVLHMTMKAVIKLGLFEIIAKAGPGAKLSA  129

Query  203  SEILSSVLPSGGGDAP-NLERLLRMLTSYGIFREHI-NADASERRYSVDEVGKTLVTDKD  376
            SEI + +  +   DAP  L+R+LR+L SYGI +  + + D S R Y +++V K  V+++D
Sbjct  130  SEIAAQLPATKNKDAPMMLDRILRLLASYGIVQCSLDDVDGSHRLYGLNDVSKYFVSNQD  189

Query  377  GLSYGAYVLQHHQAAMMKAWPLVHEA  454
            G+S G  +      A + +W  + E 
Sbjct  190  GVSLGPVLALIQDKAFLDSWSQLKET  215



>dbj|BAD87408.1| O-diphenol-O-methyl transferase-like [Oryza sativa Japonica Group]
 dbj|BAD87053.1| O-diphenol-O-methyl transferase-like [Oryza sativa Japonica Group]
Length=116

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 53/97 (55%), Gaps = 13/97 (13%)
 Frame = +2

Query  50   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  229
            G  G  S   A L +MEL NMISV M+L A IRL+V   +W  G+NAP           P
Sbjct  26   GGDGDLSPTDACLTVMELVNMISVLMALTAAIRLDVPAKLWARGANAP----------FP  75

Query  230  SGGGDAPNLERLLRMLTSYGIFREHINADASERRYSV  340
            +G  +   LERLLR+LTS  +F EH     S R +++
Sbjct  76   TGHPNPFVLERLLRLLTSCSVFCEH---KGSPRHFAL  109



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 74/133 (56%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L++ + I +GG    LS S+I +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIIAKGGPGVHLSPSQI-ASQLPTRNPEA  73

Query  248  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLASYNILSFTLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_010069184.1| PREDICTED: uncharacterized protein LOC104456144 [Eucalyptus grandis]
Length=144

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = +2

Query  236  GGDAPNLERLLRMLTSYGIFREHINADAS--------ERRYSVDEVGKTLVTDKDGLSYG  391
             GDA NL+RLLRML S+G F E   A ++        ERR+S+ EV KTLVTD +GLSY 
Sbjct  19   AGDAENLQRLLRMLASHGAFEERFPATSASSASSGCFERRFSLTEVRKTLVTDAEGLSYA  78

Query  392  AYV  400
            AYV
Sbjct  79   AYV  81



>gb|ABU53653.1| caffeic acid O-3-methyltransferase [Populus deltoides]
Length=364

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGI----FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
            P  L+R+LR+L SY I     ++H +    ER Y +  V K L  ++DG+S     L + 
Sbjct  74   PVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVSVSPLCLMNQ  132

Query  413  QAAMMKAWPLVHEA  454
               +M++W  + +A
Sbjct  133  DKVLMESWYYLKDA  146



>prf||1906376A O-methyltransferase
Length=364

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGI----FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
            P  L+R+LR+L SY I     ++H +    ER Y +  V K L  ++DG+S     L + 
Sbjct  74   PVMLDRILRLLASYSILICSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVSVSPLCLMNQ  132

Query  413  QAAMMKAWPLVHEA  454
               +M++W  + +A
Sbjct  133  DKVLMESWYYLKDA  146



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 73/133 (55%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L++ + + + G +A LS SEI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPSAFLSPSEI-ASQLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY +    +        ER Y +  V K L+ ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLAPVCKFLIKNEDGVSIAPLCLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>gb|AAF60951.1| O-methyltransferase [Populus trichocarpa x Populus deltoides]
Length=364

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGI----FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
            P  L+R+LR+L SY I     ++H +    ER Y +  V K L  ++DG+S     L + 
Sbjct  74   PVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVSVSPLCLMNQ  132

Query  413  QAAMMKAWPLVHEA  454
               +M++W  + +A
Sbjct  133  DKVLMESWYYLKDA  146



>ref|XP_006478347.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=352

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 72/135 (53%), Gaps = 2/135 (1%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  235
            M +E  + +     +L     +PM++ AVI L V + I + G  A LSASEI + +  + 
Sbjct  1    MANEGRDESFAYANQLVTASVLPMTMQAVIGLGVFEIIAKAGPGAKLSASEIAAQLPATK  60

Query  236  GGDAP-NLERLLRMLTSYGIFREHI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
              DAP  L+R+LR+L S+ +    I +AD  +R Y +++V    V +KDG+S+G  +   
Sbjct  61   NKDAPMMLDRMLRLLASHSVVECSIDDADDYQRLYGLNDVSNYFVPNKDGVSFGPVLALI  120

Query  410  HQAAMMKAWPLVHEA  454
                 M +W  + EA
Sbjct  121  QDKVFMDSWSQLKEA  135



>ref|XP_006401613.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
 gb|ESQ43066.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
Length=364

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 74/128 (58%), Gaps = 8/128 (6%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D+ A L  M+LA+   +PM+L + + L++ + + +  +  P+S SEI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPSEI-ASHLPTKNPEA  71

Query  248  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
            P  L+R+LR+LT+Y +     R   N D  ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  413  QAAMMKAW  436
               +M++W
Sbjct  132  DKVLMESW  139



>dbj|BAJ34520.1| unnamed protein product [Thellungiella halophila]
Length=364

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 74/128 (58%), Gaps = 8/128 (6%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D+ A L  M+LA+   +PM+L + + L++ + + +  +  P+S SEI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPSEI-ASHLPTKNPEA  71

Query  248  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
            P  L+R+LR+LT+Y +     R   N D  ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  413  QAAMMKAW  436
               +M++W
Sbjct  132  DKVLMESW  139



>ref|XP_006441603.1| hypothetical protein CICLE_v10020875mg [Citrus clementina]
 gb|ESR54843.1| hypothetical protein CICLE_v10020875mg [Citrus clementina]
Length=352

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 72/135 (53%), Gaps = 2/135 (1%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  235
            M +E  + +     +L     +PM++ A+I L V + I + G  A L ASEI + +  + 
Sbjct  1    MANERRDESFAYANQLVTASVLPMTMQAIIGLGVFEIIAKAGPGAKLPASEIAAQLPATK  60

Query  236  GGDAPN-LERLLRMLTSYGIFREHIN-ADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
              DAP  L+R+LR+L S+ +    I+ AD S+R Y +++V    V +KDG+S+G  +   
Sbjct  61   NKDAPMMLDRMLRLLASHSVVECSIDDADDSQRLYGLNDVSNYFVPNKDGVSFGPVLALI  120

Query  410  HQAAMMKAWPLVHEA  454
                 M +W  + EA
Sbjct  121  QDKVFMDSWSQLKEA  135



>ref|XP_006478225.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=252

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 2/114 (2%)
 Frame = +2

Query  119  VPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLRMLTSYGIF  295
            +PM++ AVI L V + I + G  A LSASEI + +  +   DAP  L+R+LR+L S+   
Sbjct  22   LPMAMQAVIGLGVFEIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRMLRLLASHSAV  81

Query  296  REHI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
               I +AD S+R Y +++V    V +KDG+S G  +        M +W  + EA
Sbjct  82   ECSIDDADDSQRLYGLNDVSNYFVPNKDGVSLGPMLALIQDKVFMDSWSQLKEA  135



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  332  YSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            YS+ E+GK+LVTD +GLSY  YVLQHHQ A+M  WPLVH+A
Sbjct  2    YSLTEIGKSLVTDVEGLSYAPYVLQHHQDALMSMWPLVHKA  42



>gb|AEV93478.1| caffeic acid O-methyltransferase [Caragana korshinskii]
Length=365

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 73/133 (55%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G  A LS ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAHLSPNDI-ASQLPTNNPDA  73

Query  248  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y IF      +     +R Y +  V K L+ ++DG+S  A  L +  
Sbjct  74   PIMLDRMLRLLACYNIFTCSLRTLQDGKVQRLYGLAPVAKYLIKNEDGVSLSALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>gb|KDP36008.1| hypothetical protein JCGZ_10407 [Jatropha curcas]
Length=365

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+  ++PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASTLPMVLKSAIELDLLEIIAKAGPGAFLSPHDI-ASQLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +     +  ER Y +  V K L  ++DG+S+ +  +    
Sbjct  74   PLVLDRILRLLASYSILTCSLRTLPDEKFERLYGLAPVCKFLTKNEDGVSFASICVMIQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>ref|XP_006478224.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
Length=253

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 2/114 (2%)
 Frame = +2

Query  119  VPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLRMLTSYGIF  295
            +PM++ AVI L V + I + G  A LSASEI + +  +   DAP  L+R+LR+L S+   
Sbjct  22   LPMAMQAVIGLGVFEIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRMLRLLASHSAV  81

Query  296  REHI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
               I +AD S+R Y +++V    V +KDG+S G  +        M +W  + EA
Sbjct  82   ECSIDDADDSQRLYGLNDVSNYFVPNKDGVSLGPMLALIQDKVFMDSWSQLKEA  135



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEI-ASQLPTTNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSIAALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_006401618.1| hypothetical protein EUTSA_v10013896mg [Eutrema salsugineum]
 gb|ESQ43071.1| hypothetical protein EUTSA_v10013896mg [Eutrema salsugineum]
Length=365

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 8/137 (6%)
 Frame = +2

Query  41   KEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSS  220
            K+I  +    D+ A L  M+LA+   +PM+L  VI L + + + +  S  P+S SEI +S
Sbjct  7    KQITPVQVTDDDEAALFAMQLAHAPVLPMALKPVIELGILEIMAKNSS--PMSPSEI-AS  63

Query  221  VLPSGGGDAP-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLS  385
             LP+   +AP  L+R+LR+L +Y I     R   + D  ER Y +  V K L  ++DG+S
Sbjct  64   HLPTKNPEAPVMLDRILRLLAAYSILTCSLRTLPDGDGVERLYGLGPVCKYLTKNEDGVS  123

Query  386  YGAYVLQHHQAAMMKAW  436
              A  L +     M++W
Sbjct  124  IAALCLVNQDKVGMESW  140



>gb|AAV36348.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36366.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +  +    +ER Y +  + K LV ++DG+S    VL +    +M++W  V
Sbjct  76   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYV  135

Query  446  HEA  454
             +A
Sbjct  136  KDA  138



>ref|XP_002320237.1| eugenol O-methyltransferase family protein [Populus trichocarpa]
 gb|ABK92890.1| unknown [Populus trichocarpa]
 gb|EEE98552.1| eugenol O-methyltransferase family protein [Populus trichocarpa]
Length=358

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLR  271
            M+LA    +PM++ + I+L + + I + G +A LSAS++ ++ LP+   DAP  L+R+LR
Sbjct  24   MQLALSSVLPMTMYSAIQLGIFEIIAKAGPDAKLSASDV-AAQLPTKNPDAPMMLDRILR  82

Query  272  MLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHE  451
            +L S+ +     + D SER YS+  V K  V +KDG+S G ++        +++W  + +
Sbjct  83   LLASHDVLG--CSVDGSERLYSLAPVSKHYVRNKDGVSLGPFMALIQDNVFLQSWSQLKD  140

Query  452  A  454
            A
Sbjct  141  A  141



>gb|EPS67212.1| hypothetical protein M569_07558 [Genlisea aurea]
Length=364

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 70/126 (56%), Gaps = 5/126 (4%)
 Frame = +2

Query  71   DNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP  250
            + GA L  M+LA+   +PM L + I LN+ + I   G+ + +S +E L++ LP+   DAP
Sbjct  17   EEGAFLFAMQLASASVLPMVLKSAIELNLLELIKTSGAGSFVSPAE-LAAQLPASNADAP  75

Query  251  N-LERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
              ++R+LR+L  Y +    +   A    ERRY +  V K L  ++DG+S    VL +   
Sbjct  76   VVIDRILRLLACYDVLSCRVETLADGGIERRYGLGPVCKFLTKNEDGVSMAPLVLMNQDK  135

Query  419  AMMKAW  436
             +M++W
Sbjct  136  VLMESW  141



>ref|XP_006478222.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=352

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = +2

Query  119  VPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLRMLTSYGIF  295
            +PM++ A+I L V + I + G  A LSASEI + +  +   DAP  L+R+LR+L S+ + 
Sbjct  22   LPMTMQAIIGLGVFEIIAKAGPGAKLSASEIAAQLPVTKNKDAPMMLDRMLRLLASHSVV  81

Query  296  REHI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
               I +AD S+R Y +++V    V +KDG+S G  +        M +W  + EA
Sbjct  82   ECSIDDADDSQRLYGLNDVSNYFVPNKDGVSLGPMLALIQDKVFMDSWSQLKEA  135



>prf||2119166A caffeic acid O-methyltransferase
Length=365

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 68/132 (52%), Gaps = 3/132 (2%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L+V + I + G    LS ++I ++V  +    A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDVLEIIAKAGPGVHLSPADIAANVPTTNPDAA  74

Query  248  PNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
              L+R+LR+L  Y I    +        ER Y +  V K LV ++DG+S  A  L +H  
Sbjct  75   VMLDRMLRLLACYNILNHSLRTLPDGKVERLYGLAPVAKFLVKNEDGVSLSALNLMNHDK  134

Query  419  AMMKAWPLVHEA  454
             +M++W  + E 
Sbjct  135  VLMESWYYLKET  146



>emb|CDX78145.1| BnaA09g33400D [Brassica napus]
Length=547

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 47/73 (64%), Gaps = 17/73 (23%)
 Frame = +2

Query  65   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  244
            E +N ARL     ANMISVPMSL A +RL +ADAIW  G+N+ LSASEIL          
Sbjct  492  EEENKARL-----ANMISVPMSLNAAVRLGIADAIWNSGANSTLSASEILP---------  537

Query  245  APNLERLLRMLTS  283
               L+R+LRMLTS
Sbjct  538  ---LQRILRMLTS  547



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_011043758.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Populus euphratica]
Length=365

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_006478243.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like, partial 
[Citrus sinensis]
Length=214

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = +2

Query  125  MSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFRE  301
            M++ AVI+L + + I + G  A LSASEI + +  +   DAP  L+R+L +L SYGI   
Sbjct  51   MTMKAVIKLGLLEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVEC  110

Query  302  HI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
             + + D S R Y +++V K  V ++DG+S G  +      A + +W  + E 
Sbjct  111  SLDDVDGSHRLYGLNDVSKYFVPNQDGVSLGPVLALIQDEAFLDSWSQLKET  162



>gb|AAF63200.1| caffeic acid O-3-methyltransferase [Populus tomentosa]
Length=360

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS SE+ +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEV-ASQLPTTNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSIAALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>dbj|BAK42963.1| caffeic acid O-methylltransferase [Chrysanthemum x morifolium]
Length=355

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 72/129 (56%), Gaps = 2/129 (2%)
 Frame = +2

Query  53   AMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPS  232
            A+ ++ D  A L  M+LA+   +PM L + I L++ + I + G  A +S +E+ + +   
Sbjct  5    ALDAKKDEEAFLFAMQLASASVLPMVLKSAIELDLLEIIAKAGPGAYVSPTELAAQLPKV  64

Query  233  GGGDAP-NLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
               +AP  L+R+ R+L SY +    +N D SER Y +  V K LV ++DG+S    +L +
Sbjct  65   ENPEAPVMLDRICRLLASYSVLTCKLN-DQSERLYGLAPVCKYLVKNEDGVSNAPLLLMN  123

Query  410  HQAAMMKAW  436
                +M++W
Sbjct  124  QDKILMESW  132



>ref|XP_011039447.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Populus euphratica]
Length=358

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 71/121 (59%), Gaps = 4/121 (3%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLR  271
            M+LA    +PM++ + I+L + + I + G +A LSAS++ ++ LP+   DAP  L+R+LR
Sbjct  24   MQLALSSVLPMTMYSAIQLGIFEIIAEAGPDAKLSASDV-AAQLPTKNPDAPMMLDRILR  82

Query  272  MLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHE  451
            +L S+ +     + D SER YS+  V K  V +KDG+S   ++        +++W  + +
Sbjct  83   LLASHDVLV--CSVDGSERLYSLAPVSKHFVRNKDGVSLAPFMALIQDNVFLQSWSQLKD  140

Query  452  A  454
            A
Sbjct  141  A  141



>gb|KDP28404.1| hypothetical protein JCGZ_14175 [Jatropha curcas]
Length=383

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 63/117 (54%), Gaps = 4/117 (3%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLR  271
            M+L N   +PM+L   I L + + +   G N  LSA EI + ++P+   +AP  LER+LR
Sbjct  39   MQLVNASVLPMTLKTAIDLGILNILASAGPNVNLSAEEI-AVLIPTRNPEAPGMLERILR  97

Query  272  MLTSYGIFREHINADA--SERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  436
            +L SY +    +  +   +ER+Y +  V K  V D+DG+S    +   H    +++W
Sbjct  98   LLVSYSVLGCSVGFEVQGTERKYCLGPVAKYFVRDEDGVSLAPLMALTHDKVFLESW  154



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  248  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>gb|AHY28755.1| caffeate O-methyltransferase, partial [Pinus palustris]
Length=189

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  19   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  78

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +  +    +ER Y +  + K LV ++DG+S    VL +    +M++W  +
Sbjct  79   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  138

Query  446  HEA  454
             +A
Sbjct  139  KDA  141



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  248  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>gb|AAV36304.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36306.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36314.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36318.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36320.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36322.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36326.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36328.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36332.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36336.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36340.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36342.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36344.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36352.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36356.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36358.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36360.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36362.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +  +    +ER Y +  + K LV ++DG+S    VL +    +M++W  +
Sbjct  76   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  446  HEA  454
             +A
Sbjct  136  KDA  138



>ref|XP_007223223.1| hypothetical protein PRUPE_ppa007212mg [Prunus persica]
 gb|EMJ24422.1| hypothetical protein PRUPE_ppa007212mg [Prunus persica]
Length=377

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 69/126 (55%), Gaps = 7/126 (6%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  271
            + LAN++ +PM L + I LN+ D I   G    LS SEI +S LP+   DA  L +R+LR
Sbjct  32   IRLANVVILPMVLKSAIELNIIDIISAAGDGKFLSPSEIAAS-LPTKNPDASVLLDRMLR  90

Query  272  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDK-DGL-SYGAYVLQHHQAAMMKAW  436
            +LTS+ I +  +        ER Y    + K LV D+ DG+ S G  +L HH    M++W
Sbjct  91   LLTSHSILKCSVRTGQDGKVERLYGAGALCKFLVKDQHDGVGSVGPLLLLHHDKVFMESW  150

Query  437  PLVHEA  454
               ++A
Sbjct  151  CHFNDA  156



>gb|KDP24164.1| hypothetical protein JCGZ_25821 [Jatropha curcas]
Length=360

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 61/114 (54%), Gaps = 0/114 (0%)
 Frame = +2

Query  113  ISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGI  292
            I +PM +   I L + D I + G +A LSAS+I + +  S       L+R+LR+L S  +
Sbjct  29   IVLPMVMQTAIELGIFDIIAKAGPDAKLSASDIAAQLSASNPSAPSMLDRILRLLASNSV  88

Query  293  FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
                + ++  +R Y +    K  V +KDG+S G +++ +     M++WP V +A
Sbjct  89   LGCSLASNTQQRLYHLISASKYFVKNKDGVSLGPFMILNQDKVYMESWPSVKDA  142



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++ LSS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSSQLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        ER Y +  V K L   +DG S G+  L +  
Sbjct  74   PVMLDRMLRVLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKSEDGASIGSLCLMNQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>ref|XP_008219627.1| PREDICTED: LOW QUALITY PROTEIN: caffeic acid 3-O-methyltransferase-like 
[Prunus mume]
Length=371

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 68/126 (54%), Gaps = 7/126 (6%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  271
            + LAN + +PM L + I LN+ D I   G    LS SEI +S LP+   +AP L +R+LR
Sbjct  31   IRLANAVILPMVLKSAIELNIIDIISAAGDGKFLSPSEIAAS-LPTKNPNAPVLLDRMLR  89

Query  272  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDK-DGL-SYGAYVLQHHQAAMMKAW  436
            + TS+ I +  +        ER Y    + K LV D+ DG+ S G  +L HH    M++W
Sbjct  90   LFTSHSILKCSVRTGQDGKVERLYGAGALCKFLVKDQHDGVGSVGPLLLLHHDKVFMESW  149

Query  437  PLVHEA  454
               ++A
Sbjct  150  CHFNDA  155



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++ L+S LP+   DA
Sbjct  15   SDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPAD-LASQLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG S G+  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGASIGSLCLMNQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>gb|KDO44721.1| hypothetical protein CISIN_1g036188mg, partial [Citrus sinensis]
Length=210

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 68/120 (57%), Gaps = 2/120 (2%)
 Frame = +2

Query  98   ELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRM  274
            +LA  + +PM++ AV  L + + + + G    LSAS+I + +L +   DAP  L+R+LR+
Sbjct  18   QLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLL-TKNKDAPMMLDRILRL  76

Query  275  LTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            L SY +    ++A  + R YS++ V K  V +KDG+  G  +       ++++W  + +A
Sbjct  77   LASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVILESWSQLKDA  136



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  248  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV  +DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKTEDGVSIAALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>gb|EAY75657.1| hypothetical protein OsI_03563 [Oryza sativa Indica Group]
 gb|EAZ13379.1| hypothetical protein OsJ_03298 [Oryza sativa Japonica Group]
Length=76

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 13/82 (16%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL NMISV M+L A IRL+V   +W  G+NAP           P+G  +   LERLLR+
Sbjct  1    MELVNMISVLMALTAAIRLDVPAKLWARGANAP----------FPTGHPNPFVLERLLRL  50

Query  275  LTSYGIFREHINADASERRYSV  340
            LTS  +F EH     S R +++
Sbjct  51   LTSCSVFCEH---KGSPRHFAL  69



>gb|AAV36308.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36310.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36312.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36316.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36324.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36330.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36334.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36338.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36350.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36364.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +       +ER Y +  + K LV ++DG+S    VL +    +M++W  +
Sbjct  76   LASHSVLSCSVTTSENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  446  HEA  454
             +A
Sbjct  136  KDA  138



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD+ A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  37   SDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-ASKLPTTNPDA  95

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  96   PVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  155

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  156  KVLMESWYYLKDA  168



>gb|AAV36346.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +       +ER Y +  + K LV ++DG+S    VL +    +M++W  +
Sbjct  76   LASHSVLSCSVTTSENGKAERFYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  446  HEA  454
             +A
Sbjct  136  KDA  138



>gb|AER35881.1| S-adenosyl-L-methionine:flavonoid O-methyltransferase [Ginkgo 
biloba]
Length=362

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM++ A + L+V   I   G  A +S  EI++ +  +    A  L+R+LR+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLDRILRV  79

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +  D    + R Y +  + K LV +KDG+S    VL +     M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTGRVYGLTPLCKYLVQNKDGVSLAPLVLMNQDKVFMESWYYL  139

Query  446  HEA  454
             +A
Sbjct  140  KDA  142



>gb|AHA44835.1| caffeate O-methyltransferase [Larix kaempferi]
Length=364

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  24   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  83

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +    +M+ W  +
Sbjct  84   LASHSVLSCSVTTDENGKAERLYGLTALCKYLVKNQDGVSLAPLVLMNQDKVLMECWYYL  143

Query  446  HEA  454
             +A
Sbjct  144  KDA  146



>gb|AAV36354.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +       +ER Y +  + K LV ++DG+S    VL +    +M++W  +
Sbjct  76   LASHSVLSCSVTTSENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  446  HEA  454
             +A
Sbjct  136  KDA  138



>gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>gb|ABR18380.1| unknown [Picea sitchensis]
Length=365

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 72/146 (49%), Gaps = 13/146 (9%)
 Frame = +2

Query  56   MGSESDNGA-RLRI---------MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSAS  205
            MGS S+N    ++I         MEL N   +PM + A I L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNMKIVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  206  EILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKD  376
            +I++ +  +    A  L+R+LR+L S+ +    +  D    +ER Y +  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVNNQD  120

Query  377  GLSYGAYVLQHHQAAMMKAWPLVHEA  454
            G+S    VL +    +M+ W  + +A
Sbjct  121  GVSLAPLVLMNQDKVLMETWYYLKDA  146



>ref|XP_008347322.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=140

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD    L  M+LAN   +PM L   + L++ + + + G  A +S ++ L+S LP+   DA
Sbjct  15   SDQETNLFAMQLANAPVLPMVLKTALELDLLEIMAKVGPGAFVSPAD-LASQLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S     L    
Sbjct  74   PVMLDRMLRLLASYSILTHSLRTLPDGNVERLYGLGPVCKFLTKNEDGVSIAPLCLMSQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>ref|XP_009119948.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Brassica rapa]
 emb|CDY14330.1| BnaA10g07250D [Brassica napus]
Length=362

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 74/132 (56%), Gaps = 6/132 (5%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D+   L  ++LA+   +PM+L + I L++ + + +  S  P+SASEI SS LP+   +A
Sbjct  15   TDDETALFAIQLASASVLPMALKSAIELDLLEIMARNCS--PMSASEI-SSHLPTKNPEA  71

Query  248  P-NLERLLRMLTSYGIFREHINA--DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
            P  L+R+LR+LT+Y +    +    D  +R Y +  V K  + ++DG+S     L +H  
Sbjct  72   PVMLDRILRLLTAYSVLTCSVRTLPDGVDRLYGLGPVCKYFIKNEDGVSIAPLCLLNHDK  131

Query  419  AMMKAWPLVHEA  454
              M +W  + +A
Sbjct  132  VFMGSWYYLKDA  143



>gb|ACT32028.1| caffeic acid O-methyltransferase 1 [Gossypium hirsutum]
Length=366

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD+ A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  15   SDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-ASKLPTTNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPVCKFLTRNEDGVTLSALSLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_010537046.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=366

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 73/128 (57%), Gaps = 6/128 (5%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQ-GGSNAPLSASEILSSVLPSGGGD  244
            SD+ A L  M+LA+   +PM L + I L++ + + +  G +A +S S+I +S LP+   D
Sbjct  15   SDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKNAGFSAQMSPSDI-ASHLPTKNPD  73

Query  245  AP-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  412
            AP  L+R+LR+L SY I    +   +S   ER Y +  V K L  ++DG+S  A  L + 
Sbjct  74   APVMLDRILRLLASYSILTCSVRTLSSGGVERLYGLGPVCKYLTKNEDGVSIAALCLMNQ  133

Query  413  QAAMMKAW  436
               +M++W
Sbjct  134  DKVLMESW  141



>gb|ADP00412.1| putative methyltransferase [Catharanthus roseus]
Length=364

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 70/121 (58%), Gaps = 5/121 (4%)
 Frame = +2

Query  86   LRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLER  262
            LR+M+L++ + +PM L  VI L++ + + + G NA LSA EI SS+LP+   +AP  L+R
Sbjct  21   LRVMQLSSGLILPMILKTVIELDLFELMAKAGPNAQLSAIEI-SSLLPTKNPEAPVMLDR  79

Query  263  LLRMLTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKA  433
            +L+ L S+     ++ AD    ++  YS   + K  + D+DG+S  + ++     A   +
Sbjct  80   ILKFLASFSFLNCNVIADEQGGAKTLYSSAPICKKFLPDEDGISLASLLMLPVDKAHFDS  139

Query  434  W  436
            W
Sbjct  140  W  140



>gb|AGR85824.1| caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=306

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ ++ LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGASLSPKEV-AAQLPTTNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    + +      ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLRSLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_009418616.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 73/144 (51%), Gaps = 3/144 (2%)
 Frame = +2

Query  32   GKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI  211
            G LK    +  E D  A +  M+LA+   +PM+L A I L++ + + + G  A LS +++
Sbjct  2    GSLKNALQLTPEEDEDACMYAMQLASASILPMTLKAAIELDLLEILVRAGPGAQLSPADV  61

Query  212  LSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGL  382
            ++ +       A  ++R+LR+L +Y +    +  DA     R+Y      K L  ++DG+
Sbjct  62   VAQLPTENPQAAVMVDRMLRLLAAYNVVSCTVGTDADGKPSRKYGAAPACKYLTKNEDGV  121

Query  383  SYGAYVLQHHQAAMMKAWPLVHEA  454
            S  A  L +    +M++W  + +A
Sbjct  122  SMAALTLMNQDKVLMESWYYLKDA  145



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 76/137 (55%), Gaps = 5/137 (4%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  235
            +GSE +  A L  M+LA+   +PM L + I L++ + + + G  A +S +E L++ LP+ 
Sbjct  16   VGSEEEEEACLFAMQLASASVLPMVLKSAIELDLLETMAKAGPGAFVSPTE-LAAQLPTQ  74

Query  236  GGDAP-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVL  403
              DA   L+R+LR+LTSY +    + +      ER Y++  V K L  + DG+S    +L
Sbjct  75   NPDAAVMLDRILRLLTSYSVLNCSVKSLPGGGVERLYALAPVCKYLTRNSDGVSMAPLLL  134

Query  404  QHHQAAMMKAWPLVHEA  454
             +    +M++W  + +A
Sbjct  135  MNQDKVLMESWYYLKDA  151



>ref|XP_008788729.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase [Phoenix 
dactylifera]
Length=367

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 3/132 (2%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D  A +  ++LA+   +PM+L   I L+V + I + GS A LS +E+ + +       A
Sbjct  19   ADEEACMYALQLASASILPMTLKNAIELDVLEIIAKAGSAAKLSPAEVAAQLPTKNPMAA  78

Query  248  PNLERLLRMLTSYGIFREHINADASE---RRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
              L+R+LR+L SY +    +  DA     RRY    V K L  ++DG+S  A  L +   
Sbjct  79   AMLDRMLRLLASYNVLTCSVEVDADGKPLRRYGPAPVCKWLTKNEDGVSMAALTLMNQDK  138

Query  419  AMMKAWPLVHEA  454
             +M++W  + +A
Sbjct  139  ILMESWYYLKDA  150



>sp|Q8W013.1|COMT1_CATRO RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Catharanthus roseus]
 gb|AAK20170.1| caffeic acid O-methyltransferase [Catharanthus roseus]
Length=363

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (56%), Gaps = 5/129 (4%)
 Frame = +2

Query  62   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  241
            ++ +  A L  M LA+   +PM L + I L++ + I + G  A +S SE L++ LP+   
Sbjct  13   TKEEEEACLSAMRLASASVLPMVLKSAIELDLLELIKKSGPGAYVSPSE-LAAQLPTQNP  71

Query  242  DAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
            DAP  L+R+LR+L SY +     + +     ER YS+  V K L  ++DG+S  A +L +
Sbjct  72   DAPVMLDRILRLLASYSVLNCTLKDLPDGGIERLYSLAPVCKFLTKNEDGVSMAALLLMN  131

Query  410  HQAAMMKAW  436
                +M++W
Sbjct  132  QDKVLMESW  140



>ref|XP_004502769.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=365

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 76/147 (52%), Gaps = 13/147 (9%)
 Frame = +2

Query  8    SRIQKQITGKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSN  187
            S ++ QIT          + SD  A L  M+LA+   +PM L + + L++ + I + G  
Sbjct  3    STVETQITPT--------NVSDEEAALFAMQLASASVLPMVLKSALELDLLEIIAKAGPA  54

Query  188  APLSASEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGK  355
            A LS  EI +S LP+   DAP  L+R+LR+L  Y I       ++    +R Y +  V K
Sbjct  55   AHLSPYEI-ASQLPTNNPDAPVMLDRILRLLACYNILTCSLTTLHDGKVQRLYGLATVAK  113

Query  356  TLVTDKDGLSYGAYVLQHHQAAMMKAW  436
             LV ++DG+S  A  L +    +M++W
Sbjct  114  YLVKNEDGVSISALNLMNQDKILMESW  140



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS S+I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPSDI-ASRLPTHNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I    +        ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPHGKVERLYGLAPVAKYLVRNEDGVSIAALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KILMESWYYLKDA  146



>ref|XP_008364894.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=140

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD    L  M+LA+    PM L A + L++ + + + G  A +S ++ L+S LP+   DA
Sbjct  15   SDEETNLFAMQLASASVPPMVLKAALELDLLEIMAKAGPGAFVSPAD-LASQLPTKNPDA  73

Query  248  PN-LERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY IF   +        ER Y +  V K L  ++DG+S   ++L    
Sbjct  74   PVILDRMLRLLASYSIFTYSLRTLPDGKVERLYGLGPVCKLLTKNEDGVSIAPHLLLTQD  133

Query  416  AAMMKAW  436
              ++++W
Sbjct  134  KVLVESW  140



>emb|CCC55423.1| caffeic acid O-3-methyltransferase [Pinus pinaster]
Length=364

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR 
Sbjct  24   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRA  83

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +    +M++W  +
Sbjct  84   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  143

Query  446  HEA  454
             +A
Sbjct  144  KDA  146



>ref|XP_010103059.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB94708.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=264

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L   + L++ + + + G  A LS S+++S  LP+    A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKTALDLDLLEIMAKAGPGAYLSPSDVVSQ-LPTKNPGA  73

Query  248  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I      ++     ER Y +  V K L  ++DG+S G+  L +  
Sbjct  74   PVMLDRVLRLLASYSILTYSLRNLPDGKVERLYGLGPVCKYLTKNEDGVSIGSLCLMNQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>gb|KDP30064.1| hypothetical protein JCGZ_18389 [Jatropha curcas]
Length=365

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 70/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIIGKAGPGAFLSPYDI-ASQLPTKNPDA  73

Query  248  PN-LERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        E+ Y +  V K L  ++DG+S     L +  
Sbjct  74   PVVLDRILRLLASYSILTYSLRTLPDGKVEKLYGLAPVCKFLTKNEDGVSIAPLCLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + EA
Sbjct  134  KVLMESWYHLKEA  146



>gb|AFD61598.1| caffeic acid 3-O-methyltransferase [Hevea brasiliensis]
 gb|AGD80033.1| caffeic acid O-methyltransferase [Hevea brasiliensis]
Length=368

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 71/139 (51%), Gaps = 6/139 (4%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAI-WQGGSNAPLSASEILSSVLPS  232
            M   SD       ++LAN + +PM L + + LNV D I   G S A LSA EI   +  +
Sbjct  13   MSGRSDEETWNLAIDLANTVILPMVLKSALELNVIDIISTAGNSGASLSAPEIAQRIPEA  72

Query  233  GGGDAPN-LERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGL-SYGAY  397
               +AP  L+R+LR+L +Y I +   N   +   ER Y+   + K L  +K+G  S    
Sbjct  73   KNPEAPVLLDRMLRLLATYDIVKCSSNTKENGEVERLYAPGPICKFLTKNKNGSGSAAPL  132

Query  398  VLQHHQAAMMKAWPLVHEA  454
            +L HH    MK+W  ++EA
Sbjct  133  LLLHHDEVFMKSWYHLNEA  151



>ref|XP_010034911.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Eucalyptus 
grandis]
 gb|KCW46118.1| hypothetical protein EUGRSUZ_K00041 [Eucalyptus grandis]
Length=365

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 68/121 (56%), Gaps = 5/121 (4%)
 Frame = +2

Query  86   LRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LER  262
            L  M+LA+   +PM L   + L+V + + + G +A LS  EI +S LP+   DAP  L+R
Sbjct  23   LYAMQLASAAELPMVLKTALELDVLEIMAKAGPSACLSPREI-ASQLPTKNPDAPTMLDR  81

Query  263  LLRMLTSYGIFR--EHINADA-SERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKA  433
            +LR+L ++ +     H   D  +ER Y +  V K L  ++DG+S  +  L +H   +M++
Sbjct  82   ILRLLATHSVVTCTMHKLPDGRAERLYGIAPVCKFLTKNEDGVSVASLCLMNHDKVLMES  141

Query  434  W  436
            W
Sbjct  142  W  142



>ref|XP_006441599.1| hypothetical protein CICLE_v10020870mg [Citrus clementina]
 ref|XP_006441601.1| hypothetical protein CICLE_v10020873mg [Citrus clementina]
 gb|ESR54839.1| hypothetical protein CICLE_v10020870mg [Citrus clementina]
 gb|ESR54841.1| hypothetical protein CICLE_v10020873mg [Citrus clementina]
Length=352

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = +2

Query  125  MSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFRE  301
            M++ AVI+L + + I + G  A LSASEI + +  +   DAP  L+R+L +L SYGI   
Sbjct  24   MTMKAVIKLGLLEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVEC  83

Query  302  HI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
             + + D S R Y +++V K  V ++DG+S G  +      A + +W  + E 
Sbjct  84   SLDDVDGSHRLYGLNDVSKYFVPNQDGVSLGPVLALIQDEAFLDSWSQLKET  135



>gb|KDP35860.1| hypothetical protein JCGZ_10599 [Jatropha curcas]
Length=365

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+L++   +PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEAILFAMQLSSAPLLPMVLKSAIELDLLEIIAKAGPGAFLSTYDI-ASQLPTKSADA  73

Query  248  PN-LERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I       +N    ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVVLDRILRLLASYSILTCSLRKLNDGKVERLYGLAPVCKFLTKNEDGVSIAPLCLLNLD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>gb|AAD29841.1|AF064693_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-L  256
            A L  M+LA+   +PM L A I L+V + I + G  A ++ SEI +S L +    AP  L
Sbjct  20   AYLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEI-ASQLSTSNSQAPTVL  78

Query  257  ERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMM  427
            +R+LR+L SY +      ++     ER Y +  V K LV ++DG+S    VL +    +M
Sbjct  79   DRMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLM  138

Query  428  KAW  436
            ++W
Sbjct  139  ESW  141



>ref|XP_006478221.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=352

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = +2

Query  125  MSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFRE  301
            M++ AVI+L + + I + G  A LSASEI + +  +   DAP  L+R+L +L SYGI   
Sbjct  24   MTMKAVIKLGLLEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVEC  83

Query  302  HI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
             + + D S R Y +++V K  V ++DG+S G  +      A + +W  + E 
Sbjct  84   SLDDVDGSHRLYGLNDVSKYFVPNQDGVSLGPVLALIQDEAFLDSWSQLKET  135



>emb|CAI30878.1| caffeate O-methyltransferase [Picea abies]
 gb|ABK23738.1| unknown [Picea sitchensis]
Length=364

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM + A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  24   MELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  83

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +    +M +W  +
Sbjct  84   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMDSWYYL  143

Query  446  HEA  454
             +A
Sbjct  144  KDA  146



>ref|NP_001289246.1| caffeic acid 3-O-methyltransferase [Pyrus x bretschneideri]
 gb|AGS44640.1| caffeic acid-O-methyltransferase [Pyrus x bretschneideri]
Length=365

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPADI-ASQLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        +R Y +  V K L  ++DG S G+  L +  
Sbjct  74   PVMLDRILRLLASYSILTYSLRTLPDGKVQRLYGLGPVCKFLTKNEDGASIGSLCLMNQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>gb|KFK27028.1| hypothetical protein AALP_AA8G324800 [Arabis alpina]
Length=365

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D+ A L  M+LA+   +PM+L   + L++ + + +  S  P+S SEI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKTALELDLLEIMAKNSS--PMSPSEI-ASHLPTKNLEA  71

Query  248  P-NLERLLRMLTSYGIFREHINA-----DASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
            P  L+R+LR+LT+Y +            DA ER Y +  V K L  ++DG+S  A  L +
Sbjct  72   PVMLDRILRLLTAYSVLTCSNRTLPGGGDAVERTYGLGPVCKYLTKNEDGVSIAALCLMN  131

Query  410  HQAAMMKAW  436
                +M++W
Sbjct  132  QDKVLMESW  140



>gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas]
Length=365

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 70/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIIGKAGPGAFLSPYDI-ASQLPTKDPDA  73

Query  248  PN-LERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        E+ Y +  V K L  ++DG+S     L +  
Sbjct  74   PVVLDRILRLLASYSILTYSLRTLPDGKVEKLYGLAPVCKFLTKNEDGVSIAPLCLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + EA
Sbjct  134  KVLMESWYHLKEA  146



>ref|XP_011084578.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=131

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 68/126 (54%), Gaps = 5/126 (4%)
 Frame = +2

Query  71   DNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP  250
            +  A L  MELA+   +PM L + I L++ + I + G  A +S S+ L++ LP+   DA 
Sbjct  7    EEEAFLFAMELASASVLPMVLKSAIELDLLELIKKAGPGASVSPSQ-LAAQLPTKNPDAA  65

Query  251  NL-ERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
             + +R+LR+L +Y + R  +        ER YS+  V K L  ++DG+S   + L     
Sbjct  66   TMIDRMLRLLAAYSVVRCSLKPLPDGGVERLYSLAPVCKFLTRNEDGVSLAPFALLIQDK  125

Query  419  AMMKAW  436
             +M++W
Sbjct  126  VLMESW  131



>ref|XP_011025357.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Populus euphratica]
 ref|XP_011025358.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Populus euphratica]
Length=358

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 69/121 (57%), Gaps = 4/121 (3%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLR  271
            M+LA    +PM+L   I+L + + I + G +  LSAS+I ++ +P+   DAP  L+R+LR
Sbjct  24   MQLALSSVLPMTLHTAIQLGIFEIIAKAGPDVKLSASDI-AAKMPTDNPDAPKMLDRILR  82

Query  272  MLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHE  451
            +L S+ +    +  D SER YS+  V K  V +K+G+S   ++        +++W  + +
Sbjct  83   LLASHQVLCCFV--DGSERFYSLAPVSKYFVPNKNGVSLAPFMALIQDNVFLQSWSQLKD  140

Query  452  A  454
            A
Sbjct  141  A  141



>gb|AAD29845.1|AF064697_1 O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 67/130 (52%), Gaps = 3/130 (2%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  235
            +  E +  A L  M+LA+   +PM L A I L+V + I + G  A ++ SEI S +  S 
Sbjct  10   LTPEEEEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPSEIASQLSTSN  69

Query  236  GGDAPNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  406
                  L+R+LR+L SY +   ++        ER Y +  V K LV ++DG+S    VL 
Sbjct  70   SQAPIILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLM  129

Query  407  HHQAAMMKAW  436
            +    +M++W
Sbjct  130  NQDKVLMESW  139



>gb|ABK22490.1| unknown [Picea sitchensis]
Length=364

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  274
            MEL N   +PM + A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  24   MELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  83

Query  275  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  445
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +    +M +W  +
Sbjct  84   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVMNQDGVSLAPLVLMNQDKVLMDSWYYL  143

Query  446  HEA  454
             +A
Sbjct  144  KDA  146



>ref|XP_006441596.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
 gb|ESR54836.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
Length=352

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 72/135 (53%), Gaps = 2/135 (1%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  235
            M +E  +       EL     + M++ AVI+L + + I + G  A LSASEI + +  + 
Sbjct  1    MANEQRDENFAYACELVTGSVLHMTMKAVIKLGLFEIIAKAGPGAKLSASEIAAQLPATK  60

Query  236  GGDAP-NLERLLRMLTSYGIFREHI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
              DAP  L+R+LR+L SYGI +  + +   S R Y +++V K  V+++DG+S G  +   
Sbjct  61   NKDAPMMLDRILRLLASYGIVQCALDDVYGSHRLYGLNDVCKYFVSNQDGVSLGPVLALI  120

Query  410  HQAAMMKAWPLVHEA  454
               A + +W  + E 
Sbjct  121  QDKAFLDSWSQLKET  135



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L A I L++ + + + G    LS ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGVFLSPADI-ASQLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +   A    ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLADGKVERLYGLGPVCKFLTKNEDGVSIAPLCLMNQD  133

Query  416  AAMMKAW  436
              ++++W
Sbjct  134  KVLVESW  140



>ref|XP_007032646.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY03572.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=365

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 73/139 (53%), Gaps = 5/139 (4%)
 Frame = +2

Query  50   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  229
            G   +E D  +    M++ +   +PMS+ A I+L + D I + G NA  S  EI ++ LP
Sbjct  11   GNNNAEQDQESFSYAMQIVSSSVLPMSMHAAIQLELFDIIAKAGPNAKFSPKEI-AAQLP  69

Query  230  SGGGDAPN-LERLLRMLTSYGIFREHI---NADASERRYSVDEVGKTLVTDKDGLSYGAY  397
                +AP+ L+R+LR+L S+GI    +     +  +R YS+  V K  V ++DG+S+G  
Sbjct  70   CKNPEAPSMLDRILRVLASHGIVGCSVVDEEGNNPQRLYSLTPVSKFFVRNEDGVSFGPL  129

Query  398  VLQHHQAAMMKAWPLVHEA  454
            +        + +W  + +A
Sbjct  130  MALTQDKVSLDSWSHLKDA  148



>sp|P46484.1|COMT1_EUCGU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Eucalyptus gunnii]
 emb|CAA52814.1| 0-Methyltransferase [Eucalyptus gunnii]
Length=366

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 78/148 (53%), Gaps = 13/148 (9%)
 Frame = +2

Query  47   IGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  202
            +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A LS 
Sbjct  1    MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSP  60

Query  203  SEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTD  370
             E+ ++ LP+   +AP  L+R+ R+L SY +      ++     ER Y +  V K LV +
Sbjct  61   GEV-AAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRNLPDGKVERLYGLAPVCKFLVKN  119

Query  371  KDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            +DG+S  A  L +    +M++W  + +A
Sbjct  120  EDGVSIAALNLMNQDKILMESWYYLKDA  147



>gb|KDO41090.1| hypothetical protein CISIN_1g018681mg [Citrus sinensis]
Length=352

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 72/135 (53%), Gaps = 2/135 (1%)
 Frame = +2

Query  56   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  235
            M +E  +       EL     + M++ AVI+L + + I + G  A LSASEI + +  + 
Sbjct  1    MANEQRDENFAYACELVTGSVLHMTMKAVIKLGLFEIIAKAGPGAKLSASEIAAQLPATK  60

Query  236  GGDAP-NLERLLRMLTSYGIFREHI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  409
              DAP  L+R+LR+L SYGI +  + +   S R Y +++V K  V+++DG+S G  +   
Sbjct  61   NKDAPMMLDRILRLLASYGIVQCALDDVYGSHRLYGLNDVCKYFVSNQDGVSLGPVLALI  120

Query  410  HQAAMMKAWPLVHEA  454
               A + +W  + E 
Sbjct  121  QDKAFLDSWSQLKET  135



>sp|P28002.1|COMT1_MEDSA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Medicago sativa]
 pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|F Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYZ|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|E Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 gb|AAB46623.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLACYIILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>ref|XP_009352092.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=269

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA++  +PM L A I L++ + + + G    +S ++ LSS LP+   DA
Sbjct  15   SDEEASLFAMQLASVSVLPMVLKAAIELDLLEIMAKAGPGVFVSPAD-LSSQLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        ER Y +  V K L T++DG+S  +  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLQDGKVERLYGLGPVCKFLTTNEDGVSIASLCLMNLD  133

Query  416  AAMMKAW  436
               +++W
Sbjct  134  KVPVESW  140



>ref|XP_006401615.1| hypothetical protein EUTSA_v10013908mg [Eutrema salsugineum]
 gb|ESQ43068.1| hypothetical protein EUTSA_v10013908mg [Eutrema salsugineum]
Length=363

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 72/136 (53%), Gaps = 8/136 (6%)
 Frame = +2

Query  44   EIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV  223
            +I  +    D+   L  M+LA+   +PM+L  VI L + + + +  S  P+S SE+ +S 
Sbjct  8    QITPVQVTDDDETALFAMQLAHAPVIPMALKPVIELGILEIMAKNSS--PMSPSEV-ASH  64

Query  224  LPSGGGDAP-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSY  388
            LP+   +AP  L+R+LR+L +Y I     R   + D  ER Y +  V K L  ++DG+S 
Sbjct  65   LPTKNPEAPVMLDRILRLLAAYSILTCSLRTLPDGDGVERLYGLGPVCKYLTKNEDGVSI  124

Query  389  GAYVLQHHQAAMMKAW  436
             A  L +     M++W
Sbjct  125  AALCLVNQDKVGMESW  140



>gb|KHN23295.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=350

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-ASQLPTHNPNA  73

Query  248  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDCKIERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_010911558.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  122  PMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGI--F  295
            PM+L A I L++ + I + G  A LS +E+ + +       AP L+R+LR+L SY I  F
Sbjct  37   PMTLKAAIELDLLEIIVKAGPGAKLSPTEMAAQLPTKNPMAAPMLDRMLRLLASYNILTF  96

Query  296  REHINADASE-RRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
               ++AD    RRY    V K L  ++DG+S  A  L +    +M++W  + +A
Sbjct  97   SVEVDADGKPLRRYGAAPVCKWLTKNEDGVSMAAVSLMNQDKILMESWYYLKDA  150



>gb|AAF28353.1|AF220491_1 O-methyltransferase [Fragaria x ananassa]
Length=365

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L A I L++ + + + G  + LS S+ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGSFLSPSD-LASQLPTKNPEA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTCSLRTLPDGKVERLYCLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  416  AAMMKAW  436
              ++++W
Sbjct  134  KVLVESW  140



>ref|XP_006436417.1| hypothetical protein CICLE_v10031953mg [Citrus clementina]
 gb|ESR49657.1| hypothetical protein CICLE_v10031953mg [Citrus clementina]
Length=264

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 68/120 (57%), Gaps = 2/120 (2%)
 Frame = +2

Query  98   ELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRM  274
            +LA  + +PM++ AV  L + + + + G    LSAS+I + +L +   DAP  L+R+LR+
Sbjct  18   QLATGVVLPMAIQAVYELGIFEILDKAGPGTKLSASDIAAQLL-TKNKDAPMMLDRILRL  76

Query  275  LTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  454
            L SY +    ++A  + R YS++ V K  V +KDG+  G  +       ++++W  + +A
Sbjct  77   LASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVLLGPLIQIIQDKVILESWSQLKDA  136



>ref|XP_008775842.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Phoenix 
dactylifera]
Length=367

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 67/132 (51%), Gaps = 3/132 (2%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D  A +  ++LA+   +PM+L A I L++ + I + G  A LS +E+ + +       A
Sbjct  19   ADEAACMYAVQLASSSILPMTLKAAIELDILEIIVKAGPGAKLSPAEVATQLPTENPMAA  78

Query  248  PNLERLLRMLTSYGIFREHINADA---SERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  418
              L+R+LR+L SY I    +  DA     RRY    V K L  +K+G S  A  L +   
Sbjct  79   TMLDRMLRLLASYNILTCSVEIDADGKPFRRYGAAPVCKWLTKNKEGASMSALTLMNQDK  138

Query  419  AMMKAWPLVHEA  454
             +M +W  + +A
Sbjct  139  ILMGSWYYLKDA  150



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPMEV-ASQLPTANPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L +Y I    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGRVERLYGLGPVCKFLTKNQDGVALSALSLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>gb|AAD29844.1|AF064696_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  80   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-L  256
            A L  M+LA+   +PM L A I L+V + I + G  A ++ SEI +S L +    AP  L
Sbjct  20   ACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEI-ASQLSTSNSQAPTVL  78

Query  257  ERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMM  427
            +R+LR+L SY +      ++     ER Y +  V K LV ++DG+S    VL +    +M
Sbjct  79   DRMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLM  138

Query  428  KAW  436
            ++W
Sbjct  139  ESW  141



>ref|XP_002864307.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40566.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 72/127 (57%), Gaps = 7/127 (6%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+    A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASHLPTKNPGA  71

Query  248  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+LTS+ +       ++ D  ER Y +  V K L  ++DG+S     L    
Sbjct  72   PVMLDRILRLLTSHSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAGLCLTSQD  131

Query  416  AAMMKAW  436
              +M++W
Sbjct  132  KVLMESW  138



>gb|KJB23956.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=251

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 70/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 5/109 (5%)
 Frame = +2

Query  122  PMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFR  298
            PM L AVI L+V + I + G NA LS +EI++  LPS   DA   L+R+LR+L SY I  
Sbjct  30   PMVLKAVIELDVLEIIKRAGPNAQLSPAEIVAQ-LPSKNPDAATMLDRMLRLLASYSILS  88

Query  299  EHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  436
              +        ER Y +  V + L  ++DG++ GA  L +    +M++W
Sbjct  89   YSLRTLPDGKVERLYGLAPVCQFLTKNQDGVTLGALSLMNQDKILMESW  137



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L A I L++ + + + G  A LS ++ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LASQLPTKNPEA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  416  AAMMKAW  436
              ++++W
Sbjct  134  KVLVESW  140



>ref|XP_003528001.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=366

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 72/133 (54%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-ASQLPTHNPNA  73

Query  248  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDCKIERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>gb|EEC84528.1| hypothetical protein OsI_31257 [Oryza sativa Indica Group]
Length=620

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = +2

Query  257  ERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDG---LSYGAYVLQHHQAAMM  427
             RLLR+L S G+F EH ++  S RR+S+  V +TLV    G    SY  YVLQHHQ  ++
Sbjct  347  HRLLRLLASRGVFSEHTSS--SPRRFSLTTVSRTLVPAGGGSSAASYADYVLQHHQDELV  404

Query  428  KAWPLVHEA  454
            +AW L+HEA
Sbjct  405  RAWSLLHEA  413



>gb|AFK39235.1| unknown [Medicago truncatula]
Length=365

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPEA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L A I L++ + + + G  A LS ++ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LASQLPTKNPEA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  416  AAMMKAW  436
              ++++W
Sbjct  134  KVLVESW  140



>ref|XP_006425206.1| hypothetical protein CICLE_v100108602mg, partial [Citrus clementina]
 gb|ESR38446.1| hypothetical protein CICLE_v100108602mg, partial [Citrus clementina]
Length=128

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +2

Query  125  MSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFRE  301
            M++ AVI+L + + I + G  A LSASEI + +  +   DAP  L+R+L +L SYGI   
Sbjct  24   MTMKAVIKLGLLEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVEC  83

Query  302  HI-NADASERRYSVDEVGKTLVTDKDGLSYG  391
             + + D S R Y +++V K  V ++DG+S G
Sbjct  84   SLDDVDGSHRLYGLNDVSKYFVPNQDGVSLG  114



>gb|ACT32029.1| caffeic acid O-methyltransferase 2 [Gossypium hirsutum]
Length=365

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 70/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L +Y I    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_003602396.1| Caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AES72647.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPEA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 70/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTNNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L +Y I    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>gb|KJB23955.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=269

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 70/133 (53%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  416  AAMMKAWPLVHEA  454
              +M++W  + +A
Sbjct  134  KVLMESWYYLKDA  146



>ref|XP_008376825.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 66/127 (52%), Gaps = 5/127 (4%)
 Frame = +2

Query  68   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  247
            +D    L  M+LAN   +PM L   + L++ + + + G  A +S+++ LSS LP+   DA
Sbjct  15   TDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSAD-LSSQLPTKNPDA  73

Query  248  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  415
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S     L    
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNEDGVSIAPLCLMSQD  133

Query  416  AAMMKAW  436
              +M++W
Sbjct  134  KVLMESW  140



>ref|XP_002302676.2| eugenol O-methyltransferase family protein [Populus trichocarpa]
 gb|EEE81949.2| eugenol O-methyltransferase family protein [Populus trichocarpa]
Length=359

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 71/121 (59%), Gaps = 4/121 (3%)
 Frame = +2

Query  95   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLR  271
            M+LA    +PM+L   I+L + + I + G +  LSA++I ++ LP+   D P  L+R+LR
Sbjct  24   MQLALSSVLPMTLHTAIQLGIFEIIAKAGPDVKLSAADI-AAKLPTDNPDTPKMLDRILR  82

Query  272  MLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHE  451
            +L S+ +    +  D SER YS+  V    V +++G+S   ++  +H+  ++++W  + +
Sbjct  83   LLASHQVLCCFV--DGSERFYSLAPVSMYFVRNQNGVSLAPFMALNHENVILQSWSQLKD  140

Query  452  A  454
            A
Sbjct  141  A  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180