BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005E09

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787384.1|  PREDICTED: post-GPI attachment to proteins f...    202   2e-62   Nicotiana sylvestris
ref|XP_009586779.1|  PREDICTED: post-GPI attachment to proteins f...    206   6e-62   Nicotiana tomentosiformis
ref|XP_009625146.1|  PREDICTED: post-GPI attachment to proteins f...    203   1e-60   Nicotiana tomentosiformis
ref|XP_009775256.1|  PREDICTED: post-GPI attachment to proteins f...    199   3e-59   Nicotiana sylvestris
ref|XP_006421843.1|  hypothetical protein CICLE_v10005347mg             194   3e-58   
ref|XP_008234299.1|  PREDICTED: post-GPI attachment to proteins f...    196   3e-58   Prunus mume [ume]
ref|XP_007218263.1|  hypothetical protein PRUPE_ppa008189mg             196   5e-58   Prunus persica
ref|XP_004234347.1|  PREDICTED: post-GPI attachment to proteins f...    195   1e-57   Solanum lycopersicum
gb|KJB52865.1|  hypothetical protein B456_008G280700                    193   1e-57   Gossypium raimondii
ref|XP_006421844.1|  hypothetical protein CICLE_v10005347mg             194   3e-57   Citrus clementina [clementine]
gb|KDO60107.1|  hypothetical protein CISIN_1g019038mg                   194   4e-57   Citrus sinensis [apfelsine]
gb|KHG15846.1|  Post-GPI attachment tos factor 3                        193   5e-57   Gossypium arboreum [tree cotton]
gb|KJB52864.1|  hypothetical protein B456_008G280700                    192   1e-56   Gossypium raimondii
gb|EYU25051.1|  hypothetical protein MIMGU_mgv1a009430mg                191   4e-56   Erythranthe guttata [common monkey flower]
ref|NP_001275064.1|  Per1-like family protein precursor                 190   7e-56   Solanum tuberosum [potatoes]
ref|XP_004240743.1|  PREDICTED: post-GPI attachment to proteins f...    190   8e-56   Solanum lycopersicum
gb|ABB86252.1|  Per1-like family protein                                190   1e-55   Solanum tuberosum [potatoes]
ref|XP_011076241.1|  PREDICTED: post-GPI attachment to proteins f...    190   1e-55   Sesamum indicum [beniseed]
emb|CDP05250.1|  unnamed protein product                                189   1e-55   Coffea canephora [robusta coffee]
ref|XP_006340525.1|  PREDICTED: protein PER1 homolog                    189   3e-55   Solanum tuberosum [potatoes]
ref|XP_006353377.1|  PREDICTED: post-GPI attachment to proteins f...    187   2e-54   Solanum tuberosum [potatoes]
ref|XP_004234349.1|  PREDICTED: post-GPI attachment to proteins f...    187   2e-54   Solanum lycopersicum
ref|XP_007038582.1|  Per1-like family protein                           186   3e-54   
ref|XP_010106800.1|  hypothetical protein L484_005346                   186   5e-54   Morus notabilis
ref|XP_010278515.1|  PREDICTED: post-GPI attachment to proteins f...    184   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009341265.1|  PREDICTED: post-GPI attachment to proteins f...    183   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_004513683.1|  PREDICTED: post-GPI attachment to proteins f...    183   4e-53   Cicer arietinum [garbanzo]
ref|XP_011030037.1|  PREDICTED: post-GPI attachment to proteins f...    182   7e-53   Populus euphratica
gb|ACA64424.1|  PERLD1                                                  182   1e-52   Glycine max [soybeans]
gb|KDP22331.1|  hypothetical protein JCGZ_26162                         182   1e-52   Jatropha curcas
ref|XP_008377107.1|  PREDICTED: post-GPI attachment to proteins f...    182   1e-52   Malus domestica [apple tree]
gb|KJB39383.1|  hypothetical protein B456_007G010000                    182   1e-52   Gossypium raimondii
ref|XP_010255551.1|  PREDICTED: post-GPI attachment to proteins f...    181   3e-52   Nelumbo nucifera [Indian lotus]
gb|KHG02645.1|  Post-GPI attachment tos factor 3                        179   2e-51   Gossypium arboreum [tree cotton]
ref|XP_008376516.1|  PREDICTED: post-GPI attachment to proteins f...    179   2e-51   Malus domestica [apple tree]
ref|XP_003549124.1|  PREDICTED: post-GPI attachment to proteins f...    179   2e-51   Glycine max [soybeans]
gb|EYU19511.1|  hypothetical protein MIMGU_mgv1a009409mg                179   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_009371276.1|  PREDICTED: post-GPI attachment to proteins f...    177   5e-51   Pyrus x bretschneideri [bai li]
ref|XP_002318250.1|  hypothetical protein POPTR_0012s13850g             177   8e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010035088.1|  PREDICTED: post-GPI attachment to proteins f...    177   9e-51   Eucalyptus grandis [rose gum]
gb|KEH26587.1|  post-GPI attachment-like factor-protein                 177   1e-50   Medicago truncatula
ref|XP_002322440.1|  hypothetical protein POPTR_0015s13810g             177   1e-50   Populus trichocarpa [western balsam poplar]
gb|KDP25109.1|  hypothetical protein JCGZ_22644                         177   1e-50   Jatropha curcas
gb|KCW90759.1|  hypothetical protein EUGRSUZ_A02835                     175   2e-50   Eucalyptus grandis [rose gum]
ref|XP_007152345.1|  hypothetical protein PHAVU_004G122200g             176   3e-50   Phaseolus vulgaris [French bean]
ref|XP_010061579.1|  PREDICTED: post-GPI attachment to proteins f...    175   7e-50   Eucalyptus grandis [rose gum]
ref|XP_002310105.1|  Per1-like family protein                           174   2e-49   Populus trichocarpa [western balsam poplar]
gb|AFK39392.1|  unknown                                                 174   2e-49   Medicago truncatula
gb|ACJ84406.1|  unknown                                                 174   2e-49   Medicago truncatula
gb|KCW90758.1|  hypothetical protein EUGRSUZ_A02835                     174   2e-49   Eucalyptus grandis [rose gum]
ref|XP_006422203.1|  hypothetical protein CICLE_v10005304mg             171   3e-49   
ref|XP_004308119.1|  PREDICTED: post-GPI attachment to proteins f...    173   3e-49   Fragaria vesca subsp. vesca
ref|XP_006422202.1|  hypothetical protein CICLE_v10005304mg             169   5e-49   
gb|KDO46709.1|  hypothetical protein CISIN_1g018683mg                   171   5e-49   Citrus sinensis [apfelsine]
ref|XP_008439161.1|  PREDICTED: post-GPI attachment to proteins f...    172   5e-49   Cucumis melo [Oriental melon]
ref|XP_010693511.1|  PREDICTED: post-GPI attachment to proteins f...    172   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006422204.1|  hypothetical protein CICLE_v10005304mg             171   1e-48   
ref|XP_006422206.1|  hypothetical protein CICLE_v10005304mg             171   2e-48   Citrus clementina [clementine]
ref|XP_004140795.1|  PREDICTED: post-GPI attachment to proteins f...    171   2e-48   
gb|KGN57336.1|  hypothetical protein Csa_3G180250                       171   2e-48   Cucumis sativus [cucumbers]
ref|XP_002280194.1|  PREDICTED: post-GPI attachment to proteins f...    171   3e-48   Vitis vinifera
ref|XP_004171793.1|  PREDICTED: post-GPI attachment to proteins f...    170   4e-48   
emb|CAN65586.1|  hypothetical protein VITISV_034376                     170   4e-48   Vitis vinifera
ref|XP_002266274.1|  PREDICTED: post-GPI attachment to proteins f...    170   4e-48   Vitis vinifera
ref|XP_010644976.1|  PREDICTED: post-GPI attachment to proteins f...    170   4e-48   Vitis vinifera
ref|XP_002510848.1|  conserved hypothetical protein                     169   1e-47   
ref|XP_002266197.1|  PREDICTED: post-GPI attachment to proteins f...    170   1e-47   Vitis vinifera
ref|XP_011014824.1|  PREDICTED: post-GPI attachment to proteins f...    168   2e-47   Populus euphratica
ref|XP_007022228.1|  Per1-like family protein isoform 7                 166   1e-46   
ref|XP_007022223.1|  Per1-like family protein isoform 2                 166   2e-46   
ref|XP_007022222.1|  Per1-like family protein isoform 1                 166   2e-46   
ref|XP_007022226.1|  Per1-like family protein isoform 5                 166   2e-46   
ref|XP_011097638.1|  PREDICTED: post-GPI attachment to proteins f...    165   5e-46   
ref|XP_011097637.1|  PREDICTED: post-GPI attachment to proteins f...    164   7e-46   Sesamum indicum [beniseed]
gb|KEH26588.1|  post-GPI attachment-like factor-protein                 162   4e-45   Medicago truncatula
emb|CDY00259.1|  BnaA06g21600D                                          162   5e-45   
ref|XP_009151332.1|  PREDICTED: post-GPI attachment to proteins f...    162   5e-45   Brassica rapa
ref|XP_002866473.1|  hypothetical protein ARALYDRAFT_919464             162   6e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_004294129.1|  PREDICTED: post-GPI attachment to proteins f...    161   1e-44   Fragaria vesca subsp. vesca
ref|XP_010094756.1|  hypothetical protein L484_019966                   161   1e-44   Morus notabilis
gb|KJB82126.1|  hypothetical protein B456_013G177900                    161   1e-44   Gossypium raimondii
ref|XP_010249648.1|  PREDICTED: post-GPI attachment to proteins f...    161   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010523608.1|  PREDICTED: post-GPI attachment to proteins f...    160   2e-44   Tarenaya hassleriana [spider flower]
gb|ACB45085.1|  PERLD1                                                  159   2e-44   Solanum commersonii
ref|XP_010249649.1|  PREDICTED: post-GPI attachment to proteins f...    160   4e-44   Nelumbo nucifera [Indian lotus]
ref|XP_007213744.1|  hypothetical protein PRUPE_ppa008593m2g            155   5e-44   
ref|XP_010523600.1|  PREDICTED: post-GPI attachment to proteins f...    160   1e-43   Tarenaya hassleriana [spider flower]
ref|NP_568951.1|  Per1-like family protein                              157   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008226095.1|  PREDICTED: post-GPI attachment to proteins f...    157   6e-43   Prunus mume [ume]
ref|XP_004512796.1|  PREDICTED: post-GPI attachment to proteins f...    155   2e-42   Cicer arietinum [garbanzo]
ref|XP_010676806.1|  PREDICTED: post-GPI attachment to proteins f...    155   2e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK27944.1|  hypothetical protein AALP_AA8G451600                    155   3e-42   Arabis alpina [alpine rockcress]
gb|EYU27545.1|  hypothetical protein MIMGU_mgv1a009440mg                153   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_009382286.1|  PREDICTED: post-GPI attachment to proteins f...    152   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES76445.2|  post-GPI attachment-like factor-protein                 149   6e-41   Medicago truncatula
ref|XP_006394430.1|  hypothetical protein EUTSA_v10004514mg             149   7e-41   
ref|XP_008805643.1|  PREDICTED: post-GPI attachment to proteins f...    151   1e-40   Phoenix dactylifera
ref|XP_004171395.1|  PREDICTED: post-GPI attachment to proteins f...    148   2e-40   
gb|AFK38324.1|  unknown                                                 147   2e-40   Medicago truncatula
ref|XP_008456335.1|  PREDICTED: post-GPI attachment to proteins f...    149   3e-40   Cucumis melo [Oriental melon]
ref|XP_003620227.1|  Post-GPI attachment to proteins factor             149   3e-40   
ref|XP_006280748.1|  hypothetical protein CARUB_v10026718mg             149   4e-40   Capsella rubella
ref|XP_009366488.1|  PREDICTED: post-GPI attachment to proteins f...    149   4e-40   
ref|XP_010459200.1|  PREDICTED: post-GPI attachment to proteins f...    149   5e-40   Camelina sativa [gold-of-pleasure]
emb|CDP13593.1|  unnamed protein product                                149   6e-40   Coffea canephora [robusta coffee]
ref|XP_006394432.1|  hypothetical protein EUTSA_v10004514mg             149   6e-40   Eutrema salsugineum [saltwater cress]
ref|XP_004143181.1|  PREDICTED: post-GPI attachment to proteins f...    148   8e-40   Cucumis sativus [cucumbers]
ref|XP_002890173.1|  hypothetical protein ARALYDRAFT_471855             148   9e-40   
ref|XP_010925813.1|  PREDICTED: post-GPI attachment to proteins f...    148   1e-39   Elaeis guineensis
ref|XP_010915760.1|  PREDICTED: post-GPI attachment to proteins f...    148   1e-39   Elaeis guineensis
gb|EPS57354.1|  hypothetical protein M569_17464                         148   1e-39   Genlisea aurea
ref|XP_009383493.1|  PREDICTED: post-GPI attachment to proteins f...    147   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010476769.1|  PREDICTED: post-GPI attachment to proteins f...    147   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_011083636.1|  PREDICTED: post-GPI attachment to proteins f...    147   3e-39   
ref|XP_011083635.1|  PREDICTED: post-GPI attachment to proteins f...    147   3e-39   Sesamum indicum [beniseed]
ref|XP_003521884.1|  PREDICTED: post-GPI attachment to proteins f...    147   4e-39   Glycine max [soybeans]
ref|XP_006576320.1|  PREDICTED: post-GPI attachment to proteins f...    147   4e-39   Glycine max [soybeans]
ref|XP_009411453.1|  PREDICTED: post-GPI attachment to proteins f...    146   5e-39   
ref|XP_009411454.1|  PREDICTED: post-GPI attachment to proteins f...    146   6e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006305176.1|  hypothetical protein CARUB_v10009543mg             145   2e-38   
ref|XP_006416803.1|  hypothetical protein EUTSA_v10008113mg             145   2e-38   Eutrema salsugineum [saltwater cress]
ref|XP_008795943.1|  PREDICTED: post-GPI attachment to proteins f...    144   4e-38   Phoenix dactylifera
gb|KJB26985.1|  hypothetical protein B456_004G270100                    144   4e-38   Gossypium raimondii
ref|XP_009130193.1|  PREDICTED: post-GPI attachment to proteins f...    144   4e-38   Brassica rapa
ref|XP_010483931.1|  PREDICTED: post-GPI attachment to proteins f...    144   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010537783.1|  PREDICTED: post-GPI attachment to proteins f...    142   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_003528854.1|  PREDICTED: post-GPI attachment to proteins f...    142   2e-37   Glycine max [soybeans]
ref|XP_010458286.1|  PREDICTED: post-GPI attachment to proteins f...    141   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009404456.1|  PREDICTED: post-GPI attachment to proteins f...    141   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY68708.1|  BnaA06g38370D                                          140   1e-36   Brassica napus [oilseed rape]
ref|XP_002872857.1|  hypothetical protein ARALYDRAFT_490363             139   2e-36   
ref|NP_173104.1|  Per1-like family protein                              139   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010497975.1|  PREDICTED: post-GPI attachment to proteins f...    139   3e-36   Camelina sativa [gold-of-pleasure]
dbj|BAH19866.1|  AT1G16560                                              139   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149093.1|  PREDICTED: post-GPI attachment to proteins f...    139   3e-36   Brassica rapa
ref|XP_010444070.1|  PREDICTED: post-GPI attachment to proteins f...    138   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006857922.1|  hypothetical protein AMTR_s00069p00146030          137   9e-36   
emb|CDY40049.1|  BnaC05g12660D                                          137   2e-35   Brassica napus [oilseed rape]
ref|XP_006422207.1|  hypothetical protein CICLE_v10005304mg             137   2e-35   
ref|XP_006490483.1|  PREDICTED: post-GPI attachment to proteins f...    137   2e-35   
ref|XP_009788344.1|  PREDICTED: post-GPI attachment to proteins f...    135   5e-35   Nicotiana sylvestris
ref|NP_001190592.1|  Per1-like family protein                           135   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668589.1|  PREDICTED: hypothetical protein isoform X1         136   2e-34   
ref|XP_009788343.1|  PREDICTED: post-GPI attachment to proteins f...    135   2e-34   Nicotiana sylvestris
ref|XP_006364637.1|  PREDICTED: post-GPI attachment to proteins f...    134   2e-34   Solanum tuberosum [potatoes]
ref|XP_007133380.1|  hypothetical protein PHAVU_011G174400g             133   4e-34   Phaseolus vulgaris [French bean]
ref|XP_004985958.1|  PREDICTED: post-GPI attachment to proteins f...    132   1e-33   Setaria italica
ref|NP_001142245.1|  hypothetical protein precursor                     132   2e-33   Zea mays [maize]
emb|CDX81768.1|  BnaC08g38330D                                          132   2e-33   
ref|XP_009590513.1|  PREDICTED: post-GPI attachment to proteins f...    131   3e-33   Nicotiana tomentosiformis
ref|XP_009117756.1|  PREDICTED: post-GPI attachment to proteins f...    130   4e-33   Brassica rapa
ref|XP_004250185.1|  PREDICTED: post-GPI attachment to proteins f...    130   4e-33   Solanum lycopersicum
gb|EAY79260.1|  hypothetical protein OsI_34376                          129   2e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_002465979.1|  hypothetical protein SORBIDRAFT_01g049340          129   2e-32   Sorghum bicolor [broomcorn]
ref|XP_009802480.1|  PREDICTED: post-GPI attachment to proteins f...    129   3e-32   Nicotiana sylvestris
ref|NP_001141237.1|  hypothetical protein precursor                     128   3e-32   Zea mays [maize]
ref|XP_007149295.1|  hypothetical protein PHAVU_005G058200g             128   3e-32   Phaseolus vulgaris [French bean]
ref|XP_007149294.1|  hypothetical protein PHAVU_005G058200g             128   4e-32   Phaseolus vulgaris [French bean]
ref|XP_009615087.1|  PREDICTED: post-GPI attachment to proteins f...    127   6e-32   Nicotiana tomentosiformis
ref|NP_001065105.1|  Os10g0524100                                       127   8e-32   
gb|EAY79263.1|  hypothetical protein OsI_34379                          127   8e-32   Oryza sativa Indica Group [Indian rice]
emb|CDX86924.1|  BnaC03g51940D                                          126   2e-31   
ref|XP_003545917.1|  PREDICTED: post-GPI attachment to proteins f...    126   2e-31   Glycine max [soybeans]
ref|XP_004240259.1|  PREDICTED: post-GPI attachment to proteins f...    126   2e-31   Solanum lycopersicum
ref|NP_001141953.1|  hypothetical protein precursor                     126   3e-31   Zea mays [maize]
gb|KHN27719.1|  Post-GPI attachment to proteins factor 3                125   4e-31   Glycine soja [wild soybean]
ref|XP_006360399.1|  PREDICTED: post-GPI attachment to proteins f...    124   1e-30   
ref|XP_006661973.1|  PREDICTED: post-GPI attachment to proteins f...    124   1e-30   Oryza brachyantha
ref|NP_001147973.1|  CAB2 precursor                                     123   3e-30   
ref|XP_002448009.1|  hypothetical protein SORBIDRAFT_06g019590          123   4e-30   Sorghum bicolor [broomcorn]
ref|XP_003562375.1|  PREDICTED: post-GPI attachment to proteins f...    122   5e-30   Brachypodium distachyon [annual false brome]
ref|XP_004968454.1|  PREDICTED: post-GPI attachment to proteins f...    122   6e-30   Setaria italica
gb|AFW89789.1|  hypothetical protein ZEAMMB73_859279                    121   2e-29   
ref|NP_001054945.1|  Os05g0220100                                       120   2e-29   
gb|AFW58545.1|  hypothetical protein ZEAMMB73_490076                    121   2e-29   
gb|ACN35025.1|  unknown                                                 120   2e-29   Zea mays [maize]
ref|XP_008661897.1|  PREDICTED: CAB2 isoform X1                         120   3e-29   
dbj|BAK01927.1|  predicted protein                                      120   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93369.1|  predicted protein                                      119   8e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006664912.1|  PREDICTED: post-GPI attachment to proteins f...    118   1e-28   Oryza brachyantha
gb|AAM12953.1|  unknown protein                                         114   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010919213.1|  PREDICTED: post-GPI attachment to proteins f...    117   3e-28   Elaeis guineensis
ref|XP_010919212.1|  PREDICTED: post-GPI attachment to proteins f...    117   3e-28   Elaeis guineensis
gb|EMS67113.1|  Post-GPI attachment to proteins factor 3                117   3e-27   Triticum urartu
gb|EMT06679.1|  hypothetical protein F775_25984                         114   6e-27   
dbj|BAK02712.1|  predicted protein                                      114   7e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT11964.1|  hypothetical protein F775_08311                         113   1e-26   
gb|EMT25149.1|  hypothetical protein F775_19461                         110   2e-25   
gb|EMS62696.1|  hypothetical protein TRIUR3_14941                       110   2e-25   Triticum urartu
tpg|DAA37379.1|  TPA: hypothetical protein ZEAMMB73_215322              109   3e-25   
ref|XP_002986499.1|  hypothetical protein SELMODRAFT_124213             109   4e-25   Selaginella moellendorffii
ref|XP_002964918.1|  hypothetical protein SELMODRAFT_167352             108   4e-25   Selaginella moellendorffii
gb|EMS64956.1|  hypothetical protein TRIUR3_20884                       107   3e-24   Triticum urartu
ref|XP_001771346.1|  predicted protein                                  102   8e-23   
ref|XP_001758224.1|  predicted protein                                98.2    2e-22   
gb|ACF87974.1|  unknown                                               99.0    1e-21   Zea mays [maize]
ref|XP_003558964.1|  PREDICTED: post-GPI attachment to proteins f...  98.6    2e-21   Brachypodium distachyon [annual false brome]
gb|AFW89791.1|  hypothetical protein ZEAMMB73_859279                  96.7    8e-21   
gb|KHN31540.1|  Post-GPI attachment to proteins factor 3              94.4    5e-20   Glycine soja [wild soybean]
ref|XP_010229303.1|  PREDICTED: post-GPI attachment to proteins f...  92.8    2e-19   
gb|KDO46714.1|  hypothetical protein CISIN_1g018683mg                 85.1    7e-17   Citrus sinensis [apfelsine]
dbj|BAB10175.1|  unnamed protein product                              80.1    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001087556.1|  post-GPI attachment to proteins factor 3 pre...  71.6    7e-12   Xenopus laevis [clawed frog]
ref|NP_001072247.1|  post-GPI attachment to proteins factor 3 pre...  70.9    1e-11   Xenopus tropicalis [western clawed frog]
ref|XP_008401955.1|  PREDICTED: post-GPI attachment to proteins f...  68.9    1e-11   Poecilia reticulata
ref|XP_010902233.1|  PREDICTED: post-GPI attachment to proteins f...  68.9    6e-11   Esox lucius
ref|XP_003058154.1|  per1-like family protein                         69.3    9e-11   Micromonas pusilla CCMP1545
ref|XP_007940230.1|  PREDICTED: post-GPI attachment to proteins f...  67.0    1e-10   Orycteropus afer afer
ref|XP_007940231.1|  PREDICTED: post-GPI attachment to proteins f...  66.6    1e-10   Orycteropus afer afer
ref|XP_010739161.1|  PREDICTED: post-GPI attachment to proteins f...  68.6    1e-10   Larimichthys crocea [croceine croaker]
ref|XP_006394431.1|  hypothetical protein EUTSA_v10004514mg           67.4    2e-10   
ref|XP_008281815.1|  PREDICTED: post-GPI attachment to proteins f...  67.4    3e-10   Stegastes partitus
ref|XP_007940228.1|  PREDICTED: post-GPI attachment to proteins f...  66.6    3e-10   Orycteropus afer afer
ref|XP_010770964.1|  PREDICTED: post-GPI attachment to proteins f...  67.0    3e-10   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007940227.1|  PREDICTED: post-GPI attachment to proteins f...  67.0    3e-10   Orycteropus afer afer
ref|XP_001701622.1|  predicted protein                                66.6    4e-10   Chlamydomonas reinhardtii
ref|XP_003458790.2|  PREDICTED: post-GPI attachment to proteins f...  67.0    5e-10   Oreochromis niloticus
ref|XP_007239376.1|  PREDICTED: post-GPI attachment to proteins f...  66.2    6e-10   
ref|XP_005749356.1|  PREDICTED: post-GPI attachment to proteins f...  66.6    6e-10   Pundamilia nyererei
ref|XP_006805747.1|  PREDICTED: post-GPI attachment to proteins f...  66.6    6e-10   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004575037.1|  PREDICTED: post-GPI attachment to proteins f...  66.6    7e-10   Maylandia zebra
ref|XP_007572869.1|  PREDICTED: post-GPI attachment to proteins f...  65.5    1e-09   Poecilia formosa
emb|CDQ75401.1|  unnamed protein product                              65.5    1e-09   Oncorhynchus mykiss
ref|XP_004463084.1|  PREDICTED: post-GPI attachment to proteins f...  63.2    1e-09   Dasypus novemcinctus
emb|CBN81402.1|  Post-GPI attachment to proteins factor 3             64.7    2e-09   Dicentrarchus labrax [European sea bass]
ref|XP_006638317.1|  PREDICTED: post-GPI attachment to proteins f...  64.3    2e-09   
ref|XP_005947497.1|  PREDICTED: post-GPI attachment to proteins f...  65.5    2e-09   Haplochromis burtoni
ref|NP_593834.1|  GPI-phospholipase A2 activity regulator (predic...  64.7    3e-09   Schizosaccharomyces pombe
ref|XP_005810657.1|  PREDICTED: post-GPI attachment to proteins f...  63.9    3e-09   
ref|XP_004463083.1|  PREDICTED: post-GPI attachment to proteins f...  62.8    4e-09   Dasypus novemcinctus
ref|XP_008312260.1|  PREDICTED: post-GPI attachment to proteins f...  63.9    4e-09   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006750531.1|  PREDICTED: post-GPI attachment to proteins f...  61.6    4e-09   Leptonychotes weddellii
ref|XP_005156102.1|  PREDICTED: post-GPI attachment to proteins f...  63.5    5e-09   Danio rerio [leopard danio]
emb|CAG12654.1|  unnamed protein product                              63.5    6e-09   Tetraodon nigroviridis
ref|NP_001108063.1|  post-GPI attachment to proteins factor 3 pre...  62.8    8e-09   Danio rerio [leopard danio]
ref|XP_008152088.1|  PREDICTED: post-GPI attachment to proteins f...  62.8    9e-09   Eptesicus fuscus
ref|XP_009047399.1|  hypothetical protein LOTGIDRAFT_138807           62.4    9e-09   Lottia gigantea
gb|KFO34892.1|  Post-GPI attachment to proteins factor 3              62.4    1e-08   Fukomys damarensis [Damara mole rat]
ref|XP_004080335.1|  PREDICTED: post-GPI attachment to proteins f...  62.8    1e-08   Oryzias latipes [Japanese rice fish]
ref|XP_004463082.1|  PREDICTED: post-GPI attachment to proteins f...  62.4    1e-08   Dasypus novemcinctus
ref|XP_003961434.1|  PREDICTED: post-GPI attachment to proteins f...  62.8    1e-08   Takifugu rubripes [tiger puffer]
ref|XP_008687474.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    1e-08   Ursus maritimus [white bear]
ref|XP_009250141.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    1e-08   
ref|XP_006100845.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  62.4    1e-08   
ref|XP_004463081.1|  PREDICTED: post-GPI attachment to proteins f...  62.4    1e-08   Dasypus novemcinctus
ref|XP_010618587.1|  PREDICTED: post-GPI attachment to proteins f...  62.4    1e-08   
ref|XP_009250142.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    1e-08   Pongo abelii [orang utan]
ref|NP_001278662.1|  post-GPI attachment to proteins factor 3 iso...  60.1    1e-08   Homo sapiens [man]
ref|XP_004921565.1|  PREDICTED: post-GPI attachment to proteins f...  62.4    1e-08   Bombyx mori [silk moth]
ref|XP_009430529.1|  PREDICTED: post-GPI attachment to proteins f...  61.2    1e-08   Pan troglodytes
ref|XP_010377601.1|  PREDICTED: post-GPI attachment to proteins f...  61.2    2e-08   Rhinopithecus roxellana
ref|XP_009250139.1|  PREDICTED: post-GPI attachment to proteins f...  61.2    2e-08   Pongo abelii [orang utan]
ref|XP_009430531.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    2e-08   Pan troglodytes
ref|XP_009250143.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    2e-08   
ref|XP_005394374.1|  PREDICTED: post-GPI attachment to proteins f...  62.0    2e-08   Chinchilla lanigera
gb|EAW60590.1|  per1-like domain containing 1, isoform CRA_b          60.1    2e-08   Homo sapiens [man]
ref|XP_008843539.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    2e-08   Nannospalax galili
ref|XP_004899055.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    2e-08   
ref|XP_008843540.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    2e-08   
ref|XP_004395104.1|  PREDICTED: post-GPI attachment to proteins f...  61.6    2e-08   Odobenus rosmarus divergens
ref|XP_004764703.1|  PREDICTED: post-GPI attachment to proteins f...  61.6    2e-08   Mustela putorius furo [black ferret]
ref|XP_008011041.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    2e-08   Chlorocebus sabaeus
ref|XP_003996830.1|  PREDICTED: post-GPI attachment to proteins f...  61.6    2e-08   Felis catus [cat]
ref|XP_009250140.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    2e-08   Pongo abelii [orang utan]
ref|XP_004395103.1|  PREDICTED: post-GPI attachment to proteins f...  61.6    2e-08   Odobenus rosmarus divergens
ref|XP_008955052.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    2e-08   Pan paniscus [bonobo]
ref|NP_001278659.1|  post-GPI attachment to proteins factor 3 iso...  60.1    3e-08   Homo sapiens [man]
ref|XP_008269636.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  61.6    3e-08   Oryctolagus cuniculus [domestic rabbit]
ref|NP_001278661.1|  post-GPI attachment to proteins factor 3 iso...  59.7    3e-08   Homo sapiens [man]
ref|XP_548142.4|  PREDICTED: LOW QUALITY PROTEIN: post-GPI attach...  61.6    3e-08   
ref|XP_005059868.1|  PREDICTED: post-GPI attachment to proteins f...  62.0    3e-08   
ref|XP_009188767.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    3e-08   Papio anubis [baboon]
ref|XP_004799098.1|  PREDICTED: post-GPI attachment to proteins f...  61.6    3e-08   
ref|XP_005294203.1|  PREDICTED: post-GPI attachment to proteins f...  61.2    3e-08   Chrysemys picta bellii
ref|XP_008011040.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    3e-08   Chlorocebus sabaeus
ref|XP_005294204.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    3e-08   Chrysemys picta bellii
ref|XP_007465230.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    3e-08   Lipotes vexillifer [baiji]
ref|NP_001271369.1|  post-GPI attachment to proteins factor 3 pre...  61.2    3e-08   Canis lupus familiaris [dogs]
ref|XP_004434624.1|  PREDICTED: post-GPI attachment to proteins f...  61.2    4e-08   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_008111541.1|  PREDICTED: post-GPI attachment to proteins f...  59.7    4e-08   
ref|XP_008843537.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    4e-08   
ref|XP_004091445.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    4e-08   
ref|XP_004859545.1|  PREDICTED: post-GPI attachment to proteins f...  61.2    4e-08   
ref|XP_004282779.1|  PREDICTED: post-GPI attachment to proteins f...  61.2    4e-08   
ref|XP_007465229.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    4e-08   
ref|XP_001501181.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    4e-08   
gb|EHH58072.1|  PER1-like domain-containing protein 1                 60.8    4e-08   
ref|XP_010814544.1|  PREDICTED: post-GPI attachment to proteins f...  58.9    4e-08   
ref|XP_003278278.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    4e-08   
ref|NP_001252663.1|  post-GPI attachment to proteins factor 3 pre...  60.8    4e-08   
ref|XP_010377600.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    4e-08   
ref|XP_007531011.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    4e-08   
ref|NP_001278657.1|  post-GPI attachment to proteins factor 3 iso...  60.8    4e-08   
ref|XP_004799097.1|  PREDICTED: post-GPI attachment to proteins f...  61.2    4e-08   
ref|XP_008843538.1|  PREDICTED: post-GPI attachment to proteins f...  59.3    4e-08   
ref|XP_002827692.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    5e-08   
ref|XP_004764702.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    5e-08   
ref|NP_219487.3|  post-GPI attachment to proteins factor 3 isofor...  60.8    5e-08   
ref|XP_511460.1|  PREDICTED: post-GPI attachment to proteins fact...  60.8    5e-08   
ref|XP_006832621.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    5e-08   
ref|XP_006260277.1|  PREDICTED: post-GPI attachment to proteins f...  60.8    5e-08   
dbj|BAC55580.1|  CAB2                                                 60.8    5e-08   
ref|XP_007531010.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    5e-08   
ref|XP_004311611.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    5e-08   
ref|XP_007112601.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    6e-08   
ref|XP_006832620.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    6e-08   
ref|XP_002407981.1|  post-GPI attachment to proteins factor, puta...  60.8    6e-08   
emb|CDS07088.1|  hypothetical protein LRAMOSA09611                    60.5    6e-08   
ref|XP_007764036.1|  Per1-like protein                                60.5    7e-08   
ref|XP_005861951.1|  PREDICTED: post-GPI attachment to proteins f...  60.5    7e-08   
ref|XP_004013425.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    7e-08   
ref|XP_005321841.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    7e-08   
ref|XP_003222491.2|  PREDICTED: post-GPI attachment to proteins f...  60.5    8e-08   
ref|XP_007177624.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    8e-08   
ref|XP_004591202.1|  PREDICTED: post-GPI attachment to proteins f...  60.1    9e-08   
ref|XP_004591203.1|  PREDICTED: post-GPI attachment to proteins f...  59.7    9e-08   
ref|XP_005964808.1|  PREDICTED: post-GPI attachment to proteins f...  59.7    1e-07   
ref|XP_005531473.1|  PREDICTED: post-GPI attachment to proteins f...  59.7    1e-07   
ref|XP_006068704.1|  PREDICTED: post-GPI attachment to proteins f...  59.7    1e-07   
ref|XP_010840964.1|  PREDICTED: post-GPI attachment to proteins f...  59.7    1e-07   
ref|XP_005964807.1|  PREDICTED: post-GPI attachment to proteins f...  59.7    1e-07   
ref|XP_003942893.1|  PREDICTED: post-GPI attachment to proteins f...  59.7    1e-07   
dbj|GAN01072.1|  conserved hypothetical protein                       59.7    1e-07   
gb|ELR54780.1|  Post-GPI attachment to proteins factor 3              59.7    1e-07   
ref|XP_003786464.1|  PREDICTED: post-GPI attachment to proteins f...  59.3    1e-07   
ref|NP_001137367.1|  post-GPI attachment to proteins factor 3 pre...  59.3    1e-07   
ref|XP_008843536.1|  PREDICTED: post-GPI attachment to proteins f...  59.3    1e-07   
ref|XP_002617181.1|  hypothetical protein CLUG_02625                  59.7    1e-07   
gb|KIY68776.1|  Per1-like protein                                     59.7    1e-07   
ref|XP_005898066.1|  PREDICTED: post-GPI attachment to proteins f...  59.3    1e-07   
ref|XP_005180266.1|  PREDICTED: post-GPI attachment to proteins f...  59.3    1e-07   
ref|XP_003786463.1|  PREDICTED: post-GPI attachment to proteins f...  59.3    1e-07   
ref|NP_001098833.1|  post-GPI attachment to proteins factor 3 pre...  59.3    1e-07   
ref|XP_007424262.1|  PREDICTED: post-GPI attachment to proteins f...  58.9    2e-07   
gb|EHH24900.1|  PER1-like domain-containing protein 1                 58.9    2e-07   
ref|XP_010814543.1|  PREDICTED: post-GPI attachment to proteins f...  58.9    2e-07   
ref|XP_007085925.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  58.9    2e-07   
ref|XP_007321687.1|  hypothetical protein SERLADRAFT_474943           58.9    2e-07   
gb|EGN96362.1|  hypothetical protein SERLA73DRAFT_59005               58.9    2e-07   
ref|XP_008070810.1|  PREDICTED: post-GPI attachment to proteins f...  57.4    2e-07   
ref|XP_010592699.1|  PREDICTED: post-GPI attachment to proteins f...  58.5    2e-07   
ref|XP_002748572.2|  PREDICTED: post-GPI attachment to proteins f...  58.9    2e-07   
ref|XP_008070819.1|  PREDICTED: post-GPI attachment to proteins f...  57.0    2e-07   
gb|EPQ05047.1|  Post-GPI attachment to proteins factor 3              58.9    2e-07   
ref|XP_003414744.1|  PREDICTED: post-GPI attachment to proteins f...  58.5    3e-07   
gb|EPB92095.1|  hypothetical protein HMPREF1544_01159                 58.5    3e-07   
ref|XP_004655527.1|  PREDICTED: post-GPI attachment to proteins f...  58.5    3e-07   
ref|XP_005693807.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  58.5    3e-07   
ref|XP_004655528.1|  PREDICTED: post-GPI attachment to proteins f...  58.2    3e-07   
ref|XP_008588015.1|  PREDICTED: post-GPI attachment to proteins f...  56.2    3e-07   
ref|XP_008548871.1|  PREDICTED: post-GPI attachment to proteins f...  58.5    3e-07   
ref|XP_008548872.1|  PREDICTED: post-GPI attachment to proteins f...  58.2    3e-07   
ref|XP_008070796.1|  PREDICTED: post-GPI attachment to proteins f...  58.2    4e-07   
ref|XP_008070788.1|  PREDICTED: post-GPI attachment to proteins f...  58.2    4e-07   
ref|NP_001028709.2|  post-GPI attachment to proteins factor 3 pre...  58.2    4e-07   
dbj|BAE42049.1|  unnamed protein product                              58.2    4e-07   
ref|XP_010584003.1|  PREDICTED: post-GPI attachment to proteins f...  58.2    4e-07   
ref|XP_003642860.1|  PREDICTED: post-GPI attachment to proteins f...  57.8    5e-07   
ref|XP_005104826.1|  PREDICTED: post-GPI attachment to proteins f...  57.8    5e-07   
ref|XP_011381325.1|  PREDICTED: post-GPI attachment to proteins f...  55.8    5e-07   
ref|XP_001370840.1|  PREDICTED: post-GPI attachment to proteins f...  57.8    5e-07   
ref|XP_005368340.1|  PREDICTED: post-GPI attachment to proteins f...  57.8    5e-07   
ref|XP_007296460.1|  putative Mn2+ homeostasis protein Per1           57.8    6e-07   
ref|XP_006971904.1|  PREDICTED: post-GPI attachment to proteins f...  57.8    6e-07   
ref|XP_006924763.1|  PREDICTED: post-GPI attachment to proteins f...  57.8    6e-07   
ref|XP_003131568.3|  PREDICTED: post-GPI attachment to proteins f...  57.4    6e-07   
ref|XP_011381324.1|  PREDICTED: post-GPI attachment to proteins f...  57.4    6e-07   
ref|XP_005075993.1|  PREDICTED: post-GPI attachment to proteins f...  57.4    6e-07   
ref|XP_005075994.1|  PREDICTED: post-GPI attachment to proteins f...  57.4    6e-07   
gb|KIY99526.1|  hypothetical protein MNEG_8435                        57.8    7e-07   
ref|XP_005653984.1|  PREDICTED: post-GPI attachment to proteins f...  57.8    7e-07   
ref|XP_011381323.1|  PREDICTED: post-GPI attachment to proteins f...  57.4    7e-07   
ref|XP_006676575.1|  hypothetical protein BATDEDRAFT_18873            57.0    8e-07   
ref|XP_001839867.1|  PER1                                             57.0    9e-07   
ref|XP_007638499.1|  PREDICTED: post-GPI attachment to proteins f...  57.0    9e-07   
ref|XP_004608988.1|  PREDICTED: post-GPI attachment to proteins f...  56.6    9e-07   
ref|NP_001233642.1|  post-GPI attachment to proteins factor 3 pre...  57.0    9e-07   
gb|KFH71265.1|  hypothetical protein MVEG_01566                       57.0    9e-07   
gb|EPY87156.1|  post-GPI attachment to proteins factor 3-like iso...  56.6    1e-06   
ref|XP_008588014.1|  PREDICTED: post-GPI attachment to proteins f...  57.0    1e-06   
ref|XP_004378092.1|  PREDICTED: post-GPI attachment to proteins f...  57.0    1e-06   
ref|XP_004378093.1|  PREDICTED: post-GPI attachment to proteins f...  56.6    1e-06   
gb|KHJ36390.1|  putative post-gpi attachment factor 3 protein         57.0    1e-06   
ref|XP_002929402.1|  PREDICTED: post-GPI attachment to proteins f...  56.6    1e-06   
ref|XP_004633765.1|  PREDICTED: post-GPI attachment to proteins f...  56.6    1e-06   
ref|XP_002796042.1|  Mn2+ homeostasis protein (Per1)                  56.6    1e-06   
ref|XP_006889452.1|  PREDICTED: post-GPI attachment to proteins f...  56.6    1e-06   
ref|XP_006889453.1|  PREDICTED: post-GPI attachment to proteins f...  56.2    1e-06   
gb|KGK37214.1|  hypothetical protein JL09_g3630                       56.6    2e-06   
ref|XP_006176416.1|  PREDICTED: LOW QUALITY PROTEIN: post-GPI att...  56.2    2e-06   
ref|XP_006214313.1|  PREDICTED: post-GPI attachment to proteins f...  56.2    2e-06   
ref|XP_010958773.1|  PREDICTED: post-GPI attachment to proteins f...  56.2    2e-06   
ref|XP_007940229.1|  PREDICTED: post-GPI attachment to proteins f...  55.8    2e-06   
ref|XP_010990123.1|  PREDICTED: post-GPI attachment to proteins f...  56.2    2e-06   
ref|XP_006214312.1|  PREDICTED: post-GPI attachment to proteins f...  56.2    2e-06   
ref|XP_001607194.2|  PREDICTED: post-GPI attachment to proteins f...  56.2    2e-06   
ref|XP_007308542.1|  Per1-like protein                                56.2    2e-06   
gb|KIK69963.1|  hypothetical protein GYMLUDRAFT_150557                56.2    2e-06   
ref|XP_002499669.1|  per1-like family protein                         56.2    2e-06   
gb|EPB91026.1|  hypothetical protein HMPREF1544_02095                 55.8    2e-06   
ref|XP_011268250.1|  PREDICTED: post-GPI attachment to proteins f...  54.3    2e-06   
ref|XP_007858451.1|  mn2+ homeostasis protein                         55.8    2e-06   
emb|CEJ90709.1|  Putative Mn2 homeostasis protein Per1                55.8    2e-06   
ref|XP_002600731.1|  hypothetical protein BRAFLDRAFT_83474            56.6    2e-06   
ref|XP_003466972.1|  PREDICTED: post-GPI attachment to proteins f...  55.8    2e-06   
gb|EFX05746.1|  Mn2+ homeostasis protein                              55.8    2e-06   
ref|XP_004684303.1|  PREDICTED: post-GPI attachment to proteins f...  55.5    3e-06   
gb|EPY52414.1|  GPI-phospholipase A2 activity regulator               55.8    3e-06   
ref|XP_004684302.1|  PREDICTED: post-GPI attachment to proteins f...  55.5    3e-06   
ref|XP_007592018.1|  hypothetical protein CFIO01_08811                55.5    3e-06   
ref|XP_003003590.1|  PER1                                             55.5    3e-06   
gb|KIP07488.1|  hypothetical protein PHLGIDRAFT_415639                55.5    3e-06   
gb|KGG52930.1|  hypothetical protein DI09_123p100                     55.1    4e-06   
ref|XP_009655353.1|  PER1 protein                                     55.1    5e-06   
ref|XP_002551228.1|  conserved hypothetical protein                   55.1    5e-06   
ref|XP_006156089.1|  PREDICTED: post-GPI attachment to proteins f...  55.1    5e-06   
ref|XP_011268249.1|  PREDICTED: post-GPI attachment to proteins f...  54.7    5e-06   
gb|KIW12574.1|  hypothetical protein PV08_09851                       54.7    6e-06   
ref|XP_010756422.1|  hypothetical protein PADG_00603                  54.7    6e-06   
gb|EEH19943.1|  hypothetical protein PABG_02202                       54.7    6e-06   
ref|XP_011449238.1|  PREDICTED: post-GPI attachment to proteins f...  54.7    6e-06   
ref|XP_002513401.1|  conserved hypothetical protein                   54.3    7e-06   
ref|XP_006022655.1|  PREDICTED: post-GPI attachment to proteins f...  54.3    7e-06   
emb|CCM05765.1|  predicted protein                                    54.7    7e-06   
ref|XP_008198099.1|  PREDICTED: post-GPI attachment to proteins f...  54.3    8e-06   
ref|XP_452290.1|  hypothetical protein                                54.3    8e-06   
dbj|GAA89994.1|  Mn2+ homeostasis protein                             54.3    9e-06   
gb|EFA09753.1|  hypothetical protein TcasGA2_TC011892                 54.3    9e-06   
ref|XP_003189413.1|  Mn2+ homeostasis protein (Per1)                  53.9    9e-06   
ref|XP_002381929.1|  Mn2+ homeostasis protein (Per1), putative        53.9    9e-06   
ref|XP_001398972.2|  Mn2+ homeostasis protein (Per1)                  53.9    1e-05   
gb|EEH39741.2|  Mn2+ homeostasis protein (Per1)                       53.9    1e-05   
gb|EMR86469.1|  putative mn2+ homeostasis protein per1 protein        53.9    1e-05   
gb|KIJ25732.1|  hypothetical protein M422DRAFT_38523                  53.5    1e-05   
gb|KIW08332.1|  hypothetical protein PV09_01249                       53.5    1e-05   
gb|KEZ44157.1|  hypothetical protein SAPIO_CDS3081                    53.5    2e-05   
gb|EER37200.1|  Mn2+ homeostasis protein                              53.1    2e-05   
ref|XP_002623479.1|  Mn2+ homeostasis protein                         53.1    2e-05   
emb|CDH49221.1|  per1-like protein                                    53.1    2e-05   
gb|ESZ90588.1|  hypothetical protein SBOR_9021                        53.1    2e-05   
gb|ESX02697.1|  Protein of the endoplasmic reticulum, required fo...  53.1    2e-05   
gb|EPX73000.1|  GPI-phospholipase A2 activity regulator               53.1    2e-05   
gb|EPT06260.1|  hypothetical protein FOMPIDRAFT_1027075               52.8    2e-05   
ref|XP_001385162.2|  hypothetical protein PICST_46428                 52.8    3e-05   
ref|XP_005394375.1|  PREDICTED: post-GPI attachment to proteins f...  52.4    3e-05   
ref|XP_003700743.1|  PREDICTED: post-GPI attachment to proteins f...  52.8    3e-05   
ref|XP_011119704.1|  hypothetical protein AOL_s00054g86               52.8    3e-05   
ref|XP_460341.2|  DEHA2E23936p                                        52.8    3e-05   
gb|EUC59752.1|  Mn2+ homeostasis protein (Per1)                       52.8    3e-05   
ref|XP_001269527.1|  Mn2+ homeostasis protein (Per1), putative        52.4    3e-05   
ref|XP_001938554.1|  Mn2+ homeostasis protein Per1                    52.4    3e-05   
gb|EFQ28773.1|  hypothetical protein GLRG_03917                       52.4    3e-05   
ref|NP_986226.2|  AFR678Cp                                            52.4    4e-05   
ref|XP_002850602.1|  conserved hypothetical protein                   52.4    4e-05   
emb|CEI96473.1|  hypothetical protein RMCBS344292_10633               52.0    4e-05   
ref|XP_003297679.1|  hypothetical protein PTT_08169                   52.0    5e-05   
ref|XP_002080312.1|  GD10418                                          52.0    5e-05   
emb|CEG71087.1|  hypothetical protein RMATCC62417_06875               52.0    5e-05   
ref|XP_007759993.1|  hypothetical protein A1O7_07807                  52.0    5e-05   
ref|XP_002032625.1|  GM20888                                          52.0    5e-05   
ref|XP_006458662.1|  hypothetical protein AGABI2DRAFT_200471          52.0    5e-05   
gb|KGO44931.1|  hypothetical protein PEXP_090000                      52.0    5e-05   
ref|XP_006421842.1|  hypothetical protein CICLE_v10005347mg           51.6    6e-05   
gb|KDO60109.1|  hypothetical protein CISIN_1g019038mg                 51.6    6e-05   
ref|XP_002497938.1|  ZYRO0F16940p                                     51.6    6e-05   
ref|XP_006386638.1|  hypothetical protein POPTR_0002s17790g           48.5    6e-05   
gb|EYE99388.1|  Mn2+ homeostasis protein                              51.6    7e-05   
ref|XP_002089356.1|  GE19068                                          51.6    7e-05   
ref|XP_008029976.1|  hypothetical protein SETTUDRAFT_96058            51.6    7e-05   
gb|KIL94652.1|  hypothetical protein FAVG1_01583                      51.6    7e-05   
ref|XP_001212166.1|  conserved hypothetical protein                   51.6    7e-05   
gb|KIW53595.1|  hypothetical protein PV05_09152                       51.6    7e-05   
ref|XP_002143617.1|  Mn2+ homeostasis protein (Per1), putative        51.2    8e-05   
ref|XP_002492092.1|  Protein of the endoplasmic reticulum, requir...  51.2    9e-05   
gb|EAS32506.3|  Mn2+ homeostasis protein                              50.8    1e-04   
ref|XP_008111540.1|  PREDICTED: post-GPI attachment to proteins f...  50.8    1e-04   
ref|XP_002176043.1|  GPI-phospholipase A2 activity regulator          50.8    1e-04   
gb|KIW80752.1|  hypothetical protein Z517_07368                       50.8    1e-04   
ref|XP_002558712.1|  Pc13g02730                                       50.8    1e-04   
gb|EPS27679.1|  hypothetical protein PDE_02623                        50.8    1e-04   
gb|KIW24013.1|  hypothetical protein PV07_09752                       50.8    1e-04   
ref|XP_004921566.1|  PREDICTED: post-GPI attachment to proteins f...  50.8    1e-04   
gb|EGE06131.1|  PER1                                                  50.8    1e-04   
ref|XP_006940364.1|  PREDICTED: post-GPI attachment to proteins f...  50.4    1e-04   
ref|XP_011272310.1|  Post-GPI attachment to proteins factor 3         51.2    1e-04   
ref|XP_460285.2|  DEHA2E22638p                                        50.8    1e-04   
gb|EIE84161.1|  hypothetical protein RO3G_08871                       50.8    2e-04   
gb|EZA46608.1|  Post-GPI attachment to proteins factor                50.8    2e-04   
emb|CDR47817.1|  CYFA0S38e00188g1_1                                   50.4    2e-04   
emb|CEP08422.1|  hypothetical protein                                 50.8    2e-04   
gb|KDR81958.1|  hypothetical protein GALMADRAFT_135342                50.4    2e-04   
ref|XP_004921567.1|  PREDICTED: post-GPI attachment to proteins f...  50.1    2e-04   
gb|KIX99658.1|  hypothetical protein Z520_04293                       50.4    2e-04   
gb|EFW20582.1|  Mn2+ homeostasis protein                              50.4    2e-04   
ref|XP_011351150.1|  PREDICTED: post-GPI attachment to proteins f...  50.1    2e-04   
ref|XP_001597372.1|  hypothetical protein SS1G_01566                  50.1    2e-04   
dbj|GAM39653.1|  hypothetical protein TCE0_034f11376                  50.1    2e-04   
ref|XP_001385146.2|  hypothetical protein PICST_59991                 50.1    2e-04   
dbj|BAC11642.1|  unnamed protein product                              50.1    2e-04   
ref|XP_003278279.1|  PREDICTED: post-GPI attachment to proteins f...  50.1    2e-04   



>ref|XP_009787384.1| PREDICTED: post-GPI attachment to proteins factor 3 [Nicotiana 
sylvestris]
Length=185

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA  RL+L  A F SIF +L+AS GDADP+Y+ CV QCEK+GCVG KC QHCNF+SGG+P
Sbjct  1    MAQCRLLLFLAAFFSIFGLLHASAGDADPVYRACVDQCEKTGCVGDKCSQHCNFTSGGSP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLYL+WKQWDCLSDCRYHCML+REEER+KLGLKPVKYHGKWPFQRV
Sbjct  61   IDGPWYLQEPLYLRWKQWDCLSDCRYHCMLSREEERKKLGLKPVKYHGKWPFQRV  115



>ref|XP_009586779.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
tomentosiformis]
Length=342

 Score =   206 bits (524),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA  RL+L  A+F SIF +L+AS GDADP+Y+ CV QCEK+GCVG KC QHCNF+SGG+P
Sbjct  1    MAQCRLLLFLAVFFSIFGLLHASAGDADPVYRACVDQCEKTGCVGNKCSQHCNFTSGGSP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLYL+WKQWDCLSDCRYHCML+REEER+KLGLKPVKYHGKWPFQRV
Sbjct  61   IDGPWYLQEPLYLRWKQWDCLSDCRYHCMLSREEERKKLGLKPVKYHGKWPFQRV  115



>ref|XP_009625146.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
tomentosiformis]
Length=342

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RLVL  A  SS+F +L+A+ GD+DPIYK CV QC+++GCVG  CFQHCNFSSG NPIDGP
Sbjct  5    RLVLFLAAISSVFRLLHATSGDSDPIYKACVDQCKETGCVGDNCFQHCNFSSGRNPIDGP  64

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WYLQEPLYL+WKQWDCLSDCRYHCML REEERQKLGLKP+KYHGKWPF+RV
Sbjct  65   WYLQEPLYLRWKQWDCLSDCRYHCMLVREEERQKLGLKPIKYHGKWPFRRV  115



>ref|XP_009775256.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
sylvestris]
Length=342

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RLVL  A  SS+F +L+A+ GD+DPIYK CV QC+++GCVG  CFQHCNFSSGGN I GP
Sbjct  5    RLVLFLAAISSVFRLLHATSGDSDPIYKACVDQCKETGCVGDNCFQHCNFSSGGNLIGGP  64

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WYLQEPLYL+WKQWDCLSDCRYHCML REEERQKLGLKP+KYHGKWPF+RV
Sbjct  65   WYLQEPLYLRWKQWDCLSDCRYHCMLVREEERQKLGLKPIKYHGKWPFRRV  115



>ref|XP_006421843.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 gb|ESR35083.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 gb|KDO60110.1| hypothetical protein CISIN_1g019038mg [Citrus sinensis]
Length=260

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA   L+ LF L S     L ASDGDADPIYK CV+QCEK+GCVG KCFQHCNFSS G P
Sbjct  1    MAHSHLIALFLLISCTLPALYASDGDADPIYKGCVEQCEKTGCVGDKCFQHCNFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLYL+WKQWDC SDCRYHCMLARE ER+K+G KPVKYHGKWPF+RV
Sbjct  61   IDGPWYLQEPLYLRWKQWDCSSDCRYHCMLAREGEREKVGDKPVKYHGKWPFRRV  115



>ref|XP_008234299.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Prunus 
mume]
Length=342

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MAP R +L  A   S+   L+AS GDADPIYK CV QCEKSGCVG KCFQHC FSS G P
Sbjct  1    MAPLRCILFLAALCSLIPALHASAGDADPIYKSCVVQCEKSGCVGEKCFQHCKFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+QEPLYL+WKQWDC SDCRYHCMLAREEER+KLG KPVKYHGKWPFQRV
Sbjct  61   IDGPWYMQEPLYLRWKQWDCRSDCRYHCMLAREEEREKLGDKPVKYHGKWPFQRV  115



>ref|XP_007218263.1| hypothetical protein PRUPE_ppa008189mg [Prunus persica]
 gb|EMJ19462.1| hypothetical protein PRUPE_ppa008189mg [Prunus persica]
Length=342

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MAP R +L  A   S+   L+AS GDADPIYK CV QCEKSGCVG KCFQHC FSS G P
Sbjct  1    MAPLRCILFLAALCSLIPSLHASAGDADPIYKSCVVQCEKSGCVGEKCFQHCKFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+QEPLYL+WKQWDC SDCRYHCMLAREEER+KLG KPVKYHGKWPFQRV
Sbjct  61   IDGPWYMQEPLYLRWKQWDCRSDCRYHCMLAREEEREKLGDKPVKYHGKWPFQRV  115



>ref|XP_004234347.1| PREDICTED: post-GPI attachment to proteins factor 3 [Solanum 
lycopersicum]
Length=343

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 1/116 (1%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASD-GDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGN  339
            MA  R +L FA+ SSIF +L+A+  GDADPIY  CV QCEK+GCVG +C QHCNF+SGG 
Sbjct  1    MARCRFLLFFAVLSSIFGLLHAATAGDADPIYSACVDQCEKTGCVGGECSQHCNFTSGGV  60

Query  340  PIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            PIDGPWYLQEPLYL+WKQWDCLSDCRYHCMLARE+ER+K+GLKPVKYH KWPFQRV
Sbjct  61   PIDGPWYLQEPLYLRWKQWDCLSDCRYHCMLAREDERKKVGLKPVKYHRKWPFQRV  116



>gb|KJB52865.1| hypothetical protein B456_008G280700 [Gossypium raimondii]
Length=284

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MAP RL+L+  + S + + LNAS+GDADPIYK C+++CEKSGCVG KCFQHC FSS G P
Sbjct  4    MAPCRLILIIFVLSFLVSSLNASEGDADPIYKACLEECEKSGCVGEKCFQHCKFSSDGKP  63

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLY KWKQWDC +DC+YHCM+ REE+R+KLG KP+KYHGKWPFQRV
Sbjct  64   IDGPWYLQEPLYQKWKQWDCRTDCQYHCMITREEQREKLGNKPIKYHGKWPFQRV  118



>ref|XP_006421844.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 ref|XP_006490320.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Citrus 
sinensis]
 gb|ESR35084.1| hypothetical protein CICLE_v10005347mg [Citrus clementina]
 gb|KDO60106.1| hypothetical protein CISIN_1g019038mg [Citrus sinensis]
Length=342

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA   L+ LF L S     L ASDGDADPIYK CV+QCEK+GCVG KCFQHCNFSS G P
Sbjct  1    MAHSHLIALFLLISCTLPALYASDGDADPIYKGCVEQCEKTGCVGDKCFQHCNFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLYL+WKQWDC SDCRYHCMLARE ER+K+G KPVKYHGKWPF+RV
Sbjct  61   IDGPWYLQEPLYLRWKQWDCSSDCRYHCMLAREGEREKVGDKPVKYHGKWPFRRV  115



>gb|KDO60107.1| hypothetical protein CISIN_1g019038mg [Citrus sinensis]
Length=347

 Score =   194 bits (492),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA   L+ LF L S     L ASDGDADPIYK CV+QCEK+GCVG KCFQHCNFSS G P
Sbjct  1    MAHSHLIALFLLISCTLPALYASDGDADPIYKGCVEQCEKTGCVGDKCFQHCNFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLYL+WKQWDC SDCRYHCMLARE ER+K+G KPVKYHGKWPF+RV
Sbjct  61   IDGPWYLQEPLYLRWKQWDCSSDCRYHCMLAREGEREKVGDKPVKYHGKWPFRRV  115



>gb|KHG15846.1| Post-GPI attachment tos factor 3 [Gossypium arboreum]
Length=345

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MAP RL+LL  + S + + LNAS+GDADPIYK C+++CEKSGCVG KCFQHC FSS G P
Sbjct  4    MAPCRLILLIFVLSFLVSSLNASEGDADPIYKACLEECEKSGCVGEKCFQHCKFSSDGKP  63

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLY KWKQWDC +DC+YHCM+ REE+R+KLG KP+KYHGKWPFQRV
Sbjct  64   IDGPWYLQEPLYQKWKQWDCRTDCQYHCMITREEQREKLGNKPIKYHGKWPFQRV  118



>gb|KJB52864.1| hypothetical protein B456_008G280700 [Gossypium raimondii]
Length=345

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MAP RL+L+  + S + + LNAS+GDADPIYK C+++CEKSGCVG KCFQHC FSS G P
Sbjct  4    MAPCRLILIIFVLSFLVSSLNASEGDADPIYKACLEECEKSGCVGEKCFQHCKFSSDGKP  63

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLY KWKQWDC +DC+YHCM+ REE+R+KLG KP+KYHGKWPFQRV
Sbjct  64   IDGPWYLQEPLYQKWKQWDCRTDCQYHCMITREEQREKLGNKPIKYHGKWPFQRV  118



>gb|EYU25051.1| hypothetical protein MIMGU_mgv1a009430mg [Erythranthe guttata]
Length=342

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA RR VL     S     L AS GDADP+Y+ CV++CEK+GCVG KCFQHC FSS GNP
Sbjct  1    MARRRFVLFLVALSCFAGSLKASPGDADPVYRGCVEECEKTGCVGEKCFQHCTFSSDGNP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLY++WKQWDCLSDCRYHCML+REEE+ KLG +PVKYHGKWPF+R+
Sbjct  61   IDGPWYLQEPLYIQWKQWDCLSDCRYHCMLSREEEKHKLGYQPVKYHGKWPFKRI  115



>ref|NP_001275064.1| Per1-like family protein precursor [Solanum tuberosum]
 gb|ABB72805.1| Per1-like family protein [Solanum tuberosum]
Length=342

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  205  SIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLK  384
            SIF +L+AS GDADPIY  CV QCEK+GCVG +C QHCNF+SGG P+DGPWYLQEPLYL+
Sbjct  15   SIFGLLHASAGDADPIYSACVDQCEKTGCVGDECSQHCNFTSGGIPVDGPWYLQEPLYLR  74

Query  385  WKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WKQWDCLSDCRYHCMLARE+ER+K+GLKPVKYHGKWPFQRV
Sbjct  75   WKQWDCLSDCRYHCMLAREKERKKVGLKPVKYHGKWPFQRV  115



>ref|XP_004240743.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
lycopersicum]
Length=342

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RL+L FA  S IF +++A+ G+ DPIY+ CV  C+++GCVG KCFQHCNFSSG NPIDGP
Sbjct  5    RLLLFFAAISFIFRLIHANSGEDDPIYQACVGHCKETGCVGGKCFQHCNFSSGENPIDGP  64

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WYLQEPLY +WKQWDCLSDCRYHCM+AREEERQKLGL+P+KYH KWPFQRV
Sbjct  65   WYLQEPLYQRWKQWDCLSDCRYHCMIAREEERQKLGLQPIKYHRKWPFQRV  115



>gb|ABB86252.1| Per1-like family protein [Solanum tuberosum]
Length=342

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  205  SIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLK  384
            SIF +L+AS GDADPIY  CV QCEK+GCVG +C QHCNF+SGG P+DGPWYLQEPLYL+
Sbjct  15   SIFGLLHASAGDADPIYSACVDQCEKTGCVGDECSQHCNFTSGGIPVDGPWYLQEPLYLR  74

Query  385  WKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WKQWDCLSDCRYHCMLARE+ER+K+GLKPVKYHGKWPFQRV
Sbjct  75   WKQWDCLSDCRYHCMLAREKERKKVGLKPVKYHGKWPFQRV  115



>ref|XP_011076241.1| PREDICTED: post-GPI attachment to proteins factor 3 [Sesamum 
indicum]
Length=342

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  RR +L          +L AS GDADP+Y+ CV+QCEK+GCVG KCFQHCNFSS GNP
Sbjct  1    MERRRFLLFLVALLCFAGLLEASPGDADPVYRACVEQCEKTGCVGDKCFQHCNFSSEGNP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            IDGPWYLQEPLYL+WKQWDC SDCRYHCM++REEERQKLG KPVKYHGKWPF+R
Sbjct  61   IDGPWYLQEPLYLQWKQWDCRSDCRYHCMISREEERQKLGHKPVKYHGKWPFKR  114



>emb|CDP05250.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 101/119 (85%), Gaps = 2/119 (2%)
 Frame = +1

Query  154  LAPMAPRRL-VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSS  330
            +A +  RRL VLLF  FSSI  V +AS GDADPIY  CV+QCEK+GCVG KCFQHCNFS+
Sbjct  1    MASIRCRRLPVLLFLSFSSILGVTDASAGDADPIYGACVEQCEKTGCVGGKCFQHCNFSN  60

Query  331  GGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            G N IDGPWYLQEPLYL+WK+WDC SDCRY CMLAREEER++LG KPVKYHGKWPF+RV
Sbjct  61   G-NSIDGPWYLQEPLYLRWKRWDCQSDCRYQCMLAREEERKELGYKPVKYHGKWPFRRV  118



>ref|XP_006340525.1| PREDICTED: protein PER1 homolog [Solanum tuberosum]
Length=342

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RL+L FA  S IF +++A+ G+ DPIY+ CV  C+++GCVG KCFQHCNFSSG NPIDGP
Sbjct  5    RLLLFFAAISPIFRLIHATSGEDDPIYQACVGHCKETGCVGEKCFQHCNFSSGENPIDGP  64

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WYLQEPLY +WKQWDCLSDCRYHCM+AREE RQKLGL+P+KYH KWPFQRV
Sbjct  65   WYLQEPLYQRWKQWDCLSDCRYHCMIAREEGRQKLGLQPIKYHRKWPFQRV  115



>ref|XP_006353377.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
tuberosum]
Length=342

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  208  IFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKW  387
            IF +L+AS GDADPIY  CV QCEK+GCVG +C QHCNF+SG  PIDGPWYLQEPLYL+W
Sbjct  16   IFGLLHASAGDADPIYSACVDQCEKTGCVGDECSQHCNFTSGEIPIDGPWYLQEPLYLRW  75

Query  388  KQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            KQWDCLSDCRYHCMLARE+ER+K+GLKPVKYHGKWPFQRV
Sbjct  76   KQWDCLSDCRYHCMLAREDEREKVGLKPVKYHGKWPFQRV  115



>ref|XP_004234349.1| PREDICTED: post-GPI attachment to proteins factor 3 [Solanum 
lycopersicum]
Length=342

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +1

Query  208  IFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKW  387
            IF +L+AS GDADPIY  CV QCEK+GCVG +C QHCNF+SGG P+DGPWYLQEPLYL+W
Sbjct  16   IFGLLHASAGDADPIYSACVDQCEKTGCVGDECSQHCNFTSGGVPVDGPWYLQEPLYLRW  75

Query  388  KQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            KQWDCLSDCRYHCMLARE+ER+K GLKPVKYHGKWPFQR
Sbjct  76   KQWDCLSDCRYHCMLAREKERKKAGLKPVKYHGKWPFQR  114



>ref|XP_007038582.1| Per1-like family protein [Theobroma cacao]
 gb|EOY23083.1| Per1-like family protein [Theobroma cacao]
Length=345

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MAP  L+LLF   S +   L+AS+GDADPIYK C++ CEKSGCVG  CFQHC FSS G P
Sbjct  4    MAPCGLILLFFALSFLVPSLDASEGDADPIYKACLEDCEKSGCVGETCFQHCKFSSDGKP  63

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLY KWKQWDC +DCRYHCMLAREE+R  LG KPVKYHGKWPF+RV
Sbjct  64   IDGPWYLQEPLYQKWKQWDCRTDCRYHCMLAREEQRGNLGDKPVKYHGKWPFRRV  118



>ref|XP_010106800.1| hypothetical protein L484_005346 [Morus notabilis]
 gb|EXC11885.1| hypothetical protein L484_005346 [Morus notabilis]
Length=342

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA   L+LL +   +    L+AS GDADPIYK CV+QCEKSGCVG KCFQHC FSS G P
Sbjct  1    MAHLPLILLVSALCASLPALDASAGDADPIYKSCVEQCEKSGCVGSKCFQHCKFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+QEPLYL+WKQWDC SDCRY CML REEER+KLG KPVKYHGKWPF+RV
Sbjct  61   IDGPWYMQEPLYLRWKQWDCRSDCRYQCMLDREEEREKLGDKPVKYHGKWPFRRV  115



>ref|XP_010278515.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nelumbo 
nucifera]
Length=342

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R  ++  A FS +  VLNAS GD+DP+YK CV QCEK+GCVG  CFQHC FSS G P
Sbjct  1    MADRYWIVFCAAFSCLVGVLNASPGDSDPLYKSCVDQCEKTGCVGDTCFQHCRFSSDGIP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DGPWY+QEPLYL+WKQWDC SDCRYHCML RE ER+KLG KPVKYHGKWPF RV
Sbjct  61   VDGPWYMQEPLYLRWKQWDCQSDCRYHCMLDREREREKLGNKPVKYHGKWPFWRV  115



>ref|XP_009341265.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
Length=342

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA  R +LL A  SS+   L ASDGDADPIYK CV +CEKSGCVG  CFQHC FSS G P
Sbjct  1    MAQLRCILLLAFLSSLLPALRASDGDADPIYKSCVAECEKSGCVGDTCFQHCKFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+QEPLYL+WKQWDC SDCRYHCM AREEER+KLG KPVKYHGKWPFQRV
Sbjct  61   IDGPWYMQEPLYLRWKQWDCRSDCRYHCMFAREEEREKLGHKPVKYHGKWPFQRV  115



>ref|XP_004513683.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cicer 
arietinum]
Length=342

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA  R + LFA F S    + ASDGDAD IYK CV+QCE+SGCVG KCFQHC FSS G  
Sbjct  1    MALFRSLFLFAAFCSFLLSIAASDGDADLIYKGCVEQCEESGCVGDKCFQHCKFSSDGKS  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+ EPLYL+WKQWDC +DCRYHCM+AREEER K G KPVKYHGKWPF+R+
Sbjct  61   IDGPWYMHEPLYLRWKQWDCRTDCRYHCMVAREEERTKFGEKPVKYHGKWPFRRI  115



>ref|XP_011030037.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Populus euphratica]
Length=348

 Score =   182 bits (463),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  148  TVLAPMAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFS  327
            T +A  + R ++   +L   +   + +SDGDADPIYKVCV+QCEK+GCVG KCFQHC FS
Sbjct  2    TQMARWSFRGILAFVSLLVFLTHGVYSSDGDADPIYKVCVEQCEKTGCVGEKCFQHCKFS  61

Query  328  SGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            S G P+ GPWYLQEPLYL+WKQWDC SDC+YHCMLAREEER+KLG KPVKYHGKWPF R
Sbjct  62   SDGKPVGGPWYLQEPLYLQWKQWDCRSDCQYHCMLAREEEREKLGGKPVKYHGKWPFHR  120



>gb|ACA64424.1| PERLD1 [Glycine max]
Length=342

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M+P R +LLFA    +   L A+DGDADP+Y  CV+QC+K+GCVG +CFQHC FSS G P
Sbjct  1    MSPFRPLLLFAAVFFLLRPLAATDGDADPLYIGCVEQCKKTGCVGDRCFQHCKFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+ EPLYL+WKQWDC +DCRY+CMLAREEER KLG KPVKYHGKWPF+RV
Sbjct  61   IDGPWYMHEPLYLRWKQWDCCTDCRYYCMLAREEERTKLGDKPVKYHGKWPFRRV  115



>gb|KDP22331.1| hypothetical protein JCGZ_26162 [Jatropha curcas]
Length=345

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = +1

Query  172  RRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDG  351
            R ++L F+LF  +   L+AS GDADP+YK CV+QC+K+GCVG KCFQHC FS+ G PIDG
Sbjct  8    RWILLSFSLFCLVRG-LDASAGDADPVYKSCVEQCQKTGCVGGKCFQHCKFSADGKPIDG  66

Query  352  PWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            PWYLQEPLYL+WKQWDC SDCRYHCM+AREEERQKLG KPVKYHGKW FQRV
Sbjct  67   PWYLQEPLYLQWKQWDCRSDCRYHCMVAREEERQKLGDKPVKYHGKWAFQRV  118



>ref|XP_008377107.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Malus 
domestica]
Length=342

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA  R +LL A  SS+   L ASDGDADPIYK CV +CEKSGCVG  CFQHC FSS G P
Sbjct  1    MAQLRCILLLAFLSSLLPALRASDGDADPIYKSCVAECEKSGCVGDTCFQHCKFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+QEPLYL+WKQWDC SDCRYHCM AREEER++LG KPVKYHGKWPFQRV
Sbjct  61   IDGPWYMQEPLYLRWKQWDCRSDCRYHCMFAREEEREELGHKPVKYHGKWPFQRV  115



>gb|KJB39383.1| hypothetical protein B456_007G010000 [Gossypium raimondii]
Length=345

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            +A   L++     S +   L AS+GDADPIYK C++ CEKSGCVG  CFQHC FSS G P
Sbjct  4    IARSHLIMFLFALSFLVPSLEASEGDADPIYKTCLEDCEKSGCVGEMCFQHCKFSSDGKP  63

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLY KWKQWDC SDCRYHCM+AREE+R KLG KP+KYHGKWPFQRV
Sbjct  64   IDGPWYLQEPLYQKWKQWDCRSDCRYHCMIAREEQRWKLGGKPIKYHGKWPFQRV  118



>ref|XP_010255551.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nelumbo 
nucifera]
Length=342

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R  +   A  S +F VLNAS GD+DP+YK C++QCEK+GCV   CFQHC FSS G P
Sbjct  1    MADRCWIAFLAALSCLFGVLNASAGDSDPLYKACLEQCEKTGCVRDLCFQHCRFSSDGVP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+QEPLYL+WKQWDC SDCRYHCML RE ER+KLG +PVKYHGKWPFQ V
Sbjct  61   IDGPWYMQEPLYLRWKQWDCQSDCRYHCMLDREREREKLGNRPVKYHGKWPFQHV  115



>gb|KHG02645.1| Post-GPI attachment tos factor 3 [Gossypium arboreum]
Length=345

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            +A   L++     S +   L AS+GDADPIYK C++ CE SGCVG  CFQHC FSS G P
Sbjct  4    IARSHLIMFLFALSFLVPSLEASEGDADPIYKTCLEDCEISGCVGEMCFQHCKFSSDGKP  63

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWYLQEPLY KWKQWDC SDCRYHCM+AREE+R KLG KP+KYHGKWPFQRV
Sbjct  64   IDGPWYLQEPLYQKWKQWDCRSDCRYHCMIAREEQRWKLGGKPIKYHGKWPFQRV  118



>ref|XP_008376516.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Malus 
domestica]
Length=342

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  226  ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCL  405
            ASDGDADPIYK CV +CEKSGCVG  CFQHC FSS G PIDGPWY+QEPLYL+WKQWDC 
Sbjct  22   ASDGDADPIYKSCVAECEKSGCVGDTCFQHCKFSSDGKPIDGPWYMQEPLYLRWKQWDCR  81

Query  406  SDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            SDCRYHCMLAREEER+KLG KPVKYHGKWP +RV
Sbjct  82   SDCRYHCMLAREEEREKLGNKPVKYHGKWPLRRV  115



>ref|XP_003549124.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Glycine 
max]
Length=342

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M+P R +LLFA    +   L A+ GDADP+Y  CV+QC+K+GCVG +CFQHC FSS G P
Sbjct  1    MSPFRSLLLFATVFFLLHPLAATHGDADPLYIGCVEQCKKTGCVGDRCFQHCKFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+ EPLYL+WKQWDC +DCRY+CML+REEER KLG KPVKYHGKWPF RV
Sbjct  61   IDGPWYMHEPLYLRWKQWDCCTDCRYYCMLSREEERTKLGDKPVKYHGKWPFHRV  115



>gb|EYU19511.1| hypothetical protein MIMGU_mgv1a009409mg [Erythranthe guttata]
Length=343

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +1

Query  163  MAPRRLVLLFAL-FSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGN  339
            M  R   L+F +  SS+F +L+ S GDADP+Y+ C++QCEK+GCVG KCF+HCNFSS G+
Sbjct  1    MMGRSFFLIFLVALSSLFVLLHGSPGDADPLYQSCLKQCEKTGCVGSKCFKHCNFSSSGD  60

Query  340  PIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              +GPWYLQEPLY++WKQW CLSDCRYHCML+REEERQK+G +P KYHGKWPF+R+
Sbjct  61   STNGPWYLQEPLYVQWKQWGCLSDCRYHCMLSREEERQKIGHEPEKYHGKWPFKRI  116



>ref|XP_009371276.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
Length=342

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWD  399
            L ASDGDADPIYK CV +CEKSGCVG  CFQHC FSS G PIDGPWY+QEPLYL+WKQWD
Sbjct  20   LRASDGDADPIYKSCVAECEKSGCVGDTCFQHCKFSSDGKPIDGPWYMQEPLYLRWKQWD  79

Query  400  CLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            C SDCRYHCMLAREEER+KLG K VKYHGKWP +RV
Sbjct  80   CRSDCRYHCMLAREEEREKLGDKAVKYHGKWPLRRV  115



>ref|XP_002318250.1| hypothetical protein POPTR_0012s13850g [Populus trichocarpa]
 gb|ABK96708.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE96470.1| hypothetical protein POPTR_0012s13850g [Populus trichocarpa]
Length=348

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 87/106 (82%), Gaps = 4/106 (4%)
 Frame = +1

Query  199  FSSIFAVLN----ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQ  366
            F S+   L     ASDGDADPIYK CV+QCEK+GCVG KCFQHC FSS G P+ GPWYLQ
Sbjct  15   FVSLLVFLTHGVYASDGDADPIYKACVEQCEKTGCVGEKCFQHCKFSSDGKPVGGPWYLQ  74

Query  367  EPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            EPLYL+WKQWDC SDC+YHCML REEER+KLG KPVKYHGKWPF R
Sbjct  75   EPLYLQWKQWDCRSDCQYHCMLVREEEREKLGGKPVKYHGKWPFHR  120



>ref|XP_010035088.1| PREDICTED: post-GPI attachment to proteins factor 3 [Eucalyptus 
grandis]
 gb|KCW46381.1| hypothetical protein EUGRSUZ_K00216 [Eucalyptus grandis]
Length=342

 Score =   177 bits (449),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  214  AVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQ  393
            A L+AS GDADPIY+ CV++CE SGCVG KCFQHC FSS G PIDGPWYLQEPLYL+WK 
Sbjct  18   AALDASAGDADPIYRSCVEKCESSGCVGDKCFQHCKFSSDGKPIDGPWYLQEPLYLRWKH  77

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WDC SDCRY CML REEERQKLG +PVKYHGKWPF+RV
Sbjct  78   WDCQSDCRYQCMLVREEERQKLGHEPVKYHGKWPFKRV  115



>gb|KEH26587.1| post-GPI attachment-like factor-protein [Medicago truncatula]
Length=342

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
             V+L  L S + +V +ASDGD D IYK CV+QCEKSGCVG +CFQHC FSS G PIDGPW
Sbjct  7    FVVLVVLCSFLLSV-DASDGDTDLIYKGCVEQCEKSGCVGDRCFQHCKFSSDGKPIDGPW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            Y+ EPLYL+WKQWDC +DCRYHCMLAREEER KLG  PVKYHGKWPF+R+
Sbjct  66   YMHEPLYLEWKQWDCRTDCRYHCMLAREEERTKLGETPVKYHGKWPFRRI  115



>ref|XP_002322440.1| hypothetical protein POPTR_0015s13810g [Populus trichocarpa]
 gb|EEF06567.1| hypothetical protein POPTR_0015s13810g [Populus trichocarpa]
Length=345

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +1

Query  166  APRRLVLLFA-LFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            +P   +LLFA +   +   ++ASDGDADPIYK CV+QCEK+GCVG KCFQHC FSS G P
Sbjct  4    SPFHRILLFAWIVVLLMDGVHASDGDADPIYKACVEQCEKTGCVGEKCFQHCKFSSDGKP  63

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
              GPWYLQEPLYL+WKQWDC SDCRYHCML REEER+KLG KPVKYHGKW F+R
Sbjct  64   EGGPWYLQEPLYLQWKQWDCRSDCRYHCMLTREEEREKLGGKPVKYHGKWLFRR  117



>gb|KDP25109.1| hypothetical protein JCGZ_22644 [Jatropha curcas]
Length=342

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  +  F + S +  VL+AS GDADP+Y+ CVQQCEK+GCVG +CF HC FSS G  
Sbjct  1    MVDRNWISFFLVLSCLVQVLDASIGDADPVYRSCVQQCEKTGCVGQRCFPHCKFSSDGVS  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+QEPLYL+WKQWDC SDCRYHCML RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  61   IDGPWYMQEPLYLQWKQWDCESDCRYHCMLDREKEREALGYGPVKYHGKWPFKRV  115



>gb|KCW90759.1| hypothetical protein EUGRSUZ_A02835 [Eucalyptus grandis]
Length=303

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWD  399
            L+AS GD DP+YK CV++CE+SGCVG +CFQHC FSS G P+DGPWY+QEPLYL+WKQWD
Sbjct  21   LDASAGDVDPVYKSCVEKCEQSGCVGDQCFQHCKFSSDGKPVDGPWYMQEPLYLRWKQWD  80

Query  400  CLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            C SDCRYHCMLAREEER+ LG KPVKYHGKWPF RV
Sbjct  81   CRSDCRYHCMLAREEERRTLGGKPVKYHGKWPFLRV  116



>ref|XP_007152345.1| hypothetical protein PHAVU_004G122200g [Phaseolus vulgaris]
 gb|ESW24339.1| hypothetical protein PHAVU_004G122200g [Phaseolus vulgaris]
Length=342

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M+P R +LL A    +   L+A++GDADP+Y  CV+QC+K+GCVG +CFQHC FSS G P
Sbjct  1    MSPFRSLLLSAAVFFLLRPLDATEGDADPLYIGCVEQCKKTGCVGDRCFQHCKFSSDGKP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+ EPLYL+WKQWDC +DC Y+CMLAREEER KLG KPVKYHGKWPF+RV
Sbjct  61   IDGPWYMHEPLYLRWKQWDCCTDCSYYCMLAREEERTKLGDKPVKYHGKWPFRRV  115



>ref|XP_010061579.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Eucalyptus 
grandis]
 gb|KCW90760.1| hypothetical protein EUGRSUZ_A02835 [Eucalyptus grandis]
Length=343

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWD  399
            L+AS GD DP+YK CV++CE+SGCVG +CFQHC FSS G P+DGPWY+QEPLYL+WKQWD
Sbjct  21   LDASAGDVDPVYKSCVEKCEQSGCVGDQCFQHCKFSSDGKPVDGPWYMQEPLYLRWKQWD  80

Query  400  CLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            C SDCRYHCMLAREEER+ LG KPVKYHGKWPF RV
Sbjct  81   CRSDCRYHCMLAREEERRTLGGKPVKYHGKWPFLRV  116



>ref|XP_002310105.1| Per1-like family protein [Populus trichocarpa]
 gb|EEE90555.1| Per1-like family protein [Populus trichocarpa]
Length=342

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  V  F +FS +   L+AS GD+DPIY+ CV QCEKSGCVG +CF HCNFSS G  
Sbjct  1    MVDRYWVGFFLVFSCLGGTLDASAGDSDPIYRTCVGQCEKSGCVGQRCFSHCNFSSDGVS  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY QEPLYL+WKQWDC SDCRY+CML RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  61   IDGPWYKQEPLYLQWKQWDCQSDCRYYCMLDREKEREALGHGPVKYHGKWPFKRV  115



>gb|AFK39392.1| unknown [Medicago truncatula]
Length=342

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
             V+L  L S + +V +ASDGD D IYK CV+QCEKSGCVG +CFQH  FSS G PIDGPW
Sbjct  7    FVVLVVLCSFLLSV-DASDGDTDLIYKGCVEQCEKSGCVGDRCFQHYKFSSDGKPIDGPW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            Y+ EPLYL+WKQWDC +DCRYHCMLAREEER KLG  PVKYHGKWPF+R+
Sbjct  66   YMHEPLYLEWKQWDCRTDCRYHCMLAREEERTKLGETPVKYHGKWPFRRI  115



>gb|ACJ84406.1| unknown [Medicago truncatula]
Length=342

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
             V+L  L S + +V +ASDGD D IYK CV+QCEKSGCVG +CFQH  FSS G PIDGPW
Sbjct  7    FVVLVVLCSFLLSV-DASDGDTDLIYKGCVEQCEKSGCVGDRCFQHYKFSSDGKPIDGPW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            Y+ EPLYL+WKQWDC +DCRYHCMLAREEER KLG  PVKYHGKWPF+R+
Sbjct  66   YMHEPLYLEWKQWDCRTDCRYHCMLAREEERTKLGETPVKYHGKWPFRRI  115



>gb|KCW90758.1| hypothetical protein EUGRSUZ_A02835 [Eucalyptus grandis]
Length=382

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWD  399
            L+AS GD DP+YK CV++CE+SGCVG +CFQHC FSS G P+DGPWY+QEPLYL+WKQWD
Sbjct  21   LDASAGDVDPVYKSCVEKCEQSGCVGDQCFQHCKFSSDGKPVDGPWYMQEPLYLRWKQWD  80

Query  400  CLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            C SDCRYHCMLAREEER+ LG KPVKYHGKWPF RV
Sbjct  81   CRSDCRYHCMLAREEERRTLGGKPVKYHGKWPFLRV  116



>ref|XP_006422203.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|ESR35443.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|KDO46710.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
 gb|KDO46711.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=260

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R  V LF + S +  VL+AS GDADP+Y+ CV+QCE++GCVG KCF HC FSS G  
Sbjct  3    MATRNWVALFVVLSCLLGVLDASAGDADPLYRACVKQCEETGCVGQKCFPHCKFSSDGAS  62

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            I+GPWY+QEPLYL+WK+WDCLSDCRY+CM+ RE +R  LG  PVKYHGKWPF RV
Sbjct  63   INGPWYMQEPLYLQWKKWDCLSDCRYNCMVDREIKRDALGHGPVKYHGKWPFIRV  117



>ref|XP_004308119.1| PREDICTED: post-GPI attachment to proteins factor 3 [Fragaria 
vesca subsp. vesca]
Length=344

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  235  GDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDC  414
            GD+DP+Y+ CV+QC+KSGCVG KCFQHC FSS G PIDGPWY++EPLYL+WKQWDC +DC
Sbjct  27   GDSDPVYRSCVEQCQKSGCVGEKCFQHCKFSSDGKPIDGPWYIEEPLYLRWKQWDCQTDC  86

Query  415  RYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            RYHCMLAREEER+KLG KPVKYHGKWPF RV
Sbjct  87   RYHCMLAREEERKKLGDKPVKYHGKWPFNRV  117



>ref|XP_006422202.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|ESR35442.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
Length=235

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R  V LF + S +  VL+AS GDADP+Y+ CV+QCE++GCVG KCF HC FSS G  
Sbjct  3    MATRNWVALFVVLSCLLGVLDASAGDADPLYRACVKQCEETGCVGQKCFPHCKFSSDGAS  62

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            I+GPWY+QEPLYL+WK+WDCLSDCRY+CM+ RE +R  LG  PVKYHGKWPF RV
Sbjct  63   INGPWYMQEPLYLQWKKWDCLSDCRYNCMVDREIKRDALGHGPVKYHGKWPFIRV  117



>gb|KDO46709.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=288

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R  V LF + S +  VL+AS GDADP+Y+ CV+QCE++GCVG KCF HC FSS G  
Sbjct  3    MATRNWVALFVVLSCLLGVLDASAGDADPLYRACVKQCEETGCVGQKCFPHCKFSSDGAS  62

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            I+GPWY+QEPLYL+WK+WDCLSDCRY+CM+ RE +R  LG  PVKYHGKWPF RV
Sbjct  63   INGPWYMQEPLYLQWKKWDCLSDCRYNCMVDREIKRDALGHGPVKYHGKWPFIRV  117



>ref|XP_008439161.1| PREDICTED: post-GPI attachment to proteins factor 3 [Cucumis 
melo]
Length=344

 Score =   172 bits (437),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +1

Query  226  ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCL  405
            AS GD+DPIYK CV QCEKSGC G KCFQHC FSS G P+DGPWYLQEPLYL+WKQWDC 
Sbjct  24   ASPGDSDPIYKDCVVQCEKSGCAGDKCFQHCKFSSDGKPVDGPWYLQEPLYLRWKQWDCQ  83

Query  406  SDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DCRYHCML+REEER  LG KPVKYHGKWPF+RV
Sbjct  84   TDCRYHCMLSREEERTNLGDKPVKYHGKWPFRRV  117



>ref|XP_010693511.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Beta 
vulgaris subsp. vulgaris]
Length=342

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            L+LLFA F  I + L AS+GDAD IY+ CV+ C+++GCVG +CFQHC F++ GN  DG W
Sbjct  7    LILLFAFFG-IASALKASEGDADLIYRDCVEHCQETGCVGSQCFQHCIFTADGNISDGRW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            YLQEPLYLKWKQWDC SDCRY+CMLAREEER+KLG KPVKYHG+WPF+RV
Sbjct  66   YLQEPLYLKWKQWDCHSDCRYYCMLAREEERRKLGQKPVKYHGRWPFRRV  115



>ref|XP_006422204.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 ref|XP_006422205.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 ref|XP_006490486.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X4 [Citrus sinensis]
 ref|XP_006490492.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X4 [Citrus sinensis]
 gb|ESR35444.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|ESR35445.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|KDO46708.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=344

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R  V LF + S +  VL+AS GDADP+Y+ CV+QCE++GCVG KCF HC FSS G  
Sbjct  3    MATRNWVALFVVLSCLLGVLDASAGDADPLYRACVKQCEETGCVGQKCFPHCKFSSDGAS  62

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            I+GPWY+QEPLYL+WK+WDCLSDCRY+CM+ RE +R  LG  PVKYHGKWPF RV
Sbjct  63   INGPWYMQEPLYLQWKKWDCLSDCRYNCMVDREIKRDALGHGPVKYHGKWPFIRV  117



>ref|XP_006422206.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 ref|XP_006490485.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X3 [Citrus sinensis]
 ref|XP_006490491.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X3 [Citrus sinensis]
 gb|ESR35446.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
Length=345

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R  V LF + S +  VL+AS GDADP+Y+ CV+QCE++GCVG KCF HC FSS G  
Sbjct  3    MATRNWVALFVVLSCLLGVLDASAGDADPLYRACVKQCEETGCVGQKCFPHCKFSSDGAS  62

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            I+GPWY+QEPLYL+WK+WDCLSDCRY+CM+ RE +R  LG  PVKYHGKWPF RV
Sbjct  63   INGPWYMQEPLYLQWKKWDCLSDCRYNCMVDREIKRDALGHGPVKYHGKWPFIRV  117



>ref|XP_004140795.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cucumis 
sativus]
Length=346

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +1

Query  226  ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCL  405
            AS GD+DPIYK CV QCEKSGC G KCF HC FSS G P+DGPWYLQEPLYL+WKQWDC 
Sbjct  26   ASPGDSDPIYKDCVVQCEKSGCAGDKCFHHCKFSSDGKPVDGPWYLQEPLYLRWKQWDCQ  85

Query  406  SDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DCRYHCML+REEER  LG KPVKYHGKWPF+RV
Sbjct  86   TDCRYHCMLSREEERTSLGDKPVKYHGKWPFRRV  119



>gb|KGN57336.1| hypothetical protein Csa_3G180250 [Cucumis sativus]
Length=347

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +1

Query  226  ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCL  405
            AS GD+DPIYK CV QCEKSGC G KCF HC FSS G P+DGPWYLQEPLYL+WKQWDC 
Sbjct  27   ASPGDSDPIYKDCVVQCEKSGCAGDKCFHHCKFSSDGKPVDGPWYLQEPLYLRWKQWDCQ  86

Query  406  SDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DCRYHCML+REEER  LG KPVKYHGKWPF+RV
Sbjct  87   TDCRYHCMLSREEERTSLGDKPVKYHGKWPFRRV  120



>ref|XP_002280194.1| PREDICTED: post-GPI attachment to proteins factor 3 [Vitis vinifera]
 emb|CAN61923.1| hypothetical protein VITISV_036651 [Vitis vinifera]
 emb|CBI31849.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            + L FAL S +  VLNAS GD+DP+YK C++QCEK+GCVG KCFQHC  SS GNPI GPW
Sbjct  7    IALSFAL-SFLVRVLNASAGDSDPLYKACIEQCEKTGCVGDKCFQHCKLSSDGNPIGGPW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            YLQEPLYL+WKQWDC SDCRYHCMLAREEER++LG KPVKYHGKWPF+RV
Sbjct  66   YLQEPLYLRWKQWDCRSDCRYHCMLAREEEREELGDKPVKYHGKWPFRRV  115



>ref|XP_004171793.1| PREDICTED: post-GPI attachment to proteins factor 3-like, partial 
[Cucumis sativus]
Length=341

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +1

Query  226  ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCL  405
            AS GD+DPIYK CV QCEKSGC G KCF HC FSS G P+DGPWYLQEPLYL+WKQWDC 
Sbjct  21   ASPGDSDPIYKDCVVQCEKSGCAGDKCFHHCKFSSDGKPVDGPWYLQEPLYLRWKQWDCQ  80

Query  406  SDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DCRYHCML+REEER  LG KPVKYHGKWPF+RV
Sbjct  81   TDCRYHCMLSREEERTSLGDKPVKYHGKWPFRRV  114



>emb|CAN65586.1| hypothetical protein VITISV_034376 [Vitis vinifera]
Length=342

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  +  FA+F  +  V  AS GDADP+Y+ CV+QCEK+GCVG +CF HC F S G  
Sbjct  1    MVDRYWIAFFAVFVYLVRVFEASVGDADPLYRDCVEQCEKTGCVGERCFPHCKFPSDGAV  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DGPWYLQEPLYL+WKQWDC SDCRY+CML RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  61   VDGPWYLQEPLYLRWKQWDCQSDCRYYCMLDREKEREALGNGPVKYHGKWPFKRV  115



>ref|XP_002266274.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X3 
[Vitis vinifera]
Length=342

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  +  FA+F  +  V  AS GDADP+Y+ CV+QCEK+GCVG +CF HC F S G  
Sbjct  1    MVDRYWIAFFAVFVYLVRVFEASVGDADPLYRDCVEQCEKTGCVGERCFPHCKFPSDGAV  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DGPWYLQEPLYL+WKQWDC SDCRY+CML RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  61   VDGPWYLQEPLYLRWKQWDCQSDCRYYCMLDREKEREALGNGPVKYHGKWPFKRV  115



>ref|XP_010644976.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X2 
[Vitis vinifera]
Length=343

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  +  FA+F  +  V  AS GDADP+Y+ CV+QCEK+GCVG +CF HC F S G  
Sbjct  2    MVDRYWIAFFAVFVYLVRVFEASVGDADPLYRDCVEQCEKTGCVGERCFPHCKFPSDGAV  61

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DGPWYLQEPLYL+WKQWDC SDCRY+CML RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  62   VDGPWYLQEPLYLRWKQWDCQSDCRYYCMLDREKEREALGNGPVKYHGKWPFKRV  116



>ref|XP_002510848.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51450.1| conserved hypothetical protein [Ricinus communis]
Length=341

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWD  399
            L+AS GDADPIY+ C++ CEK+GC G KCFQHC FSS G PIDGPWY QEPLYL+WKQWD
Sbjct  20   LDASAGDADPIYQACMEHCEKTGCAGGKCFQHCKFSSDGKPIDGPWYRQEPLYLEWKQWD  79

Query  400  CLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            C +DCRY CML REEERQKLG KPVKYHGKWPF+R+
Sbjct  80   CHNDCRYQCMLDREEERQKLGDKPVKYHGKWPFRRL  115



>ref|XP_002266197.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X1 
[Vitis vinifera]
 emb|CBI21760.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  +  FA+F  +  V  AS GDADP+Y+ CV+QCEK+GCVG +CF HC F S G  
Sbjct  38   MVDRYWIAFFAVFVYLVRVFEASVGDADPLYRDCVEQCEKTGCVGERCFPHCKFPSDGAV  97

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DGPWYLQEPLYL+WKQWDC SDCRY+CML RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  98   VDGPWYLQEPLYLRWKQWDCQSDCRYYCMLDREKEREALGNGPVKYHGKWPFKRV  152



>ref|XP_011014824.1| PREDICTED: post-GPI attachment to proteins factor 3 [Populus 
euphratica]
Length=341

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +1

Query  172  RRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDG  351
            R  V    +FS +   L AS GD+DPIY+ CV QCEKSGCVG  CF HCNFSS G  IDG
Sbjct  3    RYWVGFLLVFSCLVGALEASAGDSDPIYRTCVGQCEKSGCVGQTCFSHCNFSSDGVSIDG  62

Query  352  PWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            PWY QEPLYL+WKQWDC SDCRY+CML RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  63   PWYKQEPLYLQWKQWDCQSDCRYYCMLDREKEREALGHGPVKYHGKWPFKRV  114



>ref|XP_007022228.1| Per1-like family protein isoform 7 [Theobroma cacao]
 gb|EOY13753.1| Per1-like family protein isoform 7 [Theobroma cacao]
Length=327

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  + LF + S +  VL+AS GD+DP Y+ CV QCEK+GCVG +CF HC F S G  
Sbjct  2    MIDRSSIALFLVLSFLVGVLDASAGDSDPRYRTCVAQCEKTGCVGERCFPHCKFPSDGVA  61

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             DGPWY+QEPLYLKWKQWDC SDCRY+CM+ RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  62   SDGPWYMQEPLYLKWKQWDCESDCRYNCMIDREKEREALGDGPVKYHGKWPFKRV  116



>ref|XP_007022223.1| Per1-like family protein isoform 2 [Theobroma cacao]
 ref|XP_007022224.1| Per1-like family protein isoform 2 [Theobroma cacao]
 ref|XP_007022225.1| Per1-like family protein isoform 2 [Theobroma cacao]
 ref|XP_007022227.1| Per1-like family protein isoform 2 [Theobroma cacao]
 ref|XP_007022229.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13748.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13749.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13750.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13752.1| Per1-like family protein isoform 2 [Theobroma cacao]
 gb|EOY13754.1| Per1-like family protein isoform 2 [Theobroma cacao]
Length=343

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  + LF + S +  VL+AS GD+DP Y+ CV QCEK+GCVG +CF HC F S G  
Sbjct  2    MIDRSSIALFLVLSFLVGVLDASAGDSDPRYRTCVAQCEKTGCVGERCFPHCKFPSDGVA  61

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             DGPWY+QEPLYLKWKQWDC SDCRY+CM+ RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  62   SDGPWYMQEPLYLKWKQWDCESDCRYNCMIDREKEREALGDGPVKYHGKWPFKRV  116



>ref|XP_007022222.1| Per1-like family protein isoform 1 [Theobroma cacao]
 gb|EOY13747.1| Per1-like family protein isoform 1 [Theobroma cacao]
Length=355

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  + LF + S +  VL+AS GD+DP Y+ CV QCEK+GCVG +CF HC F S G  
Sbjct  2    MIDRSSIALFLVLSFLVGVLDASAGDSDPRYRTCVAQCEKTGCVGERCFPHCKFPSDGVA  61

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             DGPWY+QEPLYLKWKQWDC SDCRY+CM+ RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  62   SDGPWYMQEPLYLKWKQWDCESDCRYNCMIDREKEREALGDGPVKYHGKWPFKRV  116



>ref|XP_007022226.1| Per1-like family protein isoform 5 [Theobroma cacao]
 gb|EOY13751.1| Per1-like family protein isoform 5 [Theobroma cacao]
Length=362

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  + LF + S +  VL+AS GD+DP Y+ CV QCEK+GCVG +CF HC F S G  
Sbjct  2    MIDRSSIALFLVLSFLVGVLDASAGDSDPRYRTCVAQCEKTGCVGERCFPHCKFPSDGVA  61

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             DGPWY+QEPLYLKWKQWDC SDCRY+CM+ RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  62   SDGPWYMQEPLYLKWKQWDCESDCRYNCMIDREKEREALGDGPVKYHGKWPFKRV  116



>ref|XP_011097638.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X2 
[Sesamum indicum]
Length=342

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  ++   +FSS+F V  AS GD+DP+Y+ C++QCEK+GC+  +CF HC FS  G+ 
Sbjct  1    MGNRYWIICGLVFSSLFRVYEASAGDSDPLYRACIEQCEKTGCIAERCFSHCKFSPDGSF  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            +DGPWY+QEPLYL+WKQWDC SDCRYHCM+ RE+ER +L L PVKYHGKWPF+ 
Sbjct  61   LDGPWYMQEPLYLRWKQWDCQSDCRYHCMVEREKERAELDLGPVKYHGKWPFRH  114



>ref|XP_011097637.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X1 
[Sesamum indicum]
Length=353

 Score =   164 bits (416),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  ++   +FSS+F V  AS GD+DP+Y+ C++QCEK+GC+  +CF HC FS  G+ 
Sbjct  12   MGNRYWIICGLVFSSLFRVYEASAGDSDPLYRACIEQCEKTGCIAERCFSHCKFSPDGSF  71

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            +DGPWY+QEPLYL+WKQWDC SDCRYHCM+ RE+ER +L L PVKYHGKWPF+ 
Sbjct  72   LDGPWYMQEPLYLRWKQWDCQSDCRYHCMVEREKERAELDLGPVKYHGKWPFRH  125



>gb|KEH26588.1| post-GPI attachment-like factor-protein [Medicago truncatula]
Length=349

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 88/117 (75%), Gaps = 8/117 (7%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIY-------KVCVQQCEKSGCVGVKCFQHCNFSSGG  336
             V+L  L S + +V +ASDGD D IY       +    +CEKSGCVG +CFQHC FSS G
Sbjct  7    FVVLVVLCSFLLSV-DASDGDTDLIYNTDSSDRRSVWSRCEKSGCVGDRCFQHCKFSSDG  65

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             PIDGPWY+ EPLYL+WKQWDC +DCRYHCMLAREEER KLG  PVKYHGKWPF+R+
Sbjct  66   KPIDGPWYMHEPLYLEWKQWDCRTDCRYHCMLAREEERTKLGETPVKYHGKWPFRRI  122



>emb|CDY00259.1| BnaA06g21600D [Brassica napus]
Length=345

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +1

Query  172  RRLVLLFALFS-SIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            RR++L+ A+ S  + + L AS+GDADP+YK CV QC+K+GCVG  CFQHC FS+ G  ID
Sbjct  6    RRVLLIVAVVSWCLVSTLEASEGDADPLYKSCVDQCQKTGCVGDNCFQHCKFSADGKAID  65

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            GPWY+QEPLYL+WKQWDC SDC+Y CM+ REEER++ G KP KY GKWP + V
Sbjct  66   GPWYMQEPLYLRWKQWDCQSDCQYECMMTREEERKRNGEKPTKYFGKWPLKHV  118



>ref|XP_009151332.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Brassica 
rapa]
Length=345

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +1

Query  172  RRLVLLFALFS-SIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            RR++L+ A+ S  + + L AS+GDADP+YK CV QC+K+GCVG  CFQHC FS+ G  ID
Sbjct  6    RRVLLIVAVVSWCLVSTLEASEGDADPLYKSCVDQCQKTGCVGDNCFQHCKFSADGKAID  65

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            GPWY+QEPLYL+WKQWDC SDC+Y CM+ REEER++ G KP KY GKWP + V
Sbjct  66   GPWYMQEPLYLRWKQWDCQSDCQYECMMTREEERKRNGEKPTKYFGKWPLKHV  118



>ref|XP_002866473.1| hypothetical protein ARALYDRAFT_919464 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42732.1| hypothetical protein ARALYDRAFT_919464 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   162 bits (409),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            VLL  + S + + L ASDGD+DP+YK CV QC+K+GCVG  CFQHC FS+ G  IDGPWY
Sbjct  8    VLLIVVVSCLVSTLEASDGDSDPLYKSCVDQCQKTGCVGDTCFQHCKFSADGKAIDGPWY  67

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +QEPLYL+WKQWDC SDC Y CM+ REEER++ G +P KY GKWP + V
Sbjct  68   MQEPLYLRWKQWDCQSDCEYECMMTREEERKRNGERPTKYFGKWPLKHV  116



>ref|XP_004294129.1| PREDICTED: post-GPI attachment to proteins factor 3 [Fragaria 
vesca subsp. vesca]
Length=348

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +1

Query  211  FAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWK  390
            F  ++AS GDADP Y+ C+QQCE++GCV  +CF HCNFSSGG  +DGPW+LQEPLYL+WK
Sbjct  19   FRAIDASAGDADPHYRACLQQCEETGCVAHRCFPHCNFSSGGVSVDGPWFLQEPLYLQWK  78

Query  391  QWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            QWDC SDCRY+CM+ RE+ER+  G  PVKYHGKWPF+RV
Sbjct  79   QWDCQSDCRYYCMVDREKEREAAGYGPVKYHGKWPFKRV  117



>ref|XP_010094756.1| hypothetical protein L484_019966 [Morus notabilis]
 gb|EXB56921.1| hypothetical protein L484_019966 [Morus notabilis]
Length=342

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  + L  + S    VL+AS GD D  Y+ CV++C+++GCVG +CF HC FSS G P
Sbjct  1    MLNRFWIALLFVVSWHVGVLDASAGDVDARYRACVKECQETGCVGERCFPHCKFSSKGVP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             DGPWY+QEPLYLKWKQWDC  DCRYHCM+ RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  61   FDGPWYMQEPLYLKWKQWDCQGDCRYHCMIDREKEREALGTGPVKYHGKWPFKRV  115



>gb|KJB82126.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
 gb|KJB82127.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
 gb|KJB82128.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
 gb|KJB82129.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
 gb|KJB82130.1| hypothetical protein B456_013G177900 [Gossypium raimondii]
Length=343

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  + LF +FS +  +L+AS GDADP Y+ CV +CEK+GC G  CF HC F S G  
Sbjct  2    MIDRYSIALFLVFSYLVGLLDASAGDADPRYRGCVAECEKTGCAGGTCFPHCKFPSDGVA  61

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             DGPWY+QEPLYLKWKQWDC SDCRY+CM+ RE+ER+ +G  PVKYHGKWPF RV
Sbjct  62   NDGPWYMQEPLYLKWKQWDCQSDCRYNCMIDREKEREAVGHGPVKYHGKWPFTRV  116



>ref|XP_010249648.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Nelumbo nucifera]
Length=347

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +1

Query  157  APMAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            A MA   LV      S    VLNAS GD DP Y+ CV QC+KSGC+G  CF  CN SSGG
Sbjct  3    AKMAYYHLVAFLVALSCFLGVLNASAGDVDPQYRTCVDQCKKSGCIGDACFASCNSSSGG  62

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              I G W ++EPLYL+WKQWDC SDCRYHCM+ RE+ER+ LG +PVKYHGKWPF+R+
Sbjct  63   ISITGQWSMKEPLYLRWKQWDCQSDCRYHCMVEREKEREVLGARPVKYHGKWPFRRI  119



>ref|XP_010523608.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X2 
[Tarenaya hassleriana]
Length=343

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  214  AVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQ  393
            + + AS+GDADP+YK CV+ C+K+GCVG KCF HC FS+ G PIDGPWY+QEPLYL+WKQ
Sbjct  19   SAVEASEGDADPLYKDCVEHCQKTGCVGDKCFLHCKFSADGKPIDGPWYMQEPLYLQWKQ  78

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WDC SDC+Y CM++REEER+K G KPVKYH +WP +RV
Sbjct  79   WDCQSDCQYECMMSREEERKKHGEKPVKYHNRWPLKRV  116



>gb|ACB45085.1| PERLD1 [Solanum commersonii]
Length=307

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +1

Query  271  QCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEER  450
            QCEK+GCVG +C QHCNF+SGG P+DGPWYLQEPLYL+WKQWDCLSDCRYHCMLARE+ER
Sbjct  2    QCEKTGCVGDECSQHCNFTSGGIPVDGPWYLQEPLYLRWKQWDCLSDCRYHCMLAREKER  61

Query  451  QKLGLKPVKYHGKWPFQRV  507
            +K+GLKPVKYHGKWPFQRV
Sbjct  62   KKVGLKPVKYHGKWPFQRV  80



>ref|XP_010249649.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Nelumbo nucifera]
Length=343

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA   LV      S    VLNAS GD DP Y+ CV QC+KSGC+G  CF  CN SSGG  
Sbjct  1    MAYYHLVAFLVALSCFLGVLNASAGDVDPQYRTCVDQCKKSGCIGDACFASCNSSSGGIS  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            I G W ++EPLYL+WKQWDC SDCRYHCM+ RE+ER+ LG +PVKYHGKWPF+R+
Sbjct  61   ITGQWSMKEPLYLRWKQWDCQSDCRYHCMVEREKEREVLGARPVKYHGKWPFRRI  115



>ref|XP_007213744.1| hypothetical protein PRUPE_ppa008593m2g, partial [Prunus persica]
 gb|EMJ14943.1| hypothetical protein PRUPE_ppa008593m2g, partial [Prunus persica]
Length=186

 Score =   155 bits (392),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSI--FAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            M     V  F + S +  F VL+AS GDADP+Y+ C++QC ++GCV  +CF  CNFSS G
Sbjct  1    MLKHYWVAFFVVVSWVVNFRVLDASAGDADPLYRACIKQCGETGCVAQRCFPQCNFSSDG  60

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              +DGPWY+QEPLY++WKQWDC SDCRY+CML RE +R+  G  PVKYHGKWPF+RV
Sbjct  61   VSVDGPWYMQEPLYMQWKQWDCQSDCRYYCMLDRENKREATGHDPVKYHGKWPFKRV  117



>ref|XP_010523600.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X1 
[Tarenaya hassleriana]
Length=418

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  214  AVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQ  393
            + + AS+GDADP+YK CV+ C+K+GCVG KCF HC FS+ G PIDGPWY+QEPLYL+WKQ
Sbjct  94   SAVEASEGDADPLYKDCVEHCQKTGCVGDKCFLHCKFSADGKPIDGPWYMQEPLYLQWKQ  153

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WDC SDC+Y CM++REEER+K G KPVKYH +WP +RV
Sbjct  154  WDCQSDCQYECMMSREEERKKHGEKPVKYHNRWPLKRV  191



>ref|NP_568951.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AAK95279.1|AF410293_1 AT5g62130/mtg10_150 [Arabidopsis thaliana]
 gb|AAM10355.1| AT5g62130/mtg10_150 [Arabidopsis thaliana]
 gb|AED97567.1| Per1-like family protein [Arabidopsis thaliana]
Length=343

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            VLL  + S + + L AS+GD+D +YK CV QC+K+GCVG  CFQHC FS+ G  IDGPWY
Sbjct  8    VLLIIVVSCLVSTLEASEGDSDSLYKSCVDQCQKTGCVGDTCFQHCKFSADGKAIDGPWY  67

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +QEPLYL+WKQWDC SDC+Y CM+ REEER++ G +P KY GKWP + V
Sbjct  68   MQEPLYLRWKQWDCQSDCQYECMMTREEERKRNGERPTKYFGKWPLKHV  116



>ref|XP_008226095.1| PREDICTED: post-GPI attachment to proteins factor 3 [Prunus mume]
Length=353

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSI--FAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            M     V  F + S +  F VL+AS GDADP+Y+ CV+QC ++GCV  +CF  CNFSS G
Sbjct  1    MLKHYWVAFFVVVSWVVNFRVLDASAGDADPLYRACVKQCGETGCVAQRCFPQCNFSSDG  60

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              +D PWY+QEPLY++WKQWDC SDCRY+CML RE ER+  G  PVKYHGKWPF+RV
Sbjct  61   VSVDSPWYMQEPLYMQWKQWDCQSDCRYYCMLDRENEREATGHDPVKYHGKWPFKRV  117



>ref|XP_004512796.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cicer 
arietinum]
Length=342

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +1

Query  181  VLLFALFSSIFA-VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            V +F L    F  +++AS GDADP+Y+ C++QC+++GCVG KCF HC FSS G  +  PW
Sbjct  6    VFVFLLLLCCFVNIIDASAGDADPLYRGCIRQCQETGCVGQKCFPHCTFSSDGEIVGRPW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            Y+QEPLYL+WK+WDC SDCRYHCML RE+E++ L L PVKYHGKWPF+R+
Sbjct  66   YMQEPLYLQWKKWDCQSDCRYHCMLDREKEKELLNLDPVKYHGKWPFKRI  115



>ref|XP_010676806.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Beta 
vulgaris subsp. vulgaris]
Length=361

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +1

Query  136  SASCTVLAPMAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQH  315
            S+  ++L  M  R L++LF +FS    V   S GDADP+Y+ CV  C  +GC+G KCF H
Sbjct  12   SSRNSILQKMLNRWLIVLFMVFSCFAGVSYGSAGDADPLYRSCVNNCISNGCIGEKCFPH  71

Query  316  CNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWP  495
            CN +  G+ +  PWY++E LYLKWKQ DCL DCRY+CM+ RE++RQ LG  PVKYHGKWP
Sbjct  72   CNITLNGDSLHSPWYMREALYLKWKQSDCLGDCRYYCMIDREQKRQSLGHGPVKYHGKWP  131

Query  496  FQRV  507
            F+RV
Sbjct  132  FKRV  135



>gb|KFK27944.1| hypothetical protein AALP_AA8G451600 [Arabis alpina]
Length=343

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWD  399
            L AS+GD+DP YK CV+QC+K+GCVG  CFQHC FS+ G  IDGPWY+QEPLYL+WKQWD
Sbjct  21   LEASEGDSDPRYKSCVEQCQKTGCVGDTCFQHCKFSADGKAIDGPWYMQEPLYLRWKQWD  80

Query  400  CLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            C SDC+Y CM+ REEER++ G KP KY GKWP + V
Sbjct  81   CQSDCQYECMMTREEERKRNGEKPTKYFGKWPLKHV  116



>gb|EYU27545.1| hypothetical protein MIMGU_mgv1a009440mg [Erythranthe guttata]
 gb|EYU27546.1| hypothetical protein MIMGU_mgv1a009440mg [Erythranthe guttata]
Length=342

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA    ++   + S +  V   S GD DP Y+ CV+QCEK+GCVG +CF HC FSS G+ 
Sbjct  1    MANCYWIICILVVSCLVGVYEGSAGDVDPSYRACVKQCEKTGCVGERCFPHCKFSSDGSS  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DGPWY+QEPLYL WK WDC S+C +HCML RE+ER +LG  PVKYHGKWPF+R+
Sbjct  61   VDGPWYMQEPLYLWWKHWDCKSECHHHCMLDREKERAELGQGPVKYHGKWPFRRL  115



>ref|XP_009382286.1| PREDICTED: post-GPI attachment to proteins factor 3 [Musa acuminata 
subsp. malaccensis]
Length=342

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            +L+  LF  IF   +AS+GDADP+Y+VC++QCEK G VG    QHC F S G   D PWY
Sbjct  6    LLVIFLFGCIFGATDASEGDADPLYRVCIEQCEKMGSVGDISIQHCQFLSDGVLADSPWY  65

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            +QEPLY++WKQW+C SDC+Y CM+ RE+ER+ LGL+PVKY+GKWPF+R
Sbjct  66   MQEPLYVQWKQWNCRSDCQYFCMMQREKEREALGLRPVKYYGKWPFKR  113



>gb|AES76445.2| post-GPI attachment-like factor-protein [Medicago truncatula]
Length=255

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  217  VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQW  396
            V++AS GDA P+Y+ C++QCE++GCVG KCF  C+FSS G  +  PWY+QEPLYL+WK+W
Sbjct  19   VVDASKGDAHPLYRSCIRQCEETGCVGPKCFPQCSFSSDGELVGRPWYIQEPLYLQWKKW  78

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            DCLSDCRY+CML RE+E++ L   PVKYHGKWPF+R+
Sbjct  79   DCLSDCRYYCMLDREKEKELLNHDPVKYHGKWPFKRI  115



>ref|XP_006394430.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
 gb|ESQ31716.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
Length=259

 Score =   149 bits (376),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            R VLL    S + + L AS+GDADP+YK CV QC+K+GCVG  CFQHC FS+ G  IDGP
Sbjct  6    RWVLLIVAVSYLVSSLEASEGDADPLYKSCVDQCQKTGCVGDNCFQHCKFSADGKAIDGP  65

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY+QEPLYL+WKQWDC SDC+Y CM+ REEER++ G KP KY GKWP + V
Sbjct  66   WYMQEPLYLRWKQWDCQSDCQYECMMTREEERRRNGEKPTKYFGKWPLKHV  116



>ref|XP_008805643.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Phoenix 
dactylifera]
Length=343

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  RR + L      +   L+AS GD DP+Y+ CV+QCEK+G +G    QHC F S   P
Sbjct  1    MEARRWLALLLALGCLSEALDASPGDVDPLYRTCVEQCEKTGIIGESSIQHCEFPSNDIP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            ++ PWY+QEPLYL+WKQ +C SDCRY+CM+ RE+ER++LGLKPVKYHGKWPF+RV
Sbjct  61   VNSPWYMQEPLYLQWKQLNCKSDCRYNCMMQREKEREELGLKPVKYHGKWPFKRV  115



>ref|XP_004171395.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cucumis 
sativus]
Length=267

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  187  LFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQ  366
            L  +F+     LNAS GD DP Y+ CV+ CE+ GC+  +CF  C FSS G  +  PWY+Q
Sbjct  9    LLVVFAWFVKGLNASAGDIDPHYRTCVKHCEEIGCIDQQCFPQCKFSSDGVSVGQPWYMQ  68

Query  367  EPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            EPLYL+WKQWDC SDCRYHCM+ RE ER+ LG  PVKYHGKWPF+R+
Sbjct  69   EPLYLRWKQWDCQSDCRYHCMVKREGEREALGYDPVKYHGKWPFKRI  115



>gb|AFK38324.1| unknown [Medicago truncatula]
Length=228

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  217  VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQW  396
            V++AS GDA P+Y+ C++QCE++GCVG KCF  C+FSS G  +  PWY++EPLYL+WK+W
Sbjct  19   VVDASKGDAHPLYRSCIRQCEETGCVGPKCFPQCSFSSDGELVGRPWYIREPLYLQWKKW  78

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            DCLSDCRY+CML RE+E++ L   PVKYHGKWPF+R+
Sbjct  79   DCLSDCRYYCMLDREKEKELLNHDPVKYHGKWPFKRI  115



>ref|XP_008456335.1| PREDICTED: post-GPI attachment to proteins factor 3 [Cucumis 
melo]
Length=342

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  187  LFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQ  366
               +F+     LNAS GD DP Y+ CV+ CE+ GC+  +CF  C FSS G  +D PWY+Q
Sbjct  9    FLVVFAWFLKGLNASAGDIDPQYRTCVKHCEEIGCIDQQCFPQCKFSSDGVSVDQPWYMQ  68

Query  367  EPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            EPLYL+WKQWDC SDCRYHCM+ RE ER+ LG  PVKYHGKWPF+R+
Sbjct  69   EPLYLRWKQWDCQSDCRYHCMVKREGEREALGYDPVKYHGKWPFKRL  115



>ref|XP_003620227.1| Post-GPI attachment to proteins factor [Medicago truncatula]
Length=342

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +1

Query  217  VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQW  396
            V++AS GDA P+Y+ C++QCE++GCVG KCF  C+FSS G  +  PWY+QEPLYL+WK+W
Sbjct  19   VVDASKGDAHPLYRSCIRQCEETGCVGPKCFPQCSFSSDGELVGRPWYIQEPLYLQWKKW  78

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            DCLSDCRY+CML RE+E++ L   PVKYHGKWPF+R+
Sbjct  79   DCLSDCRYYCMLDREKEKELLNHDPVKYHGKWPFKRI  115



>ref|XP_006280748.1| hypothetical protein CARUB_v10026718mg [Capsella rubella]
 gb|EOA13646.1| hypothetical protein CARUB_v10026718mg [Capsella rubella]
Length=343

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            R VLL   FS + + L AS+GD+DP+YK CV+QC+K+GCVG  CFQHC FS+ G  IDGP
Sbjct  6    RWVLLIVAFSCLISALEASEGDSDPLYKSCVEQCQKTGCVGDTCFQHCKFSADGKAIDGP  65

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY+QEPLYL+WKQWDC SDC+Y CM+ REEER++ G  P KY GKWP + V
Sbjct  66   WYMQEPLYLRWKQWDCQSDCQYECMMTREEERRRNGEIPTKYFGKWPLKHV  116



>ref|XP_009366488.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009366489.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009366490.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009350544.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009350545.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
 ref|XP_009350546.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pyrus 
x bretschneideri]
Length=353

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  211  FAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWK  390
            F VL+AS GDADP Y+ C+++C ++GCVG +CF +CNFSS G  +D PWY++EPLY +WK
Sbjct  19   FTVLDASAGDADPRYRACLKECGETGCVGQRCFPNCNFSSDGVSVDRPWYMREPLYQQWK  78

Query  391  QWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            QWDC SDCRY+CM+ RE+ER+  G  PVKYHGKWPF+RV
Sbjct  79   QWDCQSDCRYYCMVDREKEREAAGNGPVKYHGKWPFKRV  117



>ref|XP_010459200.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
 ref|XP_010459201.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=342

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 81/115 (70%), Gaps = 4/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R    LF +   +F++ NAS GDADP Y+ CV +CE SGCVG +CF  CN SS G  
Sbjct  1    MAVRYWTALFLVLPCLFSISNASAGDADPSYRSCVSECEVSGCVGQECFPQCNSSSSG--  58

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
               PWY+QEPLYL+WKQW C  DCRY CM+ RE ER+ LG  PVKYHGKWPF+RV
Sbjct  59   --APWYIQEPLYLQWKQWGCQGDCRYQCMVNREGERETLGQAPVKYHGKWPFKRV  111



>emb|CDP13593.1| unnamed protein product [Coffea canephora]
Length=342

 Score =   149 bits (375),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M   R +    +   +  VL+AS GDADP+Y+ CV++CE +GCV  +CF +C F   G+ 
Sbjct  1    MVDCRWITFIIVLPCLVGVLDASAGDADPLYRDCVRECETTGCVRERCFTNCKFLLNGSS  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            IDGPWY+QEPL+L W+QWDC SDCRYHCM+ RE+ER  +   PVKYHGKWPF+R+
Sbjct  61   IDGPWYMQEPLFLHWRQWDCQSDCRYHCMVEREKERAAVNQGPVKYHGKWPFRRL  115



>ref|XP_006394432.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
 gb|ESQ31718.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
Length=343

 Score =   149 bits (375),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            R VLL    S + + L AS+GDADP+YK CV QC+K+GCVG  CFQHC FS+ G  IDGP
Sbjct  6    RWVLLIVAVSYLVSSLEASEGDADPLYKSCVDQCQKTGCVGDNCFQHCKFSADGKAIDGP  65

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY+QEPLYL+WKQWDC SDC+Y CM+ REEER++ G KP KY GKWP + V
Sbjct  66   WYMQEPLYLRWKQWDCQSDCQYECMMTREEERRRNGEKPTKYFGKWPLKHV  116



>ref|XP_004143181.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Cucumis 
sativus]
 gb|KGN46820.1| hypothetical protein Csa_6G139200 [Cucumis sativus]
Length=342

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +1

Query  187  LFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQ  366
            L  +F+     LNAS GD DP Y+ CV+ CE+ GC+  +CF  C FSS G  +  PWY+Q
Sbjct  9    LLVVFAWFVKGLNASAGDIDPHYRTCVKHCEEIGCIDQQCFPQCKFSSDGVSVGQPWYMQ  68

Query  367  EPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            EPLYL+WKQWDC SDCRYHCM+ RE ER+ LG  PVKYHGKWPF+R+
Sbjct  69   EPLYLRWKQWDCQSDCRYHCMVKREGEREALGYDPVKYHGKWPFKRI  115



>ref|XP_002890173.1| hypothetical protein ARALYDRAFT_471855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66432.1| hypothetical protein ARALYDRAFT_471855 [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score =   148 bits (374),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA      LF L S +F + N+S GDADP Y+ CV +CE SGCVG  CF  CN SS G  
Sbjct  1    MAVHYWTALFLLLSCLFTISNSSAGDADPDYRTCVSECEISGCVGQLCFPQCNSSSDG--  58

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              GPWY+QEPLYL+WK+W C  DCRY CM+ RE ER+ LG  PVKYHGKWPF+RV
Sbjct  59   --GPWYIQEPLYLQWKKWGCQGDCRYQCMVNRERERETLGQAPVKYHGKWPFKRV  111



>ref|XP_010925813.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Elaeis 
guineensis]
Length=343

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            L LL A F  +F  L+AS GD DP+Y+ CV+QCE++G  G    QHC F     P+D PW
Sbjct  7    LALLLA-FGCLFEALDASPGDLDPLYRTCVKQCEETGISGDSSIQHCQFPYSDIPVDSPW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            Y+QEPLYL+WKQ +C SDCRY+CM+ RE+ER KLGL PVKYHGKWPF+RV
Sbjct  66   YMQEPLYLQWKQLNCKSDCRYNCMMQREKERGKLGLDPVKYHGKWPFKRV  115



>ref|XP_010915760.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Elaeis 
guineensis]
Length=343

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  RR + L      +F  L+AS GD DP+Y+ CV+QCEK+G +G    Q C F S   P
Sbjct  1    MEARRWLALLLALGCLFEALDASPGDFDPLYRTCVEQCEKTGIIGDISIQDCQFPSNEIP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            ++ PWY+QEPLYL+WKQ +C SDCRY+CM+ RE+ER+KLGL PVKYHGKWPF+RV
Sbjct  61   VNSPWYMQEPLYLQWKQLNCKSDCRYNCMMQREKEREKLGLSPVKYHGKWPFKRV  115



>gb|EPS57354.1| hypothetical protein M569_17464 [Genlisea aurea]
Length=345

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            V+LF  FS    V++ S GDADP+Y+ CV++CEK+GCVG KC   C  S  GN +D  W+
Sbjct  12   VVLFCFFSP--GVIDGSPGDADPVYRGCVEECEKTGCVGEKCLHPCKASLDGNTVDVSWH  69

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            L+EPLY++WKQWDCLS CRY CML REE R+KLG +P KYHGKWPF+R+
Sbjct  70   LKEPLYIRWKQWDCLSHCRYQCMLTREESRKKLGQEPDKYHGKWPFKRI  118



>ref|XP_009383493.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009383494.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M   R V L   F  +F VL+AS GDADP+Y+ CV QCEK+G +G    QHC FS    P
Sbjct  1    MGVGRWVSLLLAFGCLFGVLDASAGDADPLYRNCVVQCEKTGNIGDHAIQHCKFSFTDVP  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            ++G WY+Q+PLYL+WKQ +C SDCRY+CM+  E +R+KLGL P KYHGKWPF+RV
Sbjct  61   LNGSWYMQKPLYLQWKQLNCRSDCRYYCMMQSEYQREKLGLGPAKYHGKWPFKRV  115



>ref|XP_010476769.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
 ref|XP_010476770.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=342

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 79/115 (69%), Gaps = 4/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R    LF +   +F   NAS GDADP Y+ CV +CE SGCVG +CF  CN SS G  
Sbjct  1    MAVRYWTALFLVLPCLFTFSNASAGDADPSYRSCVSECEISGCVGQECFPQCNSSSSG--  58

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
               PWY+QEPLYL+WKQW C  DCRY CM+ RE ER+ LG  PVKYHGKWPF+RV
Sbjct  59   --APWYIQEPLYLQWKQWGCQGDCRYQCMVNREGERETLGQAPVKYHGKWPFKRV  111



>ref|XP_011083636.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Sesamum indicum]
 ref|XP_011083637.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Sesamum indicum]
Length=358

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDC  402
            +AS GD+DP Y+ CV+QC K+GCVG +CF  C  SS G+ +DGP Y QEPLYL+WKQWDC
Sbjct  21   HASAGDSDPSYRACVEQCVKNGCVGERCFSQCKPSSDGSSLDGPLYTQEPLYLRWKQWDC  80

Query  403  LSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             SDC YHCM  RE+ER +LGL+P+KYHGKWPFQR+
Sbjct  81   QSDCHYHCMFDREKERAELGLEPLKYHGKWPFQRI  115



>ref|XP_011083635.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Sesamum indicum]
Length=365

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDC  402
            +AS GD+DP Y+ CV+QC K+GCVG +CF  C  SS G+ +DGP Y QEPLYL+WKQWDC
Sbjct  28   HASAGDSDPSYRACVEQCVKNGCVGERCFSQCKPSSDGSSLDGPLYTQEPLYLRWKQWDC  87

Query  403  LSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             SDC YHCM  RE+ER +LGL+P+KYHGKWPFQR+
Sbjct  88   QSDCHYHCMFDREKERAELGLEPLKYHGKWPFQRI  122



>ref|XP_003521884.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Glycine max]
Length=343

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = +1

Query  184  LLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYL  363
             L  L+ S+  V++AS GDADP Y+VC+ QC+++GCV  +CF +C FSS G  ID PWY+
Sbjct  9    FLLVLYCSV-EVIDASAGDADPRYRVCITQCQETGCVAQRCFPNCKFSSDGEFIDRPWYM  67

Query  364  Q-EPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            Q EPLYL+WK+WDC SDCRY+CML RE+ER+   L PVKYHGKWPF+R+
Sbjct  68   QQEPLYLQWKKWDCQSDCRYYCMLDREKERESHNLGPVKYHGKWPFRRI  116



>ref|XP_006576320.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Glycine max]
Length=346

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = +1

Query  184  LLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYL  363
             L  L+ S+  V++AS GDADP Y+VC+ QC+++GCV  +CF +C FSS G  ID PWY+
Sbjct  12   FLLVLYCSV-EVIDASAGDADPRYRVCITQCQETGCVAQRCFPNCKFSSDGEFIDRPWYM  70

Query  364  Q-EPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            Q EPLYL+WK+WDC SDCRY+CML RE+ER+   L PVKYHGKWPF+R+
Sbjct  71   QQEPLYLQWKKWDCQSDCRYYCMLDREKERESHNLGPVKYHGKWPFRRI  119



>ref|XP_009411453.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  208  IFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKW  387
            IF  ++AS+GDADP+Y+ C++QCEK G VG    QHC F S G  +D PWY+QEPLY++W
Sbjct  15   IFGAIDASEGDADPLYRECIEQCEKKGSVGASSIQHCQFLSDGVLVDSPWYMQEPLYVQW  74

Query  388  KQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            KQ +C SDC+Y CM+ +E+ER+ LGLKPVKYHGKWPF+R
Sbjct  75   KQCNCRSDCQYFCMMQQEKEREALGLKPVKYHGKWPFKR  113



>ref|XP_009411454.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=342

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  208  IFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKW  387
            IF  ++AS+GDADP+Y+ C++QCEK G VG    QHC F S G  +D PWY+QEPLY++W
Sbjct  15   IFGAIDASEGDADPLYRECIEQCEKKGSVGASSIQHCQFLSDGVLVDSPWYMQEPLYVQW  74

Query  388  KQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            KQ +C SDC+Y CM+ +E+ER+ LGLKPVKYHGKWPF+R
Sbjct  75   KQCNCRSDCQYFCMMQQEKEREALGLKPVKYHGKWPFKR  113



>ref|XP_006305176.1| hypothetical protein CARUB_v10009543mg, partial [Capsella rubella]
 gb|EOA38074.1| hypothetical protein CARUB_v10009543mg, partial [Capsella rubella]
Length=358

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 81/117 (69%), Gaps = 4/117 (3%)
 Frame = +1

Query  157  APMAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            A MA R    LF +F  +F++ NAS GDAD  Y+ CV  CE SGCVG +CF  CN SS G
Sbjct  15   AQMAVRFWTALFLVFPCLFSISNASAGDADLTYRTCVSGCEISGCVGQECFPQCNSSSNG  74

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
                GPWY+QEPLYL+WK+  C  DCRY CM+ RE ER+ LG  PVKYHGKWPF+RV
Sbjct  75   ----GPWYIQEPLYLQWKKLGCQGDCRYQCMVNRERERETLGQAPVKYHGKWPFKRV  127



>ref|XP_006416803.1| hypothetical protein EUTSA_v10008113mg [Eutrema salsugineum]
 gb|ESQ35156.1| hypothetical protein EUTSA_v10008113mg [Eutrema salsugineum]
Length=342

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = +1

Query  187  LFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQ  366
            LF +   +F++ +AS GDADP Y+ CV +CE SGCVG  CF  CN SS G    GPWY+Q
Sbjct  9    LFLVLPCLFSISDASAGDADPNYRTCVSECEISGCVGQVCFPQCNSSSNG----GPWYIQ  64

Query  367  EPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            EPLYL+W++W C  DCRYHCM+ RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  65   EPLYLQWQKWGCQGDCRYHCMVNREKERESLGQVPVKYHGKWPFKRV  111



>ref|XP_008795943.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Phoenix 
dactylifera]
Length=343

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +1

Query  211  FAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWK  390
            F  L+AS GD DP+Y+ CV+QCEK+G +     QHC F     P+D PWY+QEPLYL+WK
Sbjct  17   FEALDASPGDFDPLYRTCVEQCEKTGIIEDSSIQHCQFPYNDIPVDSPWYMQEPLYLQWK  76

Query  391  QWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            Q +C SDC+Y+CM+ RE ER KLGL PVKYHGKWPF+RV
Sbjct  77   QLNCESDCQYNCMMQRENERGKLGLNPVKYHGKWPFRRV  115



>gb|KJB26985.1| hypothetical protein B456_004G270100 [Gossypium raimondii]
Length=342

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            M  R  + +F + S +  VLNAS+GD+D  Y+ C+ +CE++GCVG +CF+HCNF S G  
Sbjct  1    MMDRYSIAVFMMISFLVGVLNASEGDSDLHYRSCLAECEETGCVGDQCFRHCNFPSDGVL  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +DGPWY++EPLYLKWKQW+C SDCRY CM  RE+ER++ G +P+KYHGKWPF+RV
Sbjct  61   VDGPWYMKEPLYLKWKQWECESDCRYACMTDREKEREERGEEPIKYHGKWPFKRV  115



>ref|XP_009130193.1| PREDICTED: post-GPI attachment to proteins factor 3 [Brassica 
rapa]
 emb|CDY30696.1| BnaA02g33180D [Brassica napus]
Length=345

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +1

Query  217  VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNF-SSGGNPIDGPWYLQEPLYLKWKQ  393
             L AS+GDADP+YK CV QC+K+GCVG  CF  C F S+ G   DGPWY+QEPLYL+WKQ
Sbjct  21   TLEASEGDADPLYKSCVDQCQKTGCVGDTCFHQCKFFSADGKANDGPWYMQEPLYLRWKQ  80

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WDC SDC+Y CM+ REEER++ G KP KY GKWP + V
Sbjct  81   WDCQSDCQYECMMTREEERKRDGEKPTKYFGKWPLKHV  118



>ref|XP_010483931.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=344

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +1

Query  172  RRLVLLFALFS-SIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            +R VLL  + S S+ + L ASDGD+DP+YK CV+QC+K+GCVG  CFQ+C FS+ G  ID
Sbjct  5    QRWVLLIVVVSLSLVSALEASDGDSDPLYKSCVEQCQKTGCVGDTCFQNCKFSADGKVID  64

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            GPWY+QEPLYL+WKQWDC SDC+Y CM+ REEER++ G +P KY GKWP + V
Sbjct  65   GPWYMQEPLYLRWKQWDCQSDCQYECMMTREEERRRNGERPTKYFGKWPLKHV  117



>ref|XP_010537783.1| PREDICTED: post-GPI attachment to proteins factor 3 [Tarenaya 
hassleriana]
Length=344

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 81/115 (70%), Gaps = 4/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R  + L  + S   +  + S GDADP Y+ CV +CE+SGCV  +CF HCN SS G  
Sbjct  1    MAFRCWIALCLVLSCFISTSDGSAGDADPHYRACVAECEESGCVRQQCFPHCNLSSNG--  58

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              G WY+QEPLYL+WK+W C  DCRYHCM+ REEER+ LG  PVKYHGKWPF+RV
Sbjct  59   --GAWYMQEPLYLQWKKWGCQGDCRYHCMIHREEEREILGQVPVKYHGKWPFKRV  111



>ref|XP_003528854.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Glycine 
max]
 gb|KHN26964.1| Post-GPI attachment to proteins factor 3 [Glycine soja]
Length=343

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +1

Query  217  VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQ-EPLYLKWKQ  393
            V++AS GDADP Y+ C+ QC+++GC+G +CF +C FSS G  ID PWY+Q EPLYL+WK+
Sbjct  19   VIDASAGDADPRYRGCITQCQETGCIGQRCFPNCKFSSDGEFIDRPWYMQQEPLYLQWKK  78

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WDC  DCRY+CML RE+ER+   L PVKYHGKWPF+R+
Sbjct  79   WDCQGDCRYYCMLDREKERESHNLGPVKYHGKWPFRRI  116



>ref|XP_010458286.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=344

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +1

Query  172  RRLVLLFALFSS-IFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            +R VLL  + S  + + L ASDGD+DP+YK CV+QC+K+GCVG  CFQ+C FS+ G  ID
Sbjct  5    QRWVLLIVVVSLCLVSALEASDGDSDPLYKSCVEQCQKTGCVGDTCFQNCKFSADGKVID  64

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            GPWY+QEPLYL+WKQWDC SDC+Y CM+ REEER++ G +P KY GKWP + V
Sbjct  65   GPWYMQEPLYLRWKQWDCQSDCQYECMMTREEERRRNGERPTKYFGKWPLKHV  117



>ref|XP_009404456.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            + L   F  +F  LNAS GDAD +Y+ CV QCEK+G +G +  +HC F +   P+D  WY
Sbjct  7    ISLLIAFGCLFGALNASAGDADSLYRNCVGQCEKTGDIGDQSIRHCQFQNSDVPLDSSWY  66

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +QEPLYL+WKQ +C SDCRY+CM+ RE +++KLG  PVKYHGKWPF+RV
Sbjct  67   MQEPLYLQWKQLNCRSDCRYYCMMQRENQQEKLGQHPVKYHGKWPFKRV  115



>emb|CDY68708.1| BnaA06g38370D [Brassica napus]
Length=343

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R    L  + S +F+V  AS GDADP Y+ CV +CE++GC+G  CF  CN SS    
Sbjct  1    MAVRYCAALLLVLSCLFSVSYASLGDADPTYRTCVAECERNGCIGQVCFPQCNSSSSSG-  59

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              GPWY QEPLYL+W++  C  DCRYHCM+ RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  60   --GPWYTQEPLYLQWQKLGCQGDCRYHCMVNREKERESLGHVPVKYHGKWPFKRV  112



>ref|XP_002872857.1| hypothetical protein ARALYDRAFT_490363 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49116.1| hypothetical protein ARALYDRAFT_490363 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +1

Query  217  VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQW  396
            + NAS GDADP Y+ C+ +CE SGCVG  CF  CN SS G    GPWY+QEPLYL+WK+W
Sbjct  19   ISNASAGDADPDYRTCISECEISGCVGQLCFPQCNSSSDG----GPWYIQEPLYLQWKKW  74

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             C  DCRY CM+ RE ER+ LG  PVKYHGKWPF+RV
Sbjct  75   GCQGDCRYQCMVNRERERETLGQAPVKYHGKWPFKRV  111



>ref|NP_173104.1| Per1-like family protein [Arabidopsis thaliana]
 ref|NP_973842.1| Per1-like family protein [Arabidopsis thaliana]
 ref|NP_973843.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AAG10825.1|AC011808_13 Unknown protein [Arabidopsis thaliana]
 dbj|BAH20175.1| AT1G16560 [Arabidopsis thaliana]
 gb|AEE29468.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AEE29469.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AEE29470.1| Per1-like family protein [Arabidopsis thaliana]
Length=342

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +1

Query  217  VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQW  396
            + NAS GDADP Y+ CV +CE SGCVG  CF  CN SS G    GPWY+QEPLYL+WK+W
Sbjct  19   ISNASAGDADPDYRTCVSECEISGCVGQLCFPQCNSSSDG----GPWYIQEPLYLQWKKW  74

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             C  DCRY CM+ RE ER+ LG  PVKYHGKWPF+RV
Sbjct  75   GCQGDCRYQCMVNRETERETLGQAPVKYHGKWPFKRV  111



>ref|XP_010497975.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
 ref|XP_010497976.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=342

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R    LF +   +F    AS GDADP Y+ CV +CE SGCVG +CF  CN SS G  
Sbjct  1    MAVRYWTALFLVLPCLFTFSTASAGDADPSYRSCVSECEVSGCVGQECFPQCNSSSSG--  58

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
               PWY+QEPLYL+WK+  C  DCRY CM+ RE ER+ LG  P+KYHGKWPF+RV
Sbjct  59   --APWYIQEPLYLQWKKGGCQGDCRYQCMVNRERERETLGQSPIKYHGKWPFKRV  111



>dbj|BAH19866.1| AT1G16560 [Arabidopsis thaliana]
Length=337

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +1

Query  217  VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQW  396
            + NAS GDADP Y+ CV +CE SGCVG  CF  CN SS G    GPWY+QEPLYL+WK+W
Sbjct  14   ISNASAGDADPDYRTCVSECEISGCVGQLCFPQCNSSSDG----GPWYIQEPLYLQWKKW  69

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             C  DCRY CM+ RE ER+ LG  PVKYHGKWPF+RV
Sbjct  70   GCQGDCRYQCMVNRETERETLGQAPVKYHGKWPFKRV  106



>ref|XP_009149093.1| PREDICTED: post-GPI attachment to proteins factor 3 [Brassica 
rapa]
Length=343

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 3/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R    L  + S +F+V  AS GDADP Y+ CV +CE++GC+G  CF  CN SS    
Sbjct  1    MAVRYCAALLLVLSCLFSVSYASLGDADPNYRTCVAECERNGCIGQVCFPQCNSSSSSG-  59

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              GPWY QEPLYL+W++  C  DCRYHCM+ RE+ER+ LG  PVKYHGKWPF+RV
Sbjct  60   --GPWYTQEPLYLQWQKLGCQGDCRYHCMVNREKERESLGHVPVKYHGKWPFKRV  112



>ref|XP_010444070.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Camelina 
sativa]
Length=345

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +1

Query  214  AVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQ  393
            + L ASDGD+DP+YK CV+QC+K+GCVG  CFQ+C FS+ G  IDGPWY+QEPLYL+WKQ
Sbjct  21   SALEASDGDSDPLYKSCVEQCQKTGCVGDTCFQNCKFSADGKVIDGPWYMQEPLYLRWKQ  80

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WDC SDC+Y CM+ REEER++ G +P KY GKWP + V
Sbjct  81   WDCQSDCQYECMMTREEERRRNGERPTKYFGKWPLKHV  118



>ref|XP_006857922.1| hypothetical protein AMTR_s00069p00146030 [Amborella trichopoda]
 gb|ERN19389.1| hypothetical protein AMTR_s00069p00146030 [Amborella trichopoda]
Length=326

 Score =   137 bits (346),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  256  KVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLA  435
            + CV+QCEKSGC+G  CF+ C+FSS G     PWY+QEPLYL+WKQ +C SDCRYHCML 
Sbjct  9    RTCVKQCEKSGCIGESCFKQCSFSSDGTSAGSPWYMQEPLYLRWKQLNCRSDCRYHCMLE  68

Query  436  REEERQKLGLKPVKYHGKWPFQRV  507
            RE+ER+KLG  PVKYHGKWPF+RV
Sbjct  69   REKEREKLGHGPVKYHGKWPFKRV  92



>emb|CDY40049.1| BnaC05g12660D [Brassica napus]
Length=343

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R    L  + S +F+V  AS GDADP Y+ CV +CE++GCVG  CF  CN SS    
Sbjct  1    MAVRYCTALLLVLSCLFSVSYASLGDADPNYRTCVAECERNGCVGQVCFPQCNSSSSSV-  59

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
              GPWY QEPLYL+W++  C  DCRYHCM+ RE+ER+ LG  P+KYHGKWPF+R
Sbjct  60   --GPWYTQEPLYLQWQKLGCQGDCRYHCMVNREKERESLGHVPIKYHGKWPFKR  111



>ref|XP_006422207.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 ref|XP_006490484.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Citrus sinensis]
 ref|XP_006490490.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Citrus sinensis]
 gb|ESR35447.1| hypothetical protein CICLE_v10005304mg [Citrus clementina]
 gb|KDO46712.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
 gb|KDO46713.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=352

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  262  CVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLARE  441
            CV+QCE++GCVG KCF HC FSS G  I+GPWY+QEPLYL+WK+WDCLSDCRY+CM+ RE
Sbjct  44   CVKQCEETGCVGQKCFPHCKFSSDGASINGPWYMQEPLYLQWKKWDCLSDCRYNCMVDRE  103

Query  442  EERQKLGLKPVKYHGKWPFQRV  507
             +R  LG  PVKYHGKWPF RV
Sbjct  104  IKRDALGHGPVKYHGKWPFIRV  125



>ref|XP_006490483.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Citrus sinensis]
 ref|XP_006490489.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Citrus sinensis]
Length=353

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  262  CVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLARE  441
            CV+QCE++GCVG KCF HC FSS G  I+GPWY+QEPLYL+WK+WDCLSDCRY+CM+ RE
Sbjct  44   CVKQCEETGCVGQKCFPHCKFSSDGASINGPWYMQEPLYLQWKKWDCLSDCRYNCMVDRE  103

Query  442  EERQKLGLKPVKYHGKWPFQRV  507
             +R  LG  PVKYHGKWPF RV
Sbjct  104  IKRDALGHGPVKYHGKWPFIRV  125



>ref|XP_009788344.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Nicotiana sylvestris]
Length=335

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R L + F   S ++   +AS GD DP+Y+ C+ QCEK+GCVG  CF HC +S  G+ 
Sbjct  1    MADRYLAIFFVSLSCLYRSFDASAGDVDPLYRACISQCEKTGCVGETCFTHCEYSVDGSS  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             D     +EPLY +  Q DC +DC+YHCML RE+ER  LG  PVKYHGKWPF+RV
Sbjct  61   SDNQ---KEPLYRQLTQRDCPNDCKYHCMLQREKERAALGFGPVKYHGKWPFKRV  112



>ref|NP_001190592.1| Per1-like family protein [Arabidopsis thaliana]
 gb|AED97568.1| Per1-like family protein [Arabidopsis thaliana]
Length=345

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  250  IYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCM  429
            + + CV QC+K+GCVG  CFQHC FS+ G  IDGPWY+QEPLYL+WKQWDC SDC+Y CM
Sbjct  33   VIRSCVDQCQKTGCVGDTCFQHCKFSADGKAIDGPWYMQEPLYLRWKQWDCQSDCQYECM  92

Query  430  LAREEERQKLGLKPVKYHGKWPFQRV  507
            + REEER++ G +P KY GKWP + V
Sbjct  93   MTREEERKRNGERPTKYFGKWPLKHV  118



>ref|XP_008668589.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=545

 Score =   136 bits (343),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  232  DGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSD  411
            +GDADP+Y+ CV+ C+K+G +     +HC   + G P+D  WY  EPLYL+WK W+C S+
Sbjct  226  EGDADPLYRACVEGCQKTGSLKETSIKHCMVPTDGQPVDKSWYTHEPLYLQWKDWNCKSE  285

Query  412  CRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            CRYHCM+ RE ER KLGL+PVKYHGKWP +R
Sbjct  286  CRYHCMMERENERAKLGLQPVKYHGKWPLKR  316



>ref|XP_009788343.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Nicotiana sylvestris]
Length=390

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R L + F   S ++   +AS GD DP+Y+ C+ QCEK+GCVG  CF HC +S  G+ 
Sbjct  1    MADRYLAIFFVSLSCLYRSFDASAGDVDPLYRACISQCEKTGCVGETCFTHCEYSVDGSS  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             D     +EPLY +  Q DC +DC+YHCML RE+ER  LG  PVKYHGKWPF+RV
Sbjct  61   SDNQ---KEPLYRQLTQRDCPNDCKYHCMLQREKERAALGFGPVKYHGKWPFKRV  112



>ref|XP_006364637.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
tuberosum]
Length=342

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            LV+LF L  +     +AS GDADP+Y+ C  QC+++GC G  CF HCN    G+  D  W
Sbjct  10   LVVLFCLVGA----FDASAGDADPLYRACFGQCKETGCAGETCFAHCNTPLNGSSSDDNW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            YL+EPLYL  KQ +CLSDC+YHCML RE ER   G  PVKYHGKWPF+RV
Sbjct  66   YLKEPLYLWLKQANCLSDCQYHCMLQRETERATHGFGPVKYHGKWPFKRV  115



>ref|XP_007133380.1| hypothetical protein PHAVU_011G174400g [Phaseolus vulgaris]
 ref|XP_007133381.1| hypothetical protein PHAVU_011G174400g [Phaseolus vulgaris]
 gb|ESW05374.1| hypothetical protein PHAVU_011G174400g [Phaseolus vulgaris]
 gb|ESW05375.1| hypothetical protein PHAVU_011G174400g [Phaseolus vulgaris]
Length=343

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +1

Query  217  VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQE-PLYLKWKQ  393
            V++AS GDADP Y+ CV QC+++GCVG +CF +C FSS G   D PWY+Q+ PLYL+WK+
Sbjct  19   VIDASAGDADPSYRGCVAQCQQTGCVGQRCFPNCKFSSDGEFSDRPWYMQQGPLYLQWKK  78

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WDC  DCRY+CM+ RE+ER+   L  VKYHGKWPF+R+
Sbjct  79   WDCQCDCRYYCMVDREKERESQNLGTVKYHGKWPFRRL  116



>ref|XP_004985958.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Setaria 
italica]
Length=348

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  229  SDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLS  408
            S+GDADP+YK CV++C+K+G +     +HC   + G P    WY  EPLYL+WK+W+C S
Sbjct  28   SEGDADPLYKACVEECQKTGSLKETSIKHCMVPTDGTPAHKSWYTHEPLYLQWKEWNCKS  87

Query  409  DCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            +CRYHCM+ RE ER +LGL+PVKYHGKWP +R
Sbjct  88   ECRYHCMMERENERTELGLQPVKYHGKWPLKR  119



>ref|NP_001142245.1| hypothetical protein precursor [Zea mays]
 gb|ACF81634.1| unknown [Zea mays]
 tpg|DAA42959.1| TPA: hypothetical protein ZEAMMB73_509369 [Zea mays]
Length=349

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  232  DGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSD  411
            +GDADP+Y+ CV+ C+K+G +     +HC   + G P+D  WY  EPLYL+WK W+C S+
Sbjct  30   EGDADPLYRACVEGCQKTGSLKETSIKHCMVPTDGQPVDKSWYTHEPLYLQWKDWNCKSE  89

Query  412  CRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            CRYHCM+ RE ER KLGL+PVKYHGKWP +R
Sbjct  90   CRYHCMMERENERAKLGLQPVKYHGKWPLKR  120



>emb|CDX81768.1| BnaC08g38330D [Brassica napus]
Length=410

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 4/102 (4%)
 Frame = +1

Query  202  SSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYL  381
            S +F+V  +S G+ADP Y+ CV +CE SGCVG  CF  CN SS      GPWY QEPLYL
Sbjct  82   SCLFSVSYSSLGNADPNYRACVGECEISGCVGQLCFPQCNSSSN----TGPWYTQEPLYL  137

Query  382  KWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +W++W C  DCRYHCM+ RE ER+ LG  P+KYHGKWPF+R+
Sbjct  138  QWQKWGCQGDCRYHCMVNRERERETLGQPPLKYHGKWPFKRL  179



>ref|XP_009590513.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
tomentosiformis]
Length=335

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 75/115 (65%), Gaps = 3/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R L + F   S +F   +AS GD DP+Y+ C+ QCEK+GCVG  CF HC +   G+ 
Sbjct  1    MADRYLAIFFVSLSCVFGAFDASAGDVDPLYRACILQCEKTGCVGETCFTHCKYYIDGSF  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             D     +EPLY +  Q DC +DC+YHCML RE+ER  LG  PVKYHGKW F+RV
Sbjct  61   SDSQ---KEPLYRQLTQSDCPNDCKYHCMLEREKERAALGFGPVKYHGKWTFKRV  112



>ref|XP_009117756.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Brassica 
rapa]
 ref|XP_009117757.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Brassica 
rapa]
 emb|CDY50998.1| BnaA09g56270D [Brassica napus]
Length=344

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = +1

Query  226  ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCL  405
            AS GDADP Y+ CV +CE SGCVG  CF  CN SS      GPWY QEPLYL+W++W C 
Sbjct  24   ASLGDADPNYRACVGECEVSGCVGQLCFPQCNSSSN----TGPWYTQEPLYLQWQKWGCQ  79

Query  406  SDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             DCRYHCM+ RE+ER+ LG  P+KYHGKWPF+R+
Sbjct  80   GDCRYHCMVNREKERETLGQPPLKYHGKWPFKRL  113



>ref|XP_004250185.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
lycopersicum]
Length=342

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            LV+LF L  +     +AS GDADP+Y+ C  QC+++GC G  CF HCN     +  D  W
Sbjct  10   LVVLFCLVGA----FDASAGDADPLYRACFGQCKETGCAGETCFGHCNTPLNNSSSDDNW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            YL+EPLYL  KQ +CLSDC+YHCM+ RE ER   G  PVKYHGKWPF+RV
Sbjct  66   YLKEPLYLWLKQANCLSDCQYHCMIQRETERATHGFGPVKYHGKWPFKRV  115



>gb|EAY79260.1| hypothetical protein OsI_34376 [Oryza sativa Indica Group]
Length=320

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  229  SDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLS  408
            S+GDADP+Y+ CV++CEK+G +     +HC   S  +P D  WY  EPLYL+WK+W+C S
Sbjct  27   SEGDADPLYRACVEECEKTGSLRETSVRHCQVPSDDHPADKSWYEHEPLYLQWKEWNCKS  86

Query  409  DCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            +CRYHCM+ RE ER++LGL  VKYHGKWP +R
Sbjct  87   ECRYHCMMERESEREQLGLGSVKYHGKWPMKR  118



>ref|XP_002465979.1| hypothetical protein SORBIDRAFT_01g049340 [Sorghum bicolor]
 gb|EER92977.1| hypothetical protein SORBIDRAFT_01g049340 [Sorghum bicolor]
Length=349

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +1

Query  235  GDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDC  414
            GDADP+Y+ CV+ C+K+G +     +HC   + G P D  WY  EPLYL+WK W+C S+C
Sbjct  31   GDADPLYRACVEGCQKTGSLKETSIKHCLVPTDGQPADKSWYTHEPLYLQWKDWNCKSEC  90

Query  415  RYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            RYHCM+ RE ER KLGL+PVKYHGKWP +R 
Sbjct  91   RYHCMMERESERAKLGLQPVKYHGKWPLKRA  121



>ref|XP_009802480.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
sylvestris]
Length=342

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            LV+LF LF +     +AS GDADP+Y+ C  QC+K+GC G  CF HC     G+  D  W
Sbjct  10   LVVLFCLFGT----FDASAGDADPLYRDCFDQCKKTGCAGETCFPHCKIPLNGSSSDDNW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            YL+E LYL  KQ +C SDC+YHCML RE++R   G  PVKYHGKWPF+RV
Sbjct  66   YLKESLYLWLKQANCQSDCQYHCMLQREKDRATHGFGPVKYHGKWPFKRV  115



>ref|NP_001141237.1| hypothetical protein precursor [Zea mays]
 gb|ACF85808.1| unknown [Zea mays]
 gb|AFW89790.1| hypothetical protein ZEAMMB73_859279 [Zea mays]
Length=349

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +1

Query  235  GDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDC  414
            GDADP+Y+ CV+ C+K+G +     +HC   + G P D  WY  EPLYL+WK W+C S+C
Sbjct  31   GDADPLYRACVEGCQKTGSLKEASIKHCMVPTDGQPADKSWYAHEPLYLQWKDWNCKSEC  90

Query  415  RYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            RYHCM+ RE ER KLGL+PVKYHGKWP +R 
Sbjct  91   RYHCMMEREGERAKLGLQPVKYHGKWPLKRA  121



>ref|XP_007149295.1| hypothetical protein PHAVU_005G058200g [Phaseolus vulgaris]
 gb|ESW21289.1| hypothetical protein PHAVU_005G058200g [Phaseolus vulgaris]
Length=334

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP-  354
            ++    +FS   A+ NAS GDADP Y+ CV+QCE+SGC+G +CF +C  S+   P+ GP 
Sbjct  6    VIAFILVFSPFIAISNASAGDADPRYRNCVEQCEESGCIGKRCFPNCKISADEVPVVGPP  65

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            W + EPLY +WK+  C S+C+Y+CML RE+ER+ L   P KYHGKWPF+R+
Sbjct  66   WGMVEPLYARWKKGHCKSNCQYYCMLNREKERELLNKDPEKYHGKWPFKRI  116



>ref|XP_007149294.1| hypothetical protein PHAVU_005G058200g [Phaseolus vulgaris]
 gb|ESW21288.1| hypothetical protein PHAVU_005G058200g [Phaseolus vulgaris]
Length=346

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP-  354
            ++    +FS   A+ NAS GDADP Y+ CV+QCE+SGC+G +CF +C  S+   P+ GP 
Sbjct  6    VIAFILVFSPFIAISNASAGDADPRYRNCVEQCEESGCIGKRCFPNCKISADEVPVVGPP  65

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            W + EPLY +WK+  C S+C+Y+CML RE+ER+ L   P KYHGKWPF+R+
Sbjct  66   WGMVEPLYARWKKGHCKSNCQYYCMLNREKERELLNKDPEKYHGKWPFKRI  116



>ref|XP_009615087.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nicotiana 
tomentosiformis]
Length=342

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            LV+LF L  +     +AS GDADP+Y+ C  QC+K+GC G  CF HC      +  D  W
Sbjct  10   LVVLFCLVGT----FDASAGDADPLYRACFDQCKKTGCAGETCFLHCKIPLDASSSDDNW  65

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            YL+EPLYL  KQ +C SDC+YHCML RE++R   G  PVKYHGKWPF+RV
Sbjct  66   YLKEPLYLWLKQANCQSDCQYHCMLQREKDRATHGFGPVKYHGKWPFKRV  115



>ref|NP_001065105.1| Os10g0524100 [Oryza sativa Japonica Group]
 gb|AAO00714.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAP54701.1| Per1-like family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF27019.1| Os10g0524100 [Oryza sativa Japonica Group]
 gb|EAZ16735.1| hypothetical protein OsJ_32212 [Oryza sativa Japonica Group]
 dbj|BAG93522.1| unnamed protein product [Oryza sativa Japonica Group]
Length=347

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +1

Query  229  SDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLS  408
            S+GDADP+Y+ CV +CEK+G +     +HC   +  +P D  WY  EPLYL+WK+W+C S
Sbjct  27   SEGDADPLYRACVDECEKTGSLRETSVRHCQVPTDDHPADKSWYAHEPLYLQWKEWNCKS  86

Query  409  DCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            +CRYHCM+ RE ER++LGL  VKYHGKWP +R
Sbjct  87   ECRYHCMMERESEREQLGLGSVKYHGKWPMKR  118



>gb|EAY79263.1| hypothetical protein OsI_34379 [Oryza sativa Indica Group]
Length=347

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +1

Query  229  SDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLS  408
            S+GDADP+Y+ CV +CEK+G +     +HC   +  +P D  WY  EPLYL+WK+W+C S
Sbjct  27   SEGDADPLYRACVDECEKTGSLRETSVRHCQVPTDDHPADKSWYAHEPLYLQWKEWNCKS  86

Query  409  DCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            +CRYHCM+ RE ER++LGL  VKYHGKWP +R
Sbjct  87   ECRYHCMMERESEREQLGLGSVKYHGKWPMKR  118



>emb|CDX86924.1| BnaC03g51940D [Brassica napus]
Length=313

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +1

Query  277  EKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQK  456
            +K+GCVG  CFQHC FS+ G  IDGPWY+QEPLYL+WKQWDC SDC+Y CM+ REEER++
Sbjct  10   KKTGCVGDNCFQHCKFSADGKAIDGPWYMQEPLYLRWKQWDCQSDCQYECMMTREEERKR  69

Query  457  LGLKPVKYHGKWPFQRV  507
             G KP KY GKWP + V
Sbjct  70   NGEKPTKYFGKWPLKHV  86



>ref|XP_003545917.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Glycine 
max]
Length=345

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            +    +FSS   +LNAS GD DP Y+ CV+QCE++GC   KCF +C FSS    I  PW 
Sbjct  7    IAFILVFSSFIVILNASAGDVDPHYRSCVKQCEETGCFKDKCFPNCKFSSDEVTIHHPWG  66

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            + EPLY+ WK+ DC +DC+Y+CM  RE+ER+ L   P KYH KWPF+R 
Sbjct  67   MLEPLYVHWKKGDCQNDCQYYCMFDREKERELLNKGPEKYHSKWPFKRT  115



>ref|XP_004240259.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
lycopersicum]
Length=330

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA    V+ F  FS +F + +AS GD DP+Y+ C+ QCEK+GC G  C QHC +S  G+ 
Sbjct  1    MADLCWVIFFVSFSCLFRIFDASIGDIDPLYRACIVQCEKTGCAGEICLQHCKYSLDGSL  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            ++     +EPLY++  Q DC SDC+YHCM+ RE++R  LG  PVKY+GKWP +RV
Sbjct  61   LNSQ---KEPLYMQLNQRDCPSDCKYHCMVQREKKRSSLGFGPVKYYGKWPLKRV  112



>ref|NP_001141953.1| hypothetical protein precursor [Zea mays]
 ref|XP_008667582.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF87368.1| unknown [Zea mays]
 tpg|DAA37380.1| TPA: hypothetical protein ZEAMMB73_215322 [Zea mays]
Length=346

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 0/103 (0%)
 Frame = +1

Query  199  FSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLY  378
            F  +   + AS GD DP Y+ CV++C+ +G +G     HC F      + G WY QE +Y
Sbjct  16   FGLVLGSVEASLGDVDPRYRTCVRECQTTGIIGENVISHCQFKEDNTSVGGSWYNQEQIY  75

Query  379  LKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            ++WK+ +C++DCRY CM  RE ERQ LGL PVKYHGKWPF RV
Sbjct  76   IQWKELNCMTDCRYFCMTRREGERQALGLSPVKYHGKWPFLRV  118



>gb|KHN27719.1| Post-GPI attachment to proteins factor 3 [Glycine soja]
Length=345

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            +    +FSS   +LNAS GD DP Y+ CV+QCE++GC   +CF +C FSS    I  PW 
Sbjct  7    IAFILVFSSFIVILNASAGDVDPHYRSCVKQCEETGCFKDRCFPNCKFSSDEVTIHHPWG  66

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            + EPLY+ WK+ DC +DC+Y+CM  RE+ER+ L   P KYH KWPF+R 
Sbjct  67   MLEPLYVHWKKGDCQNDCQYYCMFDREKERELLNKGPEKYHSKWPFKRT  115



>ref|XP_006360399.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Solanum 
tuberosum]
Length=330

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA    V+L   FS +F   +AS GD DP+Y+ C+ QCEK+GC G  C QHC +S  G+ 
Sbjct  1    MADLCWVILLVSFSFLFGAFDASIGDIDPLYRACIVQCEKTGCAGEICLQHCKYSLDGSL  60

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            ++     +EPLY++  Q DC +DC+YHCM+ RE++R  LG  PVKY+GKWP +RV
Sbjct  61   LNSQ---KEPLYMQLNQRDCPTDCKYHCMVQREKKRSSLGFGPVKYYGKWPLKRV  112



>ref|XP_006661973.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Oryza 
brachyantha]
Length=349

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +1

Query  229  SDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLS  408
            S+GDADP+Y+ CV +C+K+G +     +HC   +  +P D  WY  EPLYL+WK+W+C S
Sbjct  29   SEGDADPLYRSCVDECKKTGFLRDASVRHCQVPTDDHPADKSWYAHEPLYLQWKEWNCKS  88

Query  409  DCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +CRYHCM+ RE ER++LGL  +KYHGKWP +R 
Sbjct  89   ECRYHCMMERESEREQLGLGAIKYHGKWPMKRA  121



>ref|NP_001147973.1| CAB2 precursor [Zea mays]
 gb|ACG29294.1| CAB2 [Zea mays]
 gb|ACG38027.1| CAB2 [Zea mays]
Length=346

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RL  L A F  +   + AS GD DP Y+ CV++C+ +G +G     HC F      +   
Sbjct  9    RLASLLA-FGLVLVSVEASLGDVDPRYRTCVRECQATGIIGENVISHCQFKENYTSVGVS  67

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY QE +Y++WK+ +C +DCRY CM+ RE ERQ LGL PVKYHGKWPF RV
Sbjct  68   WYNQEQIYIQWKELNCRTDCRYFCMMQREGERQSLGLSPVKYHGKWPFLRV  118



>ref|XP_002448009.1| hypothetical protein SORBIDRAFT_06g019590 [Sorghum bicolor]
 gb|EES12337.1| hypothetical protein SORBIDRAFT_06g019590 [Sorghum bicolor]
Length=346

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RL  L A F  +   + AS GD D  Y+ CV++C+ +G +G     HC        + G 
Sbjct  9    RLASLLA-FGLVLGTVEASLGDVDRRYRTCVRECQTTGIIGENNISHCQSKENDASVGGS  67

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY QE +Y++WKQ +C++DCRY CM+ RE ERQ LGL PVKYHGKWPF RV
Sbjct  68   WYNQEQIYIQWKQLNCMTDCRYFCMMQREGERQSLGLSPVKYHGKWPFLRV  118



>ref|XP_003562375.1| PREDICTED: post-GPI attachment to proteins factor 3 [Brachypodium 
distachyon]
Length=348

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = +1

Query  208  IFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNF-SSGGNPIDGPWYLQEPLYLK  384
            +   + AS GD D  Y+ CV++C+++  +G     HC F  +     +  WY QEPLY++
Sbjct  20   VLGSVEASLGDTDLQYRTCVEECQRTSSIGRNIISHCQFPENNSTSAESSWYSQEPLYMQ  79

Query  385  WKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WKQ +C++DCRY+CM+ REEERQ  GL+PVKYHGKWPF RV
Sbjct  80   WKQLNCMTDCRYYCMVQREEERQSRGLRPVKYHGKWPFIRV  120



>ref|XP_004968454.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Setaria 
italica]
Length=346

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RL  L AL   +   + AS GD DP Y+ CV++C+ +G +G     HC        + G 
Sbjct  9    RLASLLAL-GLVLGSVEASLGDIDPRYRTCVKECQTTGIIGENIISHCQNKENDTSVGGS  67

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY QE +Y++WKQ  C +DCRY CM+ RE ERQ LGL PVKYHGKWPF R+
Sbjct  68   WYNQEQIYIQWKQLSCRTDCRYFCMMQREGERQSLGLNPVKYHGKWPFLRI  118



>gb|AFW89789.1| hypothetical protein ZEAMMB73_859279 [Zea mays]
Length=357

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = +1

Query  235  GDADPIYK--------VCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWK  390
            GDADP+Y+         CV+ C+K+G +     +HC   + G P D  WY  EPLYL+WK
Sbjct  31   GDADPLYRSPTGAENRACVEGCQKTGSLKEASIKHCMVPTDGQPADKSWYAHEPLYLQWK  90

Query  391  QWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             W+C S+CRYHCM+ RE ER KLGL+PVKYHGKWP +R 
Sbjct  91   DWNCKSECRYHCMMEREGERAKLGLQPVKYHGKWPLKRA  129



>ref|NP_001054945.1| Os05g0220100 [Oryza sativa Japonica Group]
 gb|AAT07554.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT07622.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16859.1| Os05g0220100 [Oryza sativa Japonica Group]
 gb|EAY97004.1| hypothetical protein OsI_18926 [Oryza sativa Indica Group]
 dbj|BAH00766.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62778.1| hypothetical protein OsJ_17581 [Oryza sativa Japonica Group]
Length=349

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 69/103 (67%), Gaps = 5/103 (5%)
 Frame = +1

Query  208  IFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGN---PIDGPWYLQEPLY  378
            +   ++AS GD DP Y+ CV++C  +G +G     HC   S GN    +   WY QEPLY
Sbjct  21   VLGSVDASLGDVDPQYRTCVEECHTTGIIGENIISHCQ--SPGNDDASVGSSWYTQEPLY  78

Query  379  LKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            ++WKQ +C++DCRY+CM+ RE ERQ  GL PVKYHGKWPF RV
Sbjct  79   MQWKQLNCMNDCRYYCMMQREGERQSRGLNPVKYHGKWPFIRV  121



>gb|AFW58545.1| hypothetical protein ZEAMMB73_490076 [Zea mays]
Length=396

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RL  L A F  +   + AS GD DP Y+ CV++C+ +G VG     HC        +   
Sbjct  59   RLASLLA-FGLVLVSVEASLGDVDPRYRTCVRECQATGIVGENVISHCQSKENYTSVGVS  117

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY QE +Y++WK+ +C +DCRY CM+ RE ERQ LGL PVKYHGKWPF RV
Sbjct  118  WYNQEQIYIQWKELNCRTDCRYFCMMQREGERQSLGLSPVKYHGKWPFLRV  168



>gb|ACN35025.1| unknown [Zea mays]
Length=346

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RL  L A F  +   + AS GD DP Y+ CV++C+ +G VG     HC        +   
Sbjct  9    RLASLLA-FGLVLVFVEASLGDVDPRYRTCVRECQATGIVGENVISHCQSKENYTSVGVS  67

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY QE +Y++WK+ +C +DCRY CM+ RE ERQ LGL PVKYHGKWPF RV
Sbjct  68   WYNQEQIYIQWKELNCRTDCRYFCMMQREGERQSLGLSPVKYHGKWPFLRV  118



>ref|XP_008661897.1| PREDICTED: CAB2 isoform X1 [Zea mays]
 gb|ACN34014.1| unknown [Zea mays]
Length=346

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RL  L A F  +   + AS GD DP Y+ CV++C+ +G VG     HC        +   
Sbjct  9    RLASLLA-FGLVLVSVEASLGDVDPRYRTCVRECQATGIVGENVISHCQSKENYTSVGVS  67

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY QE +Y++WK+ +C +DCRY CM+ RE ERQ LGL PVKYHGKWPF RV
Sbjct  68   WYNQEQIYIQWKELNCRTDCRYFCMMQREGERQSLGLSPVKYHGKWPFLRV  118



>dbj|BAK01927.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 5/120 (4%)
 Frame = +1

Query  163  MAPRRL--VLLFALFSSIFAV--LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSS  330
            MA R L  V L +L +  F V  + AS GDA P+Y+ CV++C+ +G +G     +C    
Sbjct  1    MAGRSLWVVRLASLLAVGFVVGSVEASPGDAHPLYRTCVKECQNTGIIGSNIISNCQSQE  60

Query  331  G-GNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              G      WY QEPLY+ WKQ +C +DCRY+CM+ REEER   GL PVKYHGKWPF+RV
Sbjct  61   NHGTSAGSSWYTQEPLYMHWKQQNCKTDCRYYCMIRREEERHLGGLSPVKYHGKWPFKRV  120



>dbj|BAJ93369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 77/120 (64%), Gaps = 5/120 (4%)
 Frame = +1

Query  163  MAPRRL--VLLFALFSSIFAV--LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSS  330
            MA R L  V L +L +  F V  + AS GDA P+Y+ CV++C+ +G +G     +C    
Sbjct  1    MAGRSLWVVRLASLLAVGFVVGSVEASPGDAHPLYRTCVKECQNTGIIGSNIISNCQSQE  60

Query  331  GGNPIDGP-WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              +   G  WY QEPLY+ WKQ +C +DCRY+CM+ REEER   GL PVKYHGKWPF+RV
Sbjct  61   NHSTSAGSSWYTQEPLYMHWKQQNCKTDCRYYCMIRREEERHLGGLSPVKYHGKWPFKRV  120



>ref|XP_006664912.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Oryza 
brachyantha]
Length=351

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNF-SSGGNPIDGPWYLQEPLYLKWKQW  396
            ++AS GD DP Y+ CV++C  +G +G     HC    + G  +   WY QEPLY++WKQ 
Sbjct  27   VDASLGDVDPQYRTCVEECHTTGIIGENIVTHCQSPGNDGTSVGSYWYAQEPLYMEWKQL  86

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +C +DCRY+CM+ RE ERQ  GL PVKYHGKWPF RV
Sbjct  87   NCRTDCRYYCMVQREGERQSRGLSPVKYHGKWPFIRV  123



>gb|AAM12953.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47869.1| unknown protein [Arabidopsis thaliana]
Length=156

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 61/83 (73%), Gaps = 4/83 (5%)
 Frame = +1

Query  259  VCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAR  438
            + + +CE SGCVG  CF  CN SS G    GPWY+QEPLYL+WK+W C  DCRY CM+ R
Sbjct  8    IQITECEISGCVGQLCFPQCNSSSDG----GPWYIQEPLYLQWKKWGCQGDCRYQCMVNR  63

Query  439  EEERQKLGLKPVKYHGKWPFQRV  507
            E ER+ LG  PVKYHGKWPF+RV
Sbjct  64   ETERETLGQAPVKYHGKWPFKRV  86



>ref|XP_010919213.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Elaeis guineensis]
Length=339

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            R VLL  LF  I    +AS+GDADP+Y+ C +QC+ +G  G    QHC FSSG  P +  
Sbjct  4    RWVLLVVLFGCILGATDASEGDADPLYRDCTEQCQNTGSFGNNSIQHCQFSSGDVPGENT  63

Query  355  WYLQEPLY---LKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             +++  LY   LKWKQW C S C+Y CM  RE ER  LGLK VKYHGKWP + V
Sbjct  64   -FMKTQLYSLHLKWKQWKCRSFCQYLCMKQREMERGALGLKAVKYHGKWPSKHV  116



>ref|XP_010919212.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Elaeis guineensis]
Length=344

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            R VLL  LF  I    +AS+GDADP+Y+ C +QC+ +G  G    QHC FSSG  P +  
Sbjct  4    RWVLLVVLFGCILGATDASEGDADPLYRDCTEQCQNTGSFGNNSIQHCQFSSGDVPGENT  63

Query  355  WYLQE--PLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +   +   L+LKWKQW C S C+Y CM  RE ER  LGLK VKYHGKWP + V
Sbjct  64   FMKTQLYSLHLKWKQWKCRSFCQYLCMKQREMERGALGLKAVKYHGKWPSKHV  116



>gb|EMS67113.1| Post-GPI attachment to proteins factor 3 [Triticum urartu]
Length=703

 Score =   117 bits (294),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 54/111 (49%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP-  354
            L+ L  +F SI   + AS GDADP Y+ CV +C+ +G +G     HC      +   G  
Sbjct  14   LLALPGIFVSI--SVEASPGDADPHYRTCVGECQNTGIIGGNIISHCQSRENDSISAGSS  71

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY QE L ++WKQ +C++DCRY+CM+ REEER+  GL PV+YHGKWPF+RV
Sbjct  72   WYTQEALRVQWKQLNCMTDCRYYCMMRREEERRLGGLSPVQYHGKWPFKRV  122



>gb|EMT06679.1| hypothetical protein F775_25984 [Aegilops tauschii]
Length=358

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP-  354
            L+ L  +F S+   + AS GDADP Y+ CV +C+ +G +G     HC      +   G  
Sbjct  14   LLALPGIFVSV--SVEASRGDADPHYRTCVGECQNTGIIGGNIISHCQSRENDSISAGSS  71

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WY QE L ++WKQ +C++DCRY+CM+ REEER+  GL PV+YHGKWPF+RV
Sbjct  72   WYTQEALRVQWKQLNCMTDCRYYCMMRREEERRLGGLSPVQYHGKWPFKRV  122



>dbj|BAK02712.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCN-FSSGGNPIDGPWYLQEPLYLKWKQW  396
            + AS GDADP Y+ CV +C+ +G +      HC+   +        WY QE L ++WKQ 
Sbjct  29   VQASRGDADPHYRTCVDECQNTGIIASNIISHCSSLENDSTSAGTSWYTQEALGMQWKQL  88

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +C++DCRY+CM+ REEER+  GL PV+YHGKWPF+RV
Sbjct  89   NCMTDCRYYCMMQREEERRLGGLSPVQYHGKWPFKRV  125



>gb|EMT11964.1| hypothetical protein F775_08311 [Aegilops tauschii]
Length=343

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 76/132 (58%), Gaps = 22/132 (17%)
 Frame = +1

Query  178  LVLLFALFSSIFAV--LNASDGDADPIYKV-------------------CVQQCEKSGCV  294
            +V L +L +  F V  + AS GDA P+Y+V                   CV++C+ +G +
Sbjct  8    VVRLASLLAVGFVVGSVEASPGDAHPLYRVKGIILFRSCFVTFLCSERTCVKECKNTGVI  67

Query  295  GVKCFQHCNFSSGGNPIDGP-WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKP  471
            G     HC      +   G  WY QEPLY++WK   C+SDCRY+CM+ REEERQ  GL P
Sbjct  68   GSNIISHCQSQENDSTSAGSSWYTQEPLYMQWKHQSCMSDCRYYCMIRREEERQLGGLSP  127

Query  472  VKYHGKWPFQRV  507
            VKYHGKWPF+RV
Sbjct  128  VKYHGKWPFKRV  139



>gb|EMT25149.1| hypothetical protein F775_19461 [Aegilops tauschii]
Length=352

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +1

Query  232  DGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSD  411
            +GDADP+Y+ C ++C+++G +     +HC   +   P D  WY  EPLYL+WK+W+C S+
Sbjct  33   EGDADPLYRACFEECQRTGTLKEDSIKHCVVPTDDQPADKAWYAHEPLYLQWKEWNCNSE  92

Query  412  CRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            CRYHCM+ RE+ER++LGL PVKYHGKWP +R
Sbjct  93   CRYHCMMEREQEREELGLGPVKYHGKWPLKR  123



>gb|EMS62696.1| hypothetical protein TRIUR3_14941 [Triticum urartu]
Length=348

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +1

Query  232  DGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSD  411
            +GDADP+Y+ C ++C+++G +     +HC   +   P D  WY  EPLYL+WK+W+C S+
Sbjct  29   EGDADPLYRACFEECQRTGTLKEDSIKHCVVPTDDQPADKAWYAHEPLYLQWKEWNCNSE  88

Query  412  CRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            CRYHCM+ RE+ER++LGL PVKYHGKWP +R 
Sbjct  89   CRYHCMMEREQEREELGLGPVKYHGKWPLKRA  120



>tpg|DAA37379.1| TPA: hypothetical protein ZEAMMB73_215322 [Zea mays]
Length=348

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +1

Query  259  VCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAR  438
             CV++C+ +G +G     HC F      + G WY QE +Y++WK+ +C++DCRY CM  R
Sbjct  38   TCVRECQTTGIIGENVISHCQFKEDNTSVGGSWYNQEQIYIQWKELNCMTDCRYFCMTRR  97

Query  439  EEERQKLGLKPVKYHGKWPFQRV  507
            E ERQ LGL PVKYHGKWPF RV
Sbjct  98   EGERQALGLSPVKYHGKWPFLRV  120



>ref|XP_002986499.1| hypothetical protein SELMODRAFT_124213 [Selaginella moellendorffii]
 gb|EFJ12356.1| hypothetical protein SELMODRAFT_124213 [Selaginella moellendorffii]
Length=345

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 11/109 (10%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            +LL ALF        AS GD DP Y+ CV+ C+ SGC+G  CF  CN S+     +    
Sbjct  16   ILLLALFC------GASAGDRDPSYRDCVESCQSSGCIGDLCFSSCNASTFSGKKE----  65

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             +EP+YL   +WDC S+CRY CM  RE+ER   G KPVKYHGKWPF R+
Sbjct  66   -EEPIYLSITRWDCPSECRYQCMTRREDERALAGEKPVKYHGKWPFDRI  113



>ref|XP_002964918.1| hypothetical protein SELMODRAFT_167352 [Selaginella moellendorffii]
 gb|EFJ33756.1| hypothetical protein SELMODRAFT_167352 [Selaginella moellendorffii]
Length=345

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 11/109 (10%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            +LL ALF        AS GD DP Y+ CV+ C+ SGC+G  CF  CN S+     +    
Sbjct  16   ILLLALFC------GASAGDRDPSYRDCVESCQSSGCIGDLCFSSCNASTFSGKKE----  65

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             +EP+YL   +WDC S+CRY CM  RE+ER   G KPVKYHGKWPF R+
Sbjct  66   -EEPIYLSITRWDCPSECRYQCMTRREDERALAGGKPVKYHGKWPFDRI  113



>gb|EMS64956.1| hypothetical protein TRIUR3_20884 [Triticum urartu]
Length=357

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = +1

Query  190  FALFSSIFAVLNASDGDADPI-YKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP-WYL  363
             + F +++ +L  +    D    K CV++C+ +G  G     HC      +   G  WY 
Sbjct  46   LSFFPALYGLLKVTIKFVDVFRTKTCVKECQNTGITGSNIISHCQSRDNDSTSAGSSWYT  105

Query  364  QEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             EPLYL+WKQ +C++DCRY+CM+ REE RQ  GL PVKYHGKWPF+RV
Sbjct  106  HEPLYLQWKQQNCMTDCRYYCMIQREERRQLGGLSPVKYHGKWPFKRV  153



>ref|XP_001771346.1| predicted protein [Physcomitrella patens]
 gb|EDQ63906.1| predicted protein [Physcomitrella patens]
Length=368

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 16/107 (15%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSG----GN------PIDGPW--YLQ  366
              SDGD  P Y+ CV+ CE++GCV  +C+  CNF       GN       I+ P   +L+
Sbjct  25   EGSDGDQRPRYRECVKGCEQTGCVDGQCYNSCNFQVNVDLEGNILPKKAQINSPHEKFLK  84

Query  367  EPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            EPLYL+WK+WDC+S+CRY CML REE   ++   PVKYHGKWPF R+
Sbjct  85   EPLYLRWKKWDCISECRYQCML-REEADSEV---PVKYHGKWPFVRI  127



>ref|XP_001758224.1| predicted protein [Physcomitrella patens]
 gb|EDQ77046.1| predicted protein [Physcomitrella patens]
Length=136

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 69/107 (64%), Gaps = 16/107 (15%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSG----GN------PIDGPW--YLQ  366
             +SDGD  P Y+ CV+ CE++GCV  +C+  CNF       GN       ++ P   +L+
Sbjct  25   ESSDGDERPSYRECVKVCEQTGCVDGQCYNSCNFPVNVDLEGNILPKKAQLNSPHEKFLE  84

Query  367  EPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            EPLYL+WK+WDC+S+CRY CML REE   +    PVKYHGKWPF R+
Sbjct  85   EPLYLRWKKWDCISECRYQCML-REEAGSEF---PVKYHGKWPFVRI  127



>gb|ACF87974.1| unknown [Zea mays]
 tpg|DAA42958.1| TPA: hypothetical protein ZEAMMB73_509369 [Zea mays]
Length=291

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  328  SGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            + G P+D  WY  EPLYL+WK W+C S+CRYHCM+ RE ER KLGL+PVKYHGKWP +R
Sbjct  4    TDGQPVDKSWYTHEPLYLQWKDWNCKSECRYHCMMERENERAKLGLQPVKYHGKWPLKR  62



>ref|XP_003558964.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Brachypodium distachyon]
Length=348

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  247  PIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHC  426
            P+Y+ CV++C+++G +     +HC   +   P D  WY  EPLYL+WK+W+C S+CRYHC
Sbjct  34   PVYRSCVEECQRTGLLKEHSVKHCVVPTDDQPADKSWYAHEPLYLQWKEWNCNSECRYHC  93

Query  427  MLAREEERQKLGLKPVKYHGKWPFQR  504
            M+ RE+ER++L L PVKYHGKWP +R
Sbjct  94   MMEREKEREELRLGPVKYHGKWPLKR  119



>gb|AFW89791.1| hypothetical protein ZEAMMB73_859279 [Zea mays]
Length=291

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  328  SGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            + G P D  WY  EPLYL+WK W+C S+CRYHCM+ RE ER KLGL+PVKYHGKWP +R
Sbjct  4    TDGQPADKSWYAHEPLYLQWKDWNCKSECRYHCMMEREGERAKLGLQPVKYHGKWPLKR  62



>gb|KHN31540.1| Post-GPI attachment to proteins factor 3 [Glycine soja]
Length=276

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +1

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            + EPLYL+WKQWDC +DCRY+CML+REEER KLG KPVKYHGKWPF RV
Sbjct  1    MHEPLYLRWKQWDCCTDCRYYCMLSREEERTKLGDKPVKYHGKWPFHRV  49



>ref|XP_010229303.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X2 [Brachypodium distachyon]
Length=319

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +1

Query  256  KVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLA  435
            + CV++C+++G +     +HC   +   P D  WY  EPLYL+WK+W+C S+CRYHCM+ 
Sbjct  8    RSCVEECQRTGLLKEHSVKHCVVPTDDQPADKSWYAHEPLYLQWKEWNCNSECRYHCMME  67

Query  436  REEERQKLGLKPVKYHGKWPFQR  504
            RE+ER++L L PVKYHGKWP +R
Sbjct  68   REKEREELRLGPVKYHGKWPLKR  90



>gb|KDO46714.1| hypothetical protein CISIN_1g018683mg [Citrus sinensis]
Length=276

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +QEPLYL+WK+WDCLSDCRY+CM+ RE +R  LG  PVKYHGKWPF RV
Sbjct  1    MQEPLYLQWKKWDCLSDCRYNCMVDREIKRDALGHGPVKYHGKWPFIRV  49



>dbj|BAB10175.1| unnamed protein product [Arabidopsis thaliana]
Length=276

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +QEPLYL+WKQWDC SDC+Y CM+ REEER++ G +P KY GKWP + V
Sbjct  1    MQEPLYLRWKQWDCQSDCQYECMMTREEERKRNGERPTKYFGKWPLKHV  49



>ref|NP_001087556.1| post-GPI attachment to proteins factor 3 precursor [Xenopus laevis]
 sp|Q68EV0.1|PGAP3_XENLA RecName: Full=Post-GPI attachment to proteins factor 3; AltName: 
Full=PER1-like domain-containing protein 1; Flags: Precursor 
[Xenopus laevis]
 gb|AAH80100.1| MGC84367 protein [Xenopus laevis]
Length=317

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 60/114 (53%), Gaps = 21/114 (18%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MAP  LVL  A       V++AS GD +P+Y+ CV  C+++ C G   F+  +F +    
Sbjct  1    MAPF-LVLFLA------GVVSASRGDREPVYRDCVTVCDQNNCTG---FRLRDFRA----  46

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                   Q+PLY++   W CL DCRY CM        K G +  ++HGKWPF R
Sbjct  47   -------QQPLYMRLTGWTCLDDCRYKCMWYTVSLYLKEGHEVPQFHGKWPFSR  93



>ref|NP_001072247.1| post-GPI attachment to proteins factor 3 precursor [Xenopus (Silurana) 
tropicalis]
 sp|Q0VFE3.1|PGAP3_XENTR RecName: Full=Post-GPI attachment to proteins factor 3; AltName: 
Full=PER1-like domain-containing protein 1; Flags: Precursor 
[Xenopus (Silurana) tropicalis]
 gb|AAI18862.1| CAB2 protein [Xenopus (Silurana) tropicalis]
Length=316

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 58/114 (51%), Gaps = 21/114 (18%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MAP  LVL  A       V+ AS GD +P+Y+ CV  CE++ C G +     +F +    
Sbjct  1    MAPF-LVLFLA------GVVAASRGDREPVYRDCVTLCERNNCTGSRL---TDFRA----  46

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                   ++PLY++   W CL DCRY CM        K G +  ++HGKWPF R
Sbjct  47   -------EQPLYMRVTGWTCLDDCRYQCMWYTVSLYLKEGHEVPQFHGKWPFSR  93



>ref|XP_008401955.1| PREDICTED: post-GPI attachment to proteins factor 3-like, partial 
[Poecilia reticulata]
Length=155

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 53/109 (49%), Gaps = 15/109 (14%)
 Frame = +1

Query  181  VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY  360
            V +  L  S+ AV  +S GD +P+Y+ CV+QC ++ C G +      F S          
Sbjct  17   VAVILLLMSVTAV-QSSQGDKEPVYRDCVKQCVRTNCTGARLL---GFESS---------  63

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
              +P Y+    W C  DC+Y CM       Q  G +  ++HGKWPF R+
Sbjct  64   --QPHYMALTGWTCRDDCKYQCMWTTVGLYQAEGYRVPQFHGKWPFVRI  110



>ref|XP_010902233.1| PREDICTED: post-GPI attachment to proteins factor 3 [Esox lucius]
Length=332

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 21/129 (16%)
 Frame = +1

Query  124  LSSPSASCTVLAPMAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVK  303
            ++SP   CT ++  A   + L+F L  S+ AV ++S GD +P+Y+ CV QC ++ C G +
Sbjct  1    MASPLPPCTAVSYSALTIVSLVFLL--SVTAV-HSSQGDKEPVYQGCVTQCVRTNCTGAR  57

Query  304  C--FQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVK  477
               FQ                  +P Y+    W C  DCRY CM       Q  G    +
Sbjct  58   LRGFQS----------------TQPPYMALTGWTCRDDCRYQCMWQTVGLYQAEGYSIPQ  101

Query  478  YHGKWPFQR  504
            +HGKWPF R
Sbjct  102  FHGKWPFAR  110



>ref|XP_003058154.1| per1-like family protein [Micromonas pusilla CCMP1545]
 gb|EEH58105.1| per1-like family protein [Micromonas pusilla CCMP1545]
Length=382

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 12/98 (12%)
 Frame = +1

Query  250  IYKVCVQQ-CEKSGCVGVKCFQHCNFSS-----------GGNPIDGPWYLQEPLYLKWKQ  393
            +  VCV+  C K+GC  ++     N ++           GG  ++G    +    L+  +
Sbjct  43   VMDVCVRHDCFKTGCASLRDSNTGNVTTTAGACVSSCADGGTSLNGTSPREFDAALRVLR  102

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            WDC SDC+Y CM A E  R++ GL+P KY+GKWPF RV
Sbjct  103  WDCASDCKYRCMTAVERARRREGLEPKKYYGKWPFARV  140



>ref|XP_007940230.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X4 
[Orycteropus afer afer]
Length=206

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 57/116 (49%), Gaps = 20/116 (17%)
 Frame = +1

Query  163  MAPR--RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            MA R  RLVLL    + + AV + S GD +P+Y+ CV QCE+  C G    +H   S   
Sbjct  1    MAGRATRLVLL----AGVAAVASGSQGDREPVYRDCVLQCEERNCSG-SALKHFRSS---  52

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                      +P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  53   ----------QPIYMSLAGWTCRDDCKYECMWLTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_007940231.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X5 
[Orycteropus afer afer]
Length=185

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 57/116 (49%), Gaps = 20/116 (17%)
 Frame = +1

Query  163  MAPR--RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            MA R  RLVLL    + + AV + S GD +P+Y+ CV QCE+  C G    +H   S   
Sbjct  1    MAGRATRLVLL----AGVAAVASGSQGDREPVYRDCVLQCEERNCSG-SALKHFRSS---  52

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                      +P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  53   ----------QPIYMSLAGWTCRDDCKYECMWLTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_010739161.1| PREDICTED: post-GPI attachment to proteins factor 3 [Larimichthys 
crocea]
Length=355

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 56/116 (48%), Gaps = 19/116 (16%)
 Frame = +1

Query  157  APMAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            A +A   ++LL ++       + +S GD +P+Y+ CV+QC ++ C G +      F SG 
Sbjct  37   AAVATVTVLLLMSV-----TTVQSSQGDKEPVYRDCVKQCVRTNCTGARLR---GFQSG-  87

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                      +P Y+    W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  88   ----------QPRYMALTGWTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  133



>ref|XP_006394431.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
 gb|ESQ31717.1| hypothetical protein EUTSA_v10004514mg [Eutrema salsugineum]
Length=276

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  361  LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            +QEPLYL+WKQWDC SDC+Y CM+ REEER++ G KP KY GKWP + V
Sbjct  1    MQEPLYLRWKQWDCQSDCQYECMMTREEERRRNGEKPTKYFGKWPLKHV  49



>ref|XP_008281815.1| PREDICTED: post-GPI attachment to proteins factor 3 [Stegastes 
partitus]
 ref|XP_008302298.1| PREDICTED: post-GPI attachment to proteins factor 3 [Stegastes 
partitus]
Length=356

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 57/125 (46%), Gaps = 20/125 (16%)
 Frame = +1

Query  130  SPSASCTVLAPMAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCF  309
            SP  +   L  +A   L+L+ A        + +S GD +P+Y+ CV+QC ++ C G +  
Sbjct  30   SPRCTSVRLPALAAVVLLLMSA------TTVQSSQGDKEPVYRDCVKQCVRTNCTGARLR  83

Query  310  QHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGK  489
                F S            +P Y+    W C  DCRY CM       Q  G +  ++HGK
Sbjct  84   ---GFQSA-----------QPQYMALTGWTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGK  129

Query  490  WPFQR  504
            WPF R
Sbjct  130  WPFAR  134



>ref|XP_007940228.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X2 
[Orycteropus afer afer]
Length=299

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 57/116 (49%), Gaps = 20/116 (17%)
 Frame = +1

Query  163  MAPR--RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            MA R  RLVLL    + + AV + S GD +P+Y+ CV QCE+  C G    +H   S   
Sbjct  1    MAGRATRLVLL----AGVAAVASGSQGDREPVYRDCVLQCEERNCSG-SALKHFRSS---  52

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                      +P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  53   ----------QPIYMSLAGWTCRDDCKYECMWLTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_010770964.1| PREDICTED: post-GPI attachment to proteins factor 3 [Notothenia 
coriiceps]
Length=333

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 55/124 (44%), Gaps = 22/124 (18%)
 Frame = +1

Query  139  ASCTVLAPMAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVG--VKCFQ  312
            A CT +   A    VLL    +++     AS GD +P+Y+ CV+QC  S C G  ++ FQ
Sbjct  8    ARCTSVRFPAVATAVLLLLYITTV----QASQGDKEPVYRDCVKQCVGSNCTGDRLRSFQ  63

Query  313  HCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKW  492
                              +P Y+    W C  DCRY CM       Q  G    ++HGKW
Sbjct  64   S----------------SQPQYMALTGWTCRDDCRYQCMWTTVGLYQAEGYSVPQFHGKW  107

Query  493  PFQR  504
            PF R
Sbjct  108  PFVR  111



>ref|XP_007940227.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X1 
[Orycteropus afer afer]
Length=320

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 57/116 (49%), Gaps = 20/116 (17%)
 Frame = +1

Query  163  MAPR--RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            MA R  RLVLL    + + AV + S GD +P+Y+ CV QCE+  C G    +H   S   
Sbjct  1    MAGRATRLVLL----AGVAAVASGSQGDREPVYRDCVLQCEERNCSG-SALKHFRSS---  52

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                      +P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  53   ----------QPIYMSLAGWTCRDDCKYECMWLTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_001701622.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06597.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=314

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 48/95 (51%), Gaps = 8/95 (8%)
 Frame = +1

Query  226  ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCL  405
            AS GD   +++ C+  C  SGC  +    H      G P   P     PL L+  +W C 
Sbjct  1    ASSGDRSWVFQSCLAHCSSSGCTRLP---HAGHKQPGMPGASP----VPLPLRLFRWSCE  53

Query  406  SDCRYHCMLAREEERQKLGLKPV-KYHGKWPFQRV  507
             DC+YHCM A      +L   PV KYHGKWPF+RV
Sbjct  54   DDCKYHCMEAEHGGSPQLQRLPVEKYHGKWPFRRV  88



>ref|XP_003458790.2| PREDICTED: post-GPI attachment to proteins factor 3-like [Oreochromis 
niloticus]
Length=357

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 16/112 (14%)
 Frame = +1

Query  169  PRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            P  + +L  L S     + +S GD +P+Y+ CV+QC ++ C G +             ++
Sbjct  40   PAVVTVLLLLMS--VTTVQSSQGDKEPVYRDCVKQCVRTNCTGAR-------------LN  84

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            G +   +P Y+    W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  85   G-FLSAQPQYMALTGWTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  135



>ref|XP_007239376.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Astyanax 
mexicanus]
Length=323

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 18/97 (19%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKC--FQHCNFSSGGNPIDGPWYLQEPLYLKWKQ  393
            + AS GD +P+Y+ CV+QC ++ C G +   FQ                  +P Y+    
Sbjct  21   VGASQGDKEPVYRDCVKQCSRTNCTGARLRGFQS----------------TQPPYMALTG  64

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  65   WTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  101



>ref|XP_005749356.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Pundamilia 
nyererei]
Length=357

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 16/112 (14%)
 Frame = +1

Query  169  PRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            P  + +L  L S     + +S GD +P+Y+ CV+QC ++ C G +             ++
Sbjct  40   PAVVTVLLLLMS--VTTVQSSQGDKEPVYRDCVKQCIRANCTGAR-------------LN  84

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            G +   +P Y+    W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  85   G-FLSAQPQYMALTGWTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  135



>ref|XP_006805747.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Neolamprologus 
brichardi]
Length=357

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 16/112 (14%)
 Frame = +1

Query  169  PRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            P  + +L  L S     + +S GD +P+Y+ CV+QC ++ C G +             ++
Sbjct  40   PAVVTVLLLLMS--VTTVQSSQGDKEPVYRDCVKQCIRANCTGAR-------------LN  84

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            G +   +P Y+    W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  85   G-FLSAQPQYMALTGWTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  135



>ref|XP_004575037.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Maylandia 
zebra]
Length=357

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 16/112 (14%)
 Frame = +1

Query  169  PRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            P  + +L  L S     + +S GD +P+Y+ CV+QC ++ C G +             ++
Sbjct  40   PAVVTVLLLLMS--VTTVQSSQGDKEPVYRDCVKQCIRANCTGAR-------------LN  84

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            G +   +P Y+    W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  85   G-FLSAQPQYMALTGWTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  135



>ref|XP_007572869.1| PREDICTED: post-GPI attachment to proteins factor 3 [Poecilia 
formosa]
Length=331

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 61/129 (47%), Gaps = 20/129 (16%)
 Frame = +1

Query  124  LSSPSASCT-VLAPMAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGV  300
            ++S    CT V  PM+   ++LL ++       + +S GD +P+Y+ CV+ C ++ C G 
Sbjct  1    MASAFPRCTSVRLPMSVAVILLLMSV-----TAVQSSQGDKEPVYRDCVKLCVQTNCTGA  55

Query  301  KCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKY  480
            +      F S            +P Y+    W C  DC+Y CM       Q  G +  ++
Sbjct  56   RLL---GFESS-----------QPHYMALTGWTCRDDCKYQCMWTTVGLYQAEGYRVPQF  101

Query  481  HGKWPFQRV  507
            HGKWPF R+
Sbjct  102  HGKWPFVRI  110



>emb|CDQ75401.1| unnamed protein product [Oncorhynchus mykiss]
Length=336

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 43/95 (45%), Gaps = 14/95 (15%)
 Frame = +1

Query  220  LNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWD  399
            +NAS GD +P+Y+ CV QC ++ C G +         G      P       Y+    W 
Sbjct  29   VNASQGDKEPVYQDCVTQCVRTNCTGARL-------RGFQSTQAP-------YMALTGWT  74

Query  400  CLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            C  DCRY CM       Q  G    ++HGKWPF R
Sbjct  75   CRDDCRYQCMWQTVGLYQAEGYSIPQFHGKWPFAR  109



>ref|XP_004463084.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform 4 
[Dasypus novemcinctus]
Length=168

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 18/110 (16%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RLVLL    +    + + S GD +P+Y+ CV +CE+  C GV   +H  F S        
Sbjct  7    RLVLL----AGAATLASGSQGDREPMYRDCVLRCEERNCSGV-ALKH--FRS--------  51

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
               ++P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  52   ---RQPIYMSLAGWTCQDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



>emb|CBN81402.1| Post-GPI attachment to proteins factor 3 [Dicentrarchus labrax]
Length=308

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 46/97 (47%), Gaps = 14/97 (14%)
 Frame = +1

Query  214  AVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQ  393
              + +S GD +P+Y+ CV+QC ++ C G +      F S            +P Y+    
Sbjct  4    TTVQSSQGDKEPVYRDCVKQCVRTNCTGARLR---GFQSA-----------QPQYMALTG  49

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  50   WTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  86



>ref|XP_006638317.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Lepisosteus 
oculatus]
Length=283

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 14/97 (14%)
 Frame = +1

Query  214  AVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQ  393
            A ++ S GD +P Y+ CV+QC ++ C G +      F S            +P Y+    
Sbjct  29   ARVSGSQGDKEPFYRDCVKQCVRTNCTGSRLR---GFESS-----------QPHYMALTG  74

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  75   WTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFTR  111



>ref|XP_005947497.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Haplochromis 
burtoni]
Length=357

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 53/112 (47%), Gaps = 16/112 (14%)
 Frame = +1

Query  169  PRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            P  + +L  L S     +  S GD +P+Y+ CV+QC ++ C G +             ++
Sbjct  40   PAVVTVLLLLMS--VTTVQCSQGDKEPVYRDCVKQCIRANCTGAR-------------LN  84

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            G +   +P Y+    W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  85   G-FLSAQPQYMALTGWTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  135



>ref|NP_593834.1| GPI-phospholipase A2 activity regulator (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|Q9P6N9.1|PER1_SCHPO RecName: Full=Protein PER1 homolog; Flags: Precursor [Schizosaccharomyces 
pombe 972h-]
 emb|CAB90152.1| GPI-phospholipase A2 activity regulator (predicted) [Schizosaccharomyces 
pombe]
Length=331

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 56/117 (48%), Gaps = 18/117 (15%)
 Frame = +1

Query  163  MAPRRLVLLFALFS--SIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            M   R   +F LF+  S+F  ++AS GD  P+Y  CV +C ++ C              G
Sbjct  1    MRVLRNFTIFFLFTALSLFRQISASAGDLHPVYVSCVNRCIENKC-------------HG  47

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            NP D     + PL LK  +WDC S+C Y C +  E       L   +YHGKW F RV
Sbjct  48   NPSDTS---KLPLDLKLFRWDCGSNCGYECEITAENYFAAHNLPSQQYHGKWYFIRV  101



>ref|XP_005810657.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Xiphophorus 
maculatus]
Length=308

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 46/98 (47%), Gaps = 14/98 (14%)
 Frame = +1

Query  214  AVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQ  393
              + +S GD +P+Y+ CV+ C ++ C G +      F S            +P Y+    
Sbjct  4    TAVQSSQGDKEPVYRDCVKLCVRTNCTGARLL---GFESS-----------QPHYMALTG  49

Query  394  WDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            W C  DCRY CM       Q  G +  ++HGKWPF R+
Sbjct  50   WTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFVRI  87



>ref|XP_004463083.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform 3 
[Dasypus novemcinctus]
Length=241

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 18/110 (16%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RLVLL    +    + + S GD +P+Y+ CV +CE+  C GV   +H  F S        
Sbjct  7    RLVLL----AGAATLASGSQGDREPMYRDCVLRCEERNCSGVA-LKH--FRS--------  51

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
               ++P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  52   ---RQPIYMSLAGWTCQDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_008312260.1| PREDICTED: post-GPI attachment to proteins factor 3 [Cynoglossus 
semilaevis]
Length=329

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 46/95 (48%), Gaps = 18/95 (19%)
 Frame = +1

Query  226  ASDGDADPIYKVCVQQCEKSGCVG--VKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWD  399
            +S GD +P+Y+ CV+QC ++ C G  ++ FQ                  +P Y+    W 
Sbjct  29   SSQGDKEPVYRDCVKQCVRTNCTGARLRVFQS----------------SQPQYMVLTGWT  72

Query  400  CLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
            C  DCRY CM +     Q  G    ++HGKWPF R
Sbjct  73   CRDDCRYQCMWSTVVLYQAEGYGIPQFHGKWPFAR  107



>ref|XP_006750531.1| PREDICTED: post-GPI attachment to proteins factor 3 [Leptonychotes 
weddellii]
Length=157

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 14/94 (15%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDC  402
            + S GD +P+Y+ CV +CE+  C G    +H  F S           ++P+Y+    W C
Sbjct  19   SGSQGDREPVYRDCVHRCEERNCSG-GALRH--FRS-----------RQPIYMSLAGWTC  64

Query  403  LSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
              DC+Y CM        K G K  ++HGKWPF R
Sbjct  65   QDDCKYECMWVTVALYLKEGHKVPQFHGKWPFSR  98



>ref|XP_005156102.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X1 
[Danio rerio]
Length=320

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 44/96 (46%), Gaps = 18/96 (19%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKC--FQHCNFSSGGNPIDGPWYLQEPLYLKWKQW  396
            +AS GD +P+Y+ CV+ C ++ C G +   FQ                  +P Y+    W
Sbjct  19   SASQGDKEPVYRDCVKHCVRTNCTGARLRGFQS----------------TQPPYMALTGW  62

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
             C  DCRY CM       Q  G    ++HGKWPF R
Sbjct  63   TCRDDCRYQCMWTTVGLYQAEGYSIPQFHGKWPFAR  98



>emb|CAG12654.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=318

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 52/109 (48%), Gaps = 18/109 (17%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            +V+L A  S++     +S GD +P+Y+ CV+ C ++ C G +      F S         
Sbjct  4    VVILLAWTSTV----QSSPGDKEPVYRDCVKLCVRTNCTGARLR---GFQSA--------  48

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
               +P Y+    W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  49   ---QPQYMALTGWTCRDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  94



>ref|NP_001108063.1| post-GPI attachment to proteins factor 3 precursor [Danio rerio]
 sp|A8WFS8.1|PGAP3_DANRE RecName: Full=Post-GPI attachment to proteins factor 3; AltName: 
Full=PER1-like domain-containing protein 1; Flags: Precursor 
[Danio rerio]
 gb|AAI54444.1| Zgc:171485 protein [Danio rerio]
Length=316

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 44/96 (46%), Gaps = 18/96 (19%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKC--FQHCNFSSGGNPIDGPWYLQEPLYLKWKQW  396
            +AS GD +P+Y+ CV+ C ++ C G +   FQ                  +P Y+    W
Sbjct  15   SASQGDKEPVYRDCVKHCVRANCTGARLRGFQS----------------TQPPYMALTGW  58

Query  397  DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
             C  DCRY CM       Q  G    ++HGKWPF R
Sbjct  59   TCRDDCRYQCMWTTVGLYQAEGYSIPQFHGKWPFAR  94



>ref|XP_008152088.1| PREDICTED: post-GPI attachment to proteins factor 3 [Eptesicus 
fuscus]
Length=316

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 20/116 (17%)
 Frame = +1

Query  163  MAPR--RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            MA R  RLVLL    + +  + + S GD +P+Y+ CV +CE+  C G    +H  F S  
Sbjct  1    MAGRTARLVLL----AGVATLASGSQGDREPVYRDCVLRCEERNCSG-DALKH--FRS--  51

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                     ++P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  52   ---------RQPIYMSLAGWTCQDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_009047399.1| hypothetical protein LOTGIDRAFT_138807 [Lottia gigantea]
 gb|ESP01909.1| hypothetical protein LOTGIDRAFT_138807 [Lottia gigantea]
Length=293

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +1

Query  226  ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCL  405
             S GD   +++ C++ C KS C  +  F                + ++P YL+   WDC 
Sbjct  16   TSVGDRSFVFQKCLETCLKSNCTDMNVF----------------FSRQPYYLQLLHWDCS  59

Query  406  SDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
            S+CRY+CM    +  QK GL   +++GKWPF R+
Sbjct  60   SECRYYCMWKTVDAFQKDGLPIPQFNGKWPFIRI  93



>gb|KFO34892.1| Post-GPI attachment to proteins factor 3 [Fukomys damarensis]
Length=290

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 16/114 (14%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R + L+  L +   A+ +AS GD +P+Y+ CV +CE+  C G     H  F S    
Sbjct  1    MAERAVRLV--LLAGAVAMASASQGDREPVYRDCVLRCEERNCSG-GALNH--FRS----  51

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                    +P+Y+    W C  DC+Y CM        + G +  ++HGKWPF R
Sbjct  52   -------HQPIYMSLAGWTCRDDCKYDCMWVTVGLYLQEGHRVPQFHGKWPFFR  98



>ref|XP_004080335.1| PREDICTED: post-GPI attachment to proteins factor 3 [Oryzias 
latipes]
Length=343

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 15/112 (13%)
 Frame = +1

Query  169  PRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPID  348
            P  + ++  +  ++ AV  +S GD +P+Y+ CV+ C ++ C G +      F +      
Sbjct  25   PASVAVILLVLLAVPAV-RSSQGDKEPVYRDCVKLCVRTNCTGARLR---GFEA------  74

Query  349  GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                 ++P Y+    W C  DCRY CM       Q  G +  ++HGKWPF R
Sbjct  75   -----KQPHYMALTGWTCRDDCRYQCMWTTVGLYQAEGFRIPQFHGKWPFAR  121



>ref|XP_004463082.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform 2 
[Dasypus novemcinctus]
Length=297

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 18/110 (16%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RLVLL    +    + + S GD +P+Y+ CV +CE+  C GV   +H  F S        
Sbjct  7    RLVLL----AGAATLASGSQGDREPMYRDCVLRCEERNCSGVA-LKH--FRS--------  51

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
               ++P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  52   ---RQPIYMSLAGWTCQDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_003961434.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Takifugu 
rubripes]
Length=349

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 44/94 (47%), Gaps = 14/94 (15%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDC  402
             +S GD +P+Y+ CV+ C ++ C G +      F S            +P Y+    W C
Sbjct  48   QSSQGDKEPVYRDCVKLCVRTNCTGARLR---GFQSA-----------QPHYMALTGWTC  93

Query  403  LSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
              DCRY CM       Q  G +  ++HGKWPF R
Sbjct  94   RDDCRYQCMWTTVGLYQAEGYRVPQFHGKWPFAR  127



>ref|XP_008687474.1| PREDICTED: post-GPI attachment to proteins factor 3 [Ursus maritimus]
Length=206

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 14/94 (15%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDC  402
            + S GD +P+Y+ CV +CE+  C G    +H  F S           ++P+Y+    W C
Sbjct  19   SGSQGDREPVYRDCVHRCEERNCSG-GALRH--FRS-----------RQPIYMSLAGWTC  64

Query  403  LSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
              DC+Y CM        K G K  ++HGKWPF R
Sbjct  65   QDDCKYECMWVTVGLYLKEGHKVPQFHGKWPFSR  98



>ref|XP_009250141.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X4 
[Pongo abelii]
Length=169

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (49%), Gaps = 14/94 (15%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDC  402
            + S GD +P+Y+ CV QCE+  C G     H  F S           ++P+Y+    W C
Sbjct  19   SGSQGDREPVYRDCVLQCEEQNCSG-GALNH--FRS-----------RQPIYMSLAGWTC  64

Query  403  LSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
              DC+Y CM        + G K  ++HGKWPF R
Sbjct  65   RDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_006100845.1| PREDICTED: LOW QUALITY PROTEIN: post-GPI attachment to proteins 
factor 3 [Myotis lucifugus]
Length=316

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 57/116 (49%), Gaps = 20/116 (17%)
 Frame = +1

Query  163  MAPR--RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG  336
            MA R  RLVLL    + +  +   S GD +P+Y+ CV +CE+  C G    +H  F S  
Sbjct  1    MAGRAARLVLL----AGVATLAGGSQGDREPVYRDCVLRCEERNCSG-DALKH--FRS--  51

Query  337  NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                     ++P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  52   ---------RQPIYMSLAGWTCQDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_004463081.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform 1 
[Dasypus novemcinctus]
Length=318

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 18/110 (16%)
 Frame = +1

Query  175  RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP  354
            RLVLL    +    + + S GD +P+Y+ CV +CE+  C GV   +H  F S        
Sbjct  7    RLVLL----AGAATLASGSQGDREPMYRDCVLRCEERNCSGVA-LKH--FRS--------  51

Query  355  WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
               ++P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R
Sbjct  52   ---RQPIYMSLAGWTCQDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_010618587.1| PREDICTED: post-GPI attachment to proteins factor 3 [Fukomys 
damarensis]
Length=321

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 16/114 (14%)
 Frame = +1

Query  163  MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP  342
            MA R + L+  L +   A+ +AS GD +P+Y+ CV +CE+  C G     H  F S    
Sbjct  1    MAERAVRLV--LLAGAVAMASASQGDREPVYRDCVLRCEERNCSG-GALNH--FRS----  51

Query  343  IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
                    +P+Y+    W C  DC+Y CM        + G +  ++HGKWPF R
Sbjct  52   -------HQPIYMSLAGWTCRDDCKYDCMWVTVGLYLQEGHRVPQFHGKWPFFR  98



>ref|XP_009250142.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X5 
[Pongo abelii]
Length=148

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (49%), Gaps = 14/94 (15%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDC  402
            + S GD +P+Y+ CV QCE+  C G     H  F S           ++P+Y+    W C
Sbjct  19   SGSQGDREPVYRDCVLQCEEQNCSG-GALNH--FRS-----------RQPIYMSLAGWTC  64

Query  403  LSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
              DC+Y CM        + G K  ++HGKWPF R
Sbjct  65   RDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|NP_001278662.1| post-GPI attachment to proteins factor 3 isoform 6 precursor 
[Homo sapiens]
Length=148

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (49%), Gaps = 14/94 (15%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDC  402
            + S GD +P+Y+ CV QCE+  C G     H  F S           ++P+Y+    W C
Sbjct  19   SGSQGDREPVYRDCVLQCEEQNCSG-GALNH--FRS-----------RQPIYMSLAGWTC  64

Query  403  LSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
              DC+Y CM        + G K  ++HGKWPF R
Sbjct  65   RDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



>ref|XP_004921565.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform 
X1 [Bombyx mori]
Length=324

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 57/110 (52%), Gaps = 12/110 (11%)
 Frame = +1

Query  178  LVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPW  357
            LV +F L S   + L+AS+GD   IYK C+++C    C              G       
Sbjct  8    LVTVFIL-SCKLSQLSASEGDRLYIYKDCLKRCISRNC-----------DENGLLFRQNT  55

Query  358  YLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRV  507
             +Q+  + +   W C+ +C+YHCM +  ++ +  G + VK+HGKWPF+R+
Sbjct  56   TIQQDFWCRLFSWRCIDECKYHCMWSAVKKLENAGRQVVKFHGKWPFKRI  105



>ref|XP_009430529.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X2 
[Pan troglodytes]
Length=241

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (49%), Gaps = 14/94 (15%)
 Frame = +1

Query  223  NASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDC  402
            + S GD +P+Y+ CV QCE+  C G     H  F S           ++P+Y+    W C
Sbjct  19   SGSQGDREPVYRDCVLQCEEQNCSG-GALNH--FRS-----------RQPIYMSLAGWTC  64

Query  403  LSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQR  504
              DC+Y CM        + G K  ++HGKWPF R
Sbjct  65   RDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSR  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510