BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005E07

Length=311
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619069.1|  PREDICTED: vam6/Vps39-like protein                 130   2e-32   Nicotiana tomentosiformis
ref|XP_009777137.1|  PREDICTED: vam6/Vps39-like protein                 130   2e-32   Nicotiana sylvestris
ref|XP_004243182.1|  PREDICTED: vam6/Vps39-like protein                 124   3e-30   Solanum lycopersicum
ref|XP_006348372.1|  PREDICTED: vam6/Vps39-like protein-like            122   1e-29   Solanum tuberosum [potatoes]
ref|XP_011003738.1|  PREDICTED: vam6/Vps39-like protein                 119   1e-28   Populus euphratica
ref|XP_006383195.1|  hypothetical protein POPTR_0005s12470g             118   5e-28   
ref|XP_011025779.1|  PREDICTED: vam6/Vps39-like protein                 116   2e-27   Populus euphratica
gb|KDP38604.1|  hypothetical protein JCGZ_05311                         115   5e-27   Jatropha curcas
ref|XP_002310230.2|  hypothetical protein POPTR_0007s12810g             112   4e-26   
gb|KJB43502.1|  hypothetical protein B456_007G203400                    111   8e-26   Gossypium raimondii
ref|XP_007048414.1|  Vacuolar sorting protein 39 isoform 1              110   2e-25   
ref|XP_008367954.1|  PREDICTED: vam6/Vps39-like protein                 107   2e-25   
gb|KHG02853.1|  Vam6/Vps39-like protein                                 110   2e-25   Gossypium arboreum [tree cotton]
ref|XP_002267514.1|  PREDICTED: vam6/Vps39-like protein                 110   3e-25   Vitis vinifera
ref|XP_004232411.1|  PREDICTED: vam6/Vps39-like protein isoform X2      110   3e-25   Solanum lycopersicum
ref|XP_010316369.1|  PREDICTED: vam6/Vps39-like protein isoform X1      110   4e-25   Solanum lycopersicum
ref|XP_008344274.1|  PREDICTED: vam6/Vps39-like protein                 109   5e-25   
ref|XP_009340752.1|  PREDICTED: vam6/Vps39-like protein                 108   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_006340626.1|  PREDICTED: vam6/Vps39-like protein-like            108   1e-24   Solanum tuberosum [potatoes]
ref|XP_009347535.1|  PREDICTED: vam6/Vps39-like protein                 108   2e-24   Pyrus x bretschneideri [bai li]
gb|KJB43501.1|  hypothetical protein B456_007G203400                    107   2e-24   Gossypium raimondii
ref|XP_011099610.1|  PREDICTED: vam6/Vps39-like protein                 107   3e-24   Sesamum indicum [beniseed]
emb|CAN61039.1|  hypothetical protein VITISV_018673                     107   4e-24   Vitis vinifera
ref|XP_009371595.1|  PREDICTED: vam6/Vps39-like protein                 106   5e-24   
ref|XP_002521595.1|  conserved hypothetical protein                     106   6e-24   
gb|EYU40165.1|  hypothetical protein MIMGU_mgv1a000716mg                106   7e-24   Erythranthe guttata [common monkey flower]
ref|XP_007046945.1|  Vacuolar sorting protein 39                        105   9e-24   
ref|XP_006411980.1|  hypothetical protein EUTSA_v10024305mg             105   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_010263662.1|  PREDICTED: vam6/Vps39-like protein                 104   3e-23   Nelumbo nucifera [Indian lotus]
ref|XP_004149149.1|  PREDICTED: vam6/Vps39-like protein-like            103   7e-23   Cucumis sativus [cucumbers]
gb|KGN53245.1|  hypothetical protein Csa_4G038630                       103   7e-23   Cucumis sativus [cucumbers]
ref|XP_004165852.1|  PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-l...    102   2e-22   
gb|KHG17162.1|  Vam6/Vps39-like protein                                 102   2e-22   Gossypium arboreum [tree cotton]
ref|XP_008453745.1|  PREDICTED: vam6/Vps39-like protein                 101   3e-22   Cucumis melo [Oriental melon]
emb|CDO99043.1|  unnamed protein product                                100   8e-22   Coffea canephora [robusta coffee]
ref|XP_010548331.1|  PREDICTED: vam6/Vps39-like protein               99.4    2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010679721.1|  PREDICTED: vam6/Vps39-like protein               98.2    4e-21   
gb|KJB17778.1|  hypothetical protein B456_003G015100                  97.4    8e-21   Gossypium raimondii
ref|NP_195381.6|  protein EMBRYO DEFECTIVE 2754                       96.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CAB16830.1|  hypothetical protein                                 96.7    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66254.1|  hypothetical protein M569_08522                       93.2    2e-20   Genlisea aurea
ref|XP_010432158.1|  PREDICTED: vam6/Vps39-like protein               95.9    3e-20   
ref|XP_010437326.1|  PREDICTED: vam6/Vps39-like protein               95.9    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_004287898.1|  PREDICTED: vam6/Vps39-like protein               95.5    4e-20   Fragaria vesca subsp. vesca
gb|KDO79546.1|  hypothetical protein CISIN_1g0018511mg                92.0    6e-20   Citrus sinensis [apfelsine]
ref|XP_006283063.1|  hypothetical protein CARUB_v10004058mg           95.1    6e-20   Capsella rubella
ref|XP_010089006.1|  Vam6/Vps39-like protein                          94.0    1e-19   
ref|XP_002867003.1|  hypothetical protein ARALYDRAFT_490975           93.6    2e-19   
ref|XP_010446769.1|  PREDICTED: vam6/Vps39-like protein               93.2    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004509257.1|  PREDICTED: vam6/Vps39-like protein-like isof...  92.4    5e-19   Cicer arietinum [garbanzo]
ref|XP_004509258.1|  PREDICTED: vam6/Vps39-like protein-like isof...  92.4    5e-19   Cicer arietinum [garbanzo]
ref|XP_006425673.1|  hypothetical protein CICLE_v10024797mg           92.0    6e-19   Citrus clementina [clementine]
ref|XP_006425674.1|  hypothetical protein CICLE_v10024797mg           92.0    6e-19   Citrus clementina [clementine]
ref|XP_008775839.1|  PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-l...  88.2    1e-17   Phoenix dactylifera
ref|XP_007203223.1|  hypothetical protein PRUPE_ppa000769mg           88.2    1e-17   Prunus persica
emb|CDY42696.1|  BnaA03g53490D                                        87.8    2e-17   Brassica napus [oilseed rape]
ref|XP_009138434.1|  PREDICTED: vam6/Vps39-like protein               87.4    2e-17   Brassica rapa
gb|KFK30284.1|  hypothetical protein AALP_AA7G241500                  87.4    2e-17   Arabis alpina [alpine rockcress]
ref|XP_008241674.1|  PREDICTED: vam6/Vps39-like protein               87.0    3e-17   Prunus mume [ume]
ref|XP_010916252.1|  PREDICTED: vam6/Vps39-like protein isoform X1    86.3    6e-17   Elaeis guineensis
ref|XP_010916253.1|  PREDICTED: vam6/Vps39-like protein isoform X2    86.3    6e-17   
gb|AET03930.2|  vam6/Vps39-like protein                               84.3    3e-16   Medicago truncatula
ref|XP_003629454.1|  Tubby-like F-box protein                         84.3    4e-16   
ref|XP_009409101.1|  PREDICTED: vam6/Vps39-like protein               80.5    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX72591.1|  BnaC07g46130D                                        79.0    2e-14   
ref|XP_010258480.1|  PREDICTED: vam6/Vps39-like protein isoform X1    76.3    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010258481.1|  PREDICTED: vam6/Vps39-like protein isoform X2    76.3    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_007156942.1|  hypothetical protein PHAVU_002G030300g           75.9    3e-13   Phaseolus vulgaris [French bean]
ref|XP_003517237.2|  PREDICTED: vam6/Vps39-like protein-like          75.5    3e-13   Glycine max [soybeans]
gb|KHN36129.1|  Vam6/Vps39-like protein                               75.5    3e-13   Glycine soja [wild soybean]
ref|XP_010070055.1|  PREDICTED: vam6/Vps39-like protein               74.7    6e-13   Eucalyptus grandis [rose gum]
ref|XP_004512043.1|  PREDICTED: vam6/Vps39-like protein-like          72.4    4e-12   Cicer arietinum [garbanzo]
ref|XP_003537587.1|  PREDICTED: vam6/Vps39-like protein-like          69.3    4e-11   Glycine max [soybeans]
gb|KHN41977.1|  Vam6/Vps39-like protein                               69.3    5e-11   Glycine soja [wild soybean]
ref|XP_003611995.1|  Vam6/Vps39-like protein                          67.0    2e-10   
ref|XP_006858768.1|  hypothetical protein AMTR_s00066p00149360        65.5    9e-10   Amborella trichopoda
ref|XP_002973518.1|  hypothetical protein SELMODRAFT_149115           58.9    1e-07   
ref|XP_002975550.1|  hypothetical protein SELMODRAFT_442906           55.5    2e-06   Selaginella moellendorffii



>ref|XP_009619069.1| PREDICTED: vam6/Vps39-like protein [Nicotiana tomentosiformis]
Length=1004

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LLN+CPTKIDA+ESYGSNL I CSDGSLRVY PES  SD+S  S+FH  T
Sbjct  1    MVHSAYDSFELLNNCPTKIDAIESYGSNLLIACSDGSLRVYGPESAVSDQSPPSDFHSQT  60

Query  247  SELRKERYVLERTVNGFSKR  306
              L +ERYVLER+VNGFS+R
Sbjct  61   LGLHQERYVLERSVNGFSRR  80



>ref|XP_009777137.1| PREDICTED: vam6/Vps39-like protein [Nicotiana sylvestris]
Length=1004

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LLN+CPTKIDA+ESYGSNL I CSDGSLRVY PES  SD+S  S+FH  T
Sbjct  1    MVHSAYDSFELLNNCPTKIDAIESYGSNLLIACSDGSLRVYGPESAVSDQSPPSDFHSQT  60

Query  247  SELRKERYVLERTVNGFSKR  306
              L +ERYVLER+VNGFS+R
Sbjct  61   LGLHQERYVLERSVNGFSRR  80



>ref|XP_004243182.1| PREDICTED: vam6/Vps39-like protein [Solanum lycopersicum]
Length=1004

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LLN CPTKIDAVESYGSNL + CSDGSLRVY PES+   +S  +++H+  
Sbjct  1    MVHSAYDSFELLNSCPTKIDAVESYGSNLLVACSDGSLRVYGPESSVPGQSPPADYHNQN  60

Query  247  SELRKERYVLERTVNGFSKR  306
              L++ERYVLERTVNGFS+R
Sbjct  61   LGLQQERYVLERTVNGFSRR  80



>ref|XP_006348372.1| PREDICTED: vam6/Vps39-like protein-like [Solanum tuberosum]
Length=1004

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LLN CPTKIDA+ESYGSNL + CSDGSL VY PES+   +S  S++H+  
Sbjct  1    MVHSAYDSFELLNSCPTKIDAIESYGSNLLVACSDGSLHVYGPESSVPGQSPPSDYHNQN  60

Query  247  SELRKERYVLERTVNGFSKR  306
              L++ERYVLERTVNGFS+R
Sbjct  61   LGLQQERYVLERTVNGFSRR  80



>ref|XP_011003738.1| PREDICTED: vam6/Vps39-like protein [Populus euphratica]
Length=1008

 Score =   119 bits (299),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL DCP KIDA+E+YGS L I CSDG+LR+Y P S  SD+S  S++H H 
Sbjct  1    MVHNAYDSFELLTDCPNKIDAIEAYGSKLLIACSDGALRIYAPVSAISDKSPPSDYHKHG  60

Query  247  SELRKERYVLERTVNGFSKR  306
             +LRKE+Y LERTVNGFSK+
Sbjct  61   DQLRKEQYSLERTVNGFSKK  80



>ref|XP_006383195.1| hypothetical protein POPTR_0005s12470g [Populus trichocarpa]
 gb|ERP60992.1| hypothetical protein POPTR_0005s12470g [Populus trichocarpa]
Length=1008

 Score =   118 bits (295),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL +CP KIDA+ESYGS L I CSDG+LR+Y P S  SD+S  S++H+H 
Sbjct  1    MVHNAYDSFELLTNCPNKIDAIESYGSKLLIACSDGALRIYAPVSAISDKSPPSDYHNHG  60

Query  247  SELRKERYVLERTVNGFSKR  306
             +LRKE Y LERTVNGFSK+
Sbjct  61   DQLRKEPYSLERTVNGFSKK  80



>ref|XP_011025779.1| PREDICTED: vam6/Vps39-like protein [Populus euphratica]
 ref|XP_011025780.1| PREDICTED: vam6/Vps39-like protein [Populus euphratica]
 ref|XP_011025781.1| PREDICTED: vam6/Vps39-like protein [Populus euphratica]
Length=1001

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL + P KIDA+ESYGS L + CSDG+LR+Y PEST SD+S   ++H+H 
Sbjct  1    MVHNAYDSFELLTNSPDKIDAIESYGSKLLVACSDGALRIYAPESTISDKSPPLDYHNHG  60

Query  247  SELRKERYVLERTVNGFSKR  306
             +LRKE Y LERTVNGFSK+
Sbjct  61   DQLRKEPYALERTVNGFSKK  80



>gb|KDP38604.1| hypothetical protein JCGZ_05311 [Jatropha curcas]
Length=1001

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 62/81 (77%), Gaps = 5/81 (6%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL  CPT+IDAVESYGS L + CSDG+LR+Y P     DRS+ S++H   
Sbjct  1    MVHSAYDSFELLRGCPTRIDAVESYGSKLLVGCSDGALRIYGP-----DRSSLSDYHGQA  55

Query  247  SELRKERYVLERTVNGFSKRA  309
             EL+KE Y LERTVNGFSKRA
Sbjct  56   QELKKETYALERTVNGFSKRA  76



>ref|XP_002310230.2| hypothetical protein POPTR_0007s12810g [Populus trichocarpa]
 gb|EEE90680.2| hypothetical protein POPTR_0007s12810g [Populus trichocarpa]
Length=953

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL + P KIDA+ESY S L + CSDG+LR+Y PEST SD+S   ++H+H 
Sbjct  1    MVHNAYDSFELLTNSPNKIDAIESYCSKLLVACSDGALRIYAPESTISDKSPPLDYHNHG  60

Query  247  SELRKERYVLERTVNGFSKR  306
             +LRKE Y LERTVNGFSK+
Sbjct  61   DQLRKEPYALERTVNGFSKK  80



>gb|KJB43502.1| hypothetical protein B456_007G203400 [Gossypium raimondii]
 gb|KJB43503.1| hypothetical protein B456_007G203400 [Gossypium raimondii]
Length=1000

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL DCPTKIDA+ESYGS L + CSDGSLR+YV +S+ +DRS  S+ H   
Sbjct  1    MVHSAYDSFQLLTDCPTKIDAIESYGSKLLLGCSDGSLRIYVSDSSGADRSPPSDPH---  57

Query  247  SELRKERYVLERTVNGFSKR  306
              LRKE Y LERTV GFSK+
Sbjct  58   -ALRKEPYALERTVAGFSKK  76



>ref|XP_007048414.1| Vacuolar sorting protein 39 isoform 1 [Theobroma cacao]
 gb|EOX92571.1| Vacuolar sorting protein 39 isoform 1 [Theobroma cacao]
Length=998

 Score =   110 bits (276),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 63/81 (78%), Gaps = 4/81 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYD F LLNDCPTKIDA+ESYGS L + CSDGSLR+Y P+S+ +DRS  S+ H   
Sbjct  1    MVHSAYDYFELLNDCPTKIDAIESYGSKLLLGCSDGSLRIYGPDSSGADRSPPSDQH---  57

Query  247  SELRKERYVLERTVNGFSKRA  309
              LRKE Y LERTV GFSK+A
Sbjct  58   -ALRKEPYALERTVEGFSKKA  77



>ref|XP_008367954.1| PREDICTED: vam6/Vps39-like protein [Malus domestica]
Length=346

 Score =   107 bits (268),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L+ DC TKI+A+ESYG  L + CSDGSL++Y P+S+ SDRS  S++H H 
Sbjct  1    MVHSAYDSFELIGDCXTKIEAIESYGPKLLLGCSDGSLKIYAPDSSGSDRSPPSDYHAH-  59

Query  247  SELRKERYVLERTVNGFSKR  306
             +L+KE Y LER V GFSK+
Sbjct  60   -KLQKEPYALERNVAGFSKK  78



>gb|KHG02853.1| Vam6/Vps39-like protein [Gossypium arboreum]
Length=956

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L+ DCPTKIDA+ESYGS L + CSDGSLR+YV +S+ +DRS  S+ H   
Sbjct  1    MVHSAYDSFQLITDCPTKIDAIESYGSKLLLGCSDGSLRIYVSDSSGADRSPPSDPH---  57

Query  247  SELRKERYVLERTVNGFSKR  306
              LRKE Y LERTV GFSK+
Sbjct  58   -ALRKEPYALERTVAGFSKK  76



>ref|XP_002267514.1| PREDICTED: vam6/Vps39-like protein [Vitis vinifera]
Length=1006

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LLN+CPT+I+ +ESYG+ LF+ CSDGSLR+Y PES   DRS  S+   + 
Sbjct  1    MVHSAYDSFELLNNCPTRIETIESYGAKLFLGCSDGSLRIYGPESFSFDRSPPSD--PNA  58

Query  247  SELRKERYVLERTVNGFSKR  306
             ELRKE YVLERTV GFSK+
Sbjct  59   LELRKEPYVLERTVTGFSKK  78



>ref|XP_004232411.1| PREDICTED: vam6/Vps39-like protein isoform X2 [Solanum lycopersicum]
Length=1001

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 3/80 (4%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYD+F LLN+ P+KIDA+ESY SNL I CSDGSLRVYVPES+ SD+   S+FH  T
Sbjct  1    MVHTAYDTFQLLNNSPSKIDAIESYRSNLLIACSDGSLRVYVPESSVSDQ---SDFHSET  57

Query  247  SELRKERYVLERTVNGFSKR  306
              L +  YVLERT+NGFS+R
Sbjct  58   LGLHQGPYVLERTLNGFSRR  77



>ref|XP_010316369.1| PREDICTED: vam6/Vps39-like protein isoform X1 [Solanum lycopersicum]
Length=1019

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 3/80 (4%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYD+F LLN+ P+KIDA+ESY SNL I CSDGSLRVYVPES+ SD+   S+FH  T
Sbjct  1    MVHTAYDTFQLLNNSPSKIDAIESYRSNLLIACSDGSLRVYVPESSVSDQ---SDFHSET  57

Query  247  SELRKERYVLERTVNGFSKR  306
              L +  YVLERT+NGFS+R
Sbjct  58   LGLHQGPYVLERTLNGFSRR  77



>ref|XP_008344274.1| PREDICTED: vam6/Vps39-like protein [Malus domestica]
Length=1004

 Score =   109 bits (273),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L++DCPTKI+A+ESYG  L I CSDGSL++Y P+S+ SDRS  S++H H 
Sbjct  1    MVHSAYDSFELISDCPTKIEAIESYGPKLLIGCSDGSLKIYAPDSSGSDRSPPSDYHGH-  59

Query  247  SELRKERYVLERTVNGFSKR  306
             +L+KE Y LER V GFSK+
Sbjct  60   -KLQKEPYALERNVAGFSKK  78



>ref|XP_009340752.1| PREDICTED: vam6/Vps39-like protein [Pyrus x bretschneideri]
Length=1004

 Score =   108 bits (270),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L+++CPTKI+A+ESYG  L I CSDGSL++Y P+S+ SDRS  S++H H 
Sbjct  1    MVHSAYDSFELISNCPTKIEAIESYGLKLLISCSDGSLKIYAPDSSCSDRSPPSDYHRH-  59

Query  247  SELRKERYVLERTVNGFSKR  306
             +L+KE+Y LER V GFSK+
Sbjct  60   -KLQKEQYALERNVAGFSKK  78



>ref|XP_006340626.1| PREDICTED: vam6/Vps39-like protein-like [Solanum tuberosum]
Length=1001

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 3/80 (4%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYD+F  LN+ P+KIDA+ESY SNL I CSDGSLRVYVPES+ SD+   S+FH  T
Sbjct  1    MVHTAYDTFQFLNNSPSKIDAIESYRSNLLIACSDGSLRVYVPESSVSDQ---SDFHSET  57

Query  247  SELRKERYVLERTVNGFSKR  306
              L +  YVLERT+NGFS+R
Sbjct  58   LGLHQGPYVLERTLNGFSRR  77



>ref|XP_009347535.1| PREDICTED: vam6/Vps39-like protein [Pyrus x bretschneideri]
Length=1004

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L++DCPTKI+A+ESYG  L I CSDGSL++Y P+S+ SDRS  S++  H 
Sbjct  1    MVHSAYDSFELISDCPTKIEAIESYGPKLLIGCSDGSLKIYAPDSSGSDRSPPSDYQRH-  59

Query  247  SELRKERYVLERTVNGFSKR  306
             +L+KE+Y LER V GFSK+
Sbjct  60   -KLQKEQYALERNVAGFSKK  78



>gb|KJB43501.1| hypothetical protein B456_007G203400 [Gossypium raimondii]
Length=936

 Score =   107 bits (268),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL DCPTKIDA+ESYGS L + CSDGSLR+YV +S+ +DRS  S+ H   
Sbjct  1    MVHSAYDSFQLLTDCPTKIDAIESYGSKLLLGCSDGSLRIYVSDSSGADRSPPSDPH---  57

Query  247  SELRKERYVLERTVNGFSKR  306
              LRKE Y LERTV GFSK+
Sbjct  58   -ALRKEPYALERTVAGFSKK  76



>ref|XP_011099610.1| PREDICTED: vam6/Vps39-like protein [Sesamum indicum]
Length=1006

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDR---STASEFH  237
            MVHSAYDSF LL +  T+IDA+ESY S L + CSDGSLR+Y PES+  D    S+ +EFH
Sbjct  1    MVHSAYDSFQLLANSSTRIDAIESYASTLLLSCSDGSLRIYAPESSAGDHRSPSSPAEFH  60

Query  238  HHTSELRKERYVLERTVNGFSKR  306
                EL+KE YVLERT+NGFSK+
Sbjct  61   SQALELKKEPYVLERTINGFSKK  83



>emb|CAN61039.1| hypothetical protein VITISV_018673 [Vitis vinifera]
Length=1941

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LLN+CPT+I+ +ESYG+ LF+ CSDGSL +Y PES   DRS  S+   + 
Sbjct  1    MVHSAYDSFELLNNCPTRIETIESYGAKLFLGCSDGSLXIYGPESFSFDRSPPSD--PNA  58

Query  247  SELRKERYVLERTVNGFSKR  306
             ELRKE YVLERTV GFSK+
Sbjct  59   LELRKEPYVLERTVTGFSKK  78



>ref|XP_009371595.1| PREDICTED: vam6/Vps39-like protein [Pyrus x bretschneideri]
Length=1004

 Score =   106 bits (265),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L+ DCPTKI+A+ESYG  L + CSDGSL++Y P+S+ SDR+  S++H H 
Sbjct  1    MVHSAYDSFELIGDCPTKIEAIESYGPKLLLGCSDGSLKIYAPDSSGSDRTPPSDYHAH-  59

Query  247  SELRKERYVLERTVNGFSKR  306
             +L+KE Y LER V GFSK+
Sbjct  60   -KLQKEPYALERNVAGFSKK  78



>ref|XP_002521595.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40866.1| conserved hypothetical protein [Ricinus communis]
Length=972

 Score =   106 bits (264),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL+ CPTKIDA+ESYGS L + CSDGSLR+Y PES+ S+R   S++   +
Sbjct  1    MVHSAYDSFELLSRCPTKIDAIESYGSKLLVGCSDGSLRIYGPESSVSER---SDYLGQS  57

Query  247  SELRKERYVLERTVNGFSKRA  309
             ELR+E Y+LERTV GFSK+ 
Sbjct  58   QELRRECYLLERTVTGFSKKG  78



>gb|EYU40165.1| hypothetical protein MIMGU_mgv1a000716mg [Erythranthe guttata]
Length=1008

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 61/84 (73%), Gaps = 3/84 (4%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDR---STASEFH  237
            MVHSAYDSF L+ +   +IDAVESYGS L + CSDGSLR+Y PES+ SD       SEFH
Sbjct  1    MVHSAYDSFQLVTNSTARIDAVESYGSALLLSCSDGSLRIYAPESSPSDHRSPPPPSEFH  60

Query  238  HHTSELRKERYVLERTVNGFSKRA  309
                EL+KE YVLERT+NGFS++ 
Sbjct  61   SQALELKKEPYVLERTINGFSRKP  84



>ref|XP_007046945.1| Vacuolar sorting protein 39 [Theobroma cacao]
 gb|EOX91102.1| Vacuolar sorting protein 39 [Theobroma cacao]
Length=919

 Score =   105 bits (263),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL+DCPTKIDA+ESYGS L + CSDGSLR+Y P+S+ +DRS   + H   
Sbjct  1    MVHSAYDSFELLHDCPTKIDAIESYGSKLLLGCSDGSLRIYGPDSSGADRSPPIDQH---  57

Query  247  SELRKERYVLERTVNGFSKRA  309
              LRKE Y LERTV  FSK+A
Sbjct  58   -ALRKEPYALERTVARFSKKA  77



>ref|XP_006411980.1| hypothetical protein EUTSA_v10024305mg [Eutrema salsugineum]
 gb|ESQ53433.1| hypothetical protein EUTSA_v10024305mg [Eutrema salsugineum]
Length=1002

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 57/80 (71%), Gaps = 7/80 (9%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL DCP +IDAVESYGS LF  C DGSLR+Y PES+ SDRS  SE H  +
Sbjct  1    MVHNAYDSFQLLKDCPARIDAVESYGSKLFAGCYDGSLRIYSPESSASDRSLPSELHQQS  60

Query  247  SELRKERYVLERTVNGFSKR  306
                   YVLE TV GFSK+
Sbjct  61   -------YVLETTVAGFSKK  73



>ref|XP_010263662.1| PREDICTED: vam6/Vps39-like protein [Nelumbo nucifera]
 ref|XP_010263664.1| PREDICTED: vam6/Vps39-like protein [Nelumbo nucifera]
Length=1004

 Score =   104 bits (259),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LLN+CP+KI+ V SY S L + C+DG +R++VPES+ SDRS  S+  +  
Sbjct  1    MVHSAYDSFELLNNCPSKIETVGSYSSKLLLGCTDGCIRIFVPESSASDRSPPSDRLYLN  60

Query  247  SELRKERYVLERTVNGFSKR  306
             E+RKE YVLERT+ GFSK+
Sbjct  61   PEMRKEPYVLERTITGFSKK  80



>ref|XP_004149149.1| PREDICTED: vam6/Vps39-like protein-like [Cucumis sativus]
Length=996

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL D P+KI+++ESYGS LFI CSDGSLR+Y P S+ SDRS+AS+FH  +
Sbjct  1    MVHSAYDSFELLKDNPSKIESIESYGSKLFIGCSDGSLRIYSPNSSASDRSSASDFHSRS  60

Query  247  SELRKERYVLERTVNGFSKRA  309
            +EL++E+YVLE+ V+GFS+R+
Sbjct  61   TELQQEQYVLEKNVSGFSRRS  81



>gb|KGN53245.1| hypothetical protein Csa_4G038630 [Cucumis sativus]
Length=970

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL D P+KI+++ESYGS LFI CSDGSLR+Y P S+ SDRS+AS+FH  +
Sbjct  1    MVHSAYDSFELLKDNPSKIESIESYGSKLFIGCSDGSLRIYSPNSSASDRSSASDFHSRS  60

Query  247  SELRKERYVLERTVNGFSKRA  309
            +EL++E+YVLE+ V+GFS+R+
Sbjct  61   TELQQEQYVLEKNVSGFSRRS  81



>ref|XP_004165852.1| PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-like protein-like 
[Cucumis sativus]
Length=996

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL D P+KI+++ESYGS LFI CSDGSLR+Y P S+ SDRS+AS+FH  +
Sbjct  1    MVHSAYDSFELLKDNPSKIESIESYGSKLFIGCSDGSLRIYSPNSSASDRSSASDFHSRS  60

Query  247  SELRKERYVLERTVNGFSKRA  309
            +EL++E YVLE+ V+GFS+R+
Sbjct  61   TELQQEPYVLEKNVSGFSRRS  81



>gb|KHG17162.1| Vam6/Vps39-like protein [Gossypium arboreum]
Length=940

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF L+N+CPTKIDAVESYGS L + CSDGSLR+Y P+S+ +D+S    F   T
Sbjct  1    MVHNAYDSFKLINNCPTKIDAVESYGSKLLVGCSDGSLRIYGPDSSIADQSPP--FDPLT  58

Query  247  SELRKERYVLERTVNGFSKRA  309
              LRK+ Y LERTV  FSK+A
Sbjct  59   --LRKKPYALERTVEWFSKKA  77



>ref|XP_008453745.1| PREDICTED: vam6/Vps39-like protein [Cucumis melo]
Length=997

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL D P+KI+++ESYGS L I CSDGSLR+Y P S+ SDRS++S+FH  +
Sbjct  1    MVHSAYDSFELLKDNPSKIESIESYGSKLLIGCSDGSLRIYSPNSSASDRSSSSDFHPRS  60

Query  247  SELRKERYVLERTVNGFSKRA  309
            +EL+KE YVLE+ V+GFS+R+
Sbjct  61   TELQKEPYVLEKNVSGFSRRS  81



>emb|CDO99043.1| unnamed protein product [Coffea canephora]
Length=1007

 Score =   100 bits (249),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 6/84 (7%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRS----TASEF  234
            MVHSAYD+F L+++ P KIDA+ESYGSNL + CSDGSLR+Y PES+ S  S    T+S+F
Sbjct  1    MVHSAYDTFQLVHNSPIKIDAIESYGSNLLLACSDGSLRIYGPESSSSPTSDRSPTSSDF  60

Query  235  HHHTSELRKERYVLERTVNGFSKR  306
            H H  EL+KE Y L+R++NGFSK+
Sbjct  61   HPH--ELKKEAYALDRSINGFSKK  82



>ref|XP_010548331.1| PREDICTED: vam6/Vps39-like protein [Tarenaya hassleriana]
Length=1000

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 7/80 (9%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL DCP +IDA+ESYGS +F  C DGSLR+Y PE++ SDR          
Sbjct  1    MVHSAYDSFQLLKDCPARIDALESYGSKIFAGCYDGSLRIYAPETSASDR-------FPP  53

Query  247  SELRKERYVLERTVNGFSKR  306
             EL+K+ YVL++TV GFS+R
Sbjct  54   LELQKQPYVLDKTVVGFSRR  73



>ref|XP_010679721.1| PREDICTED: vam6/Vps39-like protein [Beta vulgaris subsp. vulgaris]
Length=1005

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L++D PTKIDAVESYGS L + CSDGSLRVY  ES+ S+ S  S+ H   
Sbjct  1    MVHSAYDSFELVSDFPTKIDAVESYGSKLLLGCSDGSLRVYASESSGSEASLPSDHHAFQ  60

Query  247  SELRKERYVLERTVNGFSKR  306
             EL KE Y LERT+NGFS+R
Sbjct  61   LELTKEPYSLERTINGFSRR  80



>gb|KJB17778.1| hypothetical protein B456_003G015100 [Gossypium raimondii]
Length=983

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH AYDSF L+N+CPTKIDAVESYGS L + CSDGSLR+Y P+S+ +D+S   +    +
Sbjct  1    MVHGAYDSFELINNCPTKIDAVESYGSKLLVGCSDGSLRIYGPDSSIADQSPPFD----S  56

Query  247  SELRKERYVLERTVNGFSKRA  309
              LRK+ Y LERTV  FSK+A
Sbjct  57   LALRKKPYALERTVAWFSKKA  77



>ref|NP_195381.6| protein EMBRYO DEFECTIVE 2754 [Arabidopsis thaliana]
 gb|AAM20730.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86679.1| vacuolar sorting protein 39 [Arabidopsis thaliana]
Length=1000

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 57/81 (70%), Gaps = 11/81 (14%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVY-VPESTRSDRSTASEFHHH  243
            MVH+AYDSF LL DCP +IDAVESYGS LF  C DGSLR+Y  PES+ SD          
Sbjct  1    MVHNAYDSFQLLKDCPARIDAVESYGSKLFAGCYDGSLRIYSPPESSASD----------  50

Query  244  TSELRKERYVLERTVNGFSKR  306
             SEL +E YVLE+TV GFSK+
Sbjct  51   PSELHQETYVLEKTVAGFSKK  71



>emb|CAB16830.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80329.1| hypothetical protein [Arabidopsis thaliana]
Length=1003

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 57/81 (70%), Gaps = 11/81 (14%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVY-VPESTRSDRSTASEFHHH  243
            MVH+AYDSF LL DCP +IDAVESYGS LF  C DGSLR+Y  PES+ SD          
Sbjct  1    MVHNAYDSFQLLKDCPARIDAVESYGSKLFAGCYDGSLRIYSPPESSASD----------  50

Query  244  TSELRKERYVLERTVNGFSKR  306
             SEL +E YVLE+TV GFSK+
Sbjct  51   PSELHQETYVLEKTVAGFSKK  71



>gb|EPS66254.1| hypothetical protein M569_08522, partial [Genlisea aurea]
Length=315

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 62/83 (75%), Gaps = 3/83 (4%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSD-RSTASEFHHH  243
            MVHSAYDS  L+ +  +KI+A+ESYGS L + CSDGSLR+Y P+S+  D RS ++E   +
Sbjct  2    MVHSAYDSAELVGNSSSKINAIESYGSTLLLSCSDGSLRIYGPKSSAGDGRSLSTEVEVY  61

Query  244  TSE--LRKERYVLERTVNGFSKR  306
            + E  LRK  YVL+RT+NGFSKR
Sbjct  62   SEEPVLRKGPYVLQRTINGFSKR  84



>ref|XP_010432158.1| PREDICTED: vam6/Vps39-like protein [Camelina sativa]
Length=1000

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 57/81 (70%), Gaps = 11/81 (14%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVY-VPESTRSDRSTASEFHHH  243
            MVH+AYDSF LL DCP +IDAVESYGS LF  C DGSLR+Y  PES+ SD          
Sbjct  1    MVHNAYDSFQLLKDCPARIDAVESYGSKLFAGCYDGSLRIYSPPESSASD----------  50

Query  244  TSELRKERYVLERTVNGFSKR  306
             SEL +E YVLE TV+GFSK+
Sbjct  51   PSELHQETYVLETTVSGFSKK  71



>ref|XP_010437326.1| PREDICTED: vam6/Vps39-like protein [Camelina sativa]
Length=999

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 57/81 (70%), Gaps = 11/81 (14%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVY-VPESTRSDRSTASEFHHH  243
            MVH+AYDSF LL DCP +IDAVESYGS LF  C DGSLR+Y  PES+ SD          
Sbjct  1    MVHNAYDSFQLLKDCPARIDAVESYGSKLFAGCYDGSLRIYSPPESSASD----------  50

Query  244  TSELRKERYVLERTVNGFSKR  306
             SEL +E YVLE TV+GFSK+
Sbjct  51   PSELHQETYVLETTVSGFSKK  71



>ref|XP_004287898.1| PREDICTED: vam6/Vps39-like protein [Fragaria vesca subsp. vesca]
Length=1005

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDS  L++DCPTKI+A+ SYG  L + CSDGSL++Y P+S+ S RS  S++H  +
Sbjct  1    MVHSAYDSVELISDCPTKIEAISSYGPKLLLGCSDGSLKIYAPDSSGS-RSPPSDYHSQS  59

Query  247  SELRKERYVLERTVNGFSKR  306
              L+KE Y LER + GFSK+
Sbjct  60   --LQKEPYSLERNLAGFSKK  77



>gb|KDO79546.1| hypothetical protein CISIN_1g0018511mg, partial [Citrus sinensis]
 gb|KDO79547.1| hypothetical protein CISIN_1g0018511mg, partial [Citrus sinensis]
Length=343

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 4/80 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+A+DS  L+++C  KIDAV SYG  + + CSDGSL++Y P S+ SDRS  S++    
Sbjct  1    MVHNAFDSLELISNCSPKIDAVASYGLKILLGCSDGSLKIYSPGSSESDRSPPSDYQ---  57

Query  247  SELRKERYVLERTVNGFSKR  306
              LRKE Y LERT++GFSK+
Sbjct  58   -SLRKESYELERTISGFSKK  76



>ref|XP_006283063.1| hypothetical protein CARUB_v10004058mg [Capsella rubella]
 gb|EOA15961.1| hypothetical protein CARUB_v10004058mg [Capsella rubella]
Length=1000

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 56/81 (69%), Gaps = 11/81 (14%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVY-VPESTRSDRSTASEFHHH  243
            MVH+AYDSF LL DCP +IDAVESYGS LF  C DGSLR+Y  PES+ SD          
Sbjct  1    MVHNAYDSFQLLKDCPARIDAVESYGSKLFAGCYDGSLRIYSPPESSTSD----------  50

Query  244  TSELRKERYVLERTVNGFSKR  306
             SEL +E YVLE TV GFSK+
Sbjct  51   PSELHQETYVLETTVAGFSKK  71



>ref|XP_010089006.1| Vam6/Vps39-like protein [Morus notabilis]
 gb|EXB37233.1| Vam6/Vps39-like protein [Morus notabilis]
Length=1019

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH AYDSF LL DCPTKI+++E+YG  L + CSDGSLR+Y PES+ SD S AS++H   
Sbjct  1    MVHGAYDSFELLRDCPTKIESIEAYGQKLLLGCSDGSLRIYAPESSGSDSSPASDYHSQA  60

Query  247  SELRKERYVLERTVNGFSKR  306
             E RKE YVL R + GFS++
Sbjct  61   LEHRKEPYVLVRNMVGFSRK  80



>ref|XP_002867003.1| hypothetical protein ARALYDRAFT_490975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43262.1| hypothetical protein ARALYDRAFT_490975 [Arabidopsis lyrata subsp. 
lyrata]
Length=1000

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 56/81 (69%), Gaps = 11/81 (14%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVY-VPESTRSDRSTASEFHHH  243
            MVH+AYDSF LL DCP +IDAVESYGS LF  C DGSLR+Y  PES+ SD          
Sbjct  1    MVHNAYDSFQLLKDCPARIDAVESYGSKLFAGCYDGSLRIYSPPESSASD----------  50

Query  244  TSELRKERYVLERTVNGFSKR  306
             SEL +E +VLE TV GFSK+
Sbjct  51   PSELHQETFVLETTVAGFSKK  71



>ref|XP_010446769.1| PREDICTED: vam6/Vps39-like protein [Camelina sativa]
Length=1000

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 56/81 (69%), Gaps = 11/81 (14%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVP-ESTRSDRSTASEFHHH  243
            MVH+AYD F LL DCP +IDAVESYGS LF  C DGSLR+Y P ES+ SD          
Sbjct  1    MVHNAYDLFQLLKDCPARIDAVESYGSKLFAGCFDGSLRIYSPSESSASD----------  50

Query  244  TSELRKERYVLERTVNGFSKR  306
             SEL +E YVLE TV+GFSK+
Sbjct  51   PSELHQETYVLETTVSGFSKK  71



>ref|XP_004509257.1| PREDICTED: vam6/Vps39-like protein-like isoform X1 [Cicer arietinum]
Length=1028

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 8/80 (10%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL +CP+KI+++ESYGS + + C+DGSL +Y PES RS  +T  E     
Sbjct  1    MVHSAYDSFELLTNCPSKIESIESYGSKILLGCTDGSLLIYAPESERS--ATVPE-----  53

Query  247  SELRKERYVLERTVNGFSKR  306
             E+RKE Y LER++ GF++R
Sbjct  54   -EMRKEAYSLERSLKGFARR  72



>ref|XP_004509258.1| PREDICTED: vam6/Vps39-like protein-like isoform X2 [Cicer arietinum]
Length=993

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 8/80 (10%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF LL +CP+KI+++ESYGS + + C+DGSL +Y PES RS  +T  E     
Sbjct  1    MVHSAYDSFELLTNCPSKIESIESYGSKILLGCTDGSLLIYAPESERS--ATVPE-----  53

Query  247  SELRKERYVLERTVNGFSKR  306
             E+RKE Y LER++ GF++R
Sbjct  54   -EMRKEAYSLERSLKGFARR  72



>ref|XP_006425673.1| hypothetical protein CICLE_v10024797mg [Citrus clementina]
 gb|ESR38913.1| hypothetical protein CICLE_v10024797mg [Citrus clementina]
Length=971

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 4/80 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+A+DS  L+++C  KIDAV SYG  + + CSDGSL++Y P S+ SDRS  S++    
Sbjct  1    MVHNAFDSLELISNCSPKIDAVASYGLKILLGCSDGSLKIYSPGSSESDRSPPSDYQ---  57

Query  247  SELRKERYVLERTVNGFSKR  306
              LRKE Y LERT++GFSK+
Sbjct  58   -SLRKESYELERTISGFSKK  76



>ref|XP_006425674.1| hypothetical protein CICLE_v10024797mg [Citrus clementina]
 ref|XP_006466791.1| PREDICTED: vam6/Vps39-like protein-like [Citrus sinensis]
 gb|ESR38914.1| hypothetical protein CICLE_v10024797mg [Citrus clementina]
Length=1004

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 4/80 (5%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+A+DS  L+++C  KIDAV SYG  + + CSDGSL++Y P S+ SDRS  S++    
Sbjct  1    MVHNAFDSLELISNCSPKIDAVASYGLKILLGCSDGSLKIYSPGSSESDRSPPSDYQ---  57

Query  247  SELRKERYVLERTVNGFSKR  306
              LRKE Y LERT++GFSK+
Sbjct  58   -SLRKESYELERTISGFSKK  76



>ref|XP_008775839.1| PREDICTED: LOW QUALITY PROTEIN: vam6/Vps39-like protein [Phoenix 
dactylifera]
Length=997

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 53/82 (65%), Gaps = 6/82 (7%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRS--DRSTASEFHH  240
            MVHSAYDS  LL  CP +I+AV SYGS L + CSDGSLR+Y P S  +  D    S    
Sbjct  1    MVHSAYDSVELLKGCPARIEAVASYGSKLLLGCSDGSLRIYAPSSAPAVGDDGPLSP---  57

Query  241  HTSELRKERYVLERTVNGFSKR  306
               E+R+E Y+LERTV GF KR
Sbjct  58   -DPEIRREPYILERTVTGFWKR  78



>ref|XP_007203223.1| hypothetical protein PRUPE_ppa000769mg [Prunus persica]
 gb|EMJ04422.1| hypothetical protein PRUPE_ppa000769mg [Prunus persica]
Length=1009

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L++DCPTKI+A+ESYG  L + CSDGSL++Y P+S+ SDRS  S++H H 
Sbjct  1    MVHSAYDSFELISDCPTKIEAIESYGPKLLLGCSDGSLKIYAPDSSSSDRSPPSDYHAH-  59

Query  247  SELRKERYVLERTVNGFSKR  306
             +L +E Y LER ++GFSK+
Sbjct  60   -KLHQEPYALERNLSGFSKK  78



>emb|CDY42696.1| BnaA03g53490D [Brassica napus]
Length=993

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 13/80 (16%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL +CP +IDAVES+ S LF  C DGSLR+Y P+S              +
Sbjct  1    MVHNAYDSFQLLTNCPARIDAVESHNSKLFAGCYDGSLRIYSPQSP-------------S  47

Query  247  SELRKERYVLERTVNGFSKR  306
            SELR++ Y+LE TV GFSK+
Sbjct  48   SELRQDSYLLETTVTGFSKK  67



>ref|XP_009138434.1| PREDICTED: vam6/Vps39-like protein [Brassica rapa]
Length=993

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 13/80 (16%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL +CP +IDAVES+ S LF  C DGSLR+Y P+S              +
Sbjct  1    MVHNAYDSFQLLTNCPARIDAVESHNSKLFAGCYDGSLRIYSPQSP-------------S  47

Query  247  SELRKERYVLERTVNGFSKR  306
            SELR++ Y+LE TV GFSK+
Sbjct  48   SELRQDSYLLETTVTGFSKK  67



>gb|KFK30284.1| hypothetical protein AALP_AA7G241500 [Arabis alpina]
Length=1000

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 10/80 (13%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDS+ LLNDCP +IDAVESY S LF+ C DGSLR+Y          + S     +
Sbjct  1    MVHNAYDSYQLLNDCPVQIDAVESYNSKLFVGCYDGSLRIY----------SPSSSPSSS  50

Query  247  SELRKERYVLERTVNGFSKR  306
            SEL +E YVLE TV+GFSK+
Sbjct  51   SELHQESYVLETTVSGFSKK  70



>ref|XP_008241674.1| PREDICTED: vam6/Vps39-like protein [Prunus mume]
Length=1009

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L++DCPTKI+A+E+YG  L + CSDGSL++Y P+S+ SDRS  S++H H 
Sbjct  1    MVHSAYDSFELISDCPTKIEAIEAYGPKLLLGCSDGSLKIYAPDSSSSDRSPPSDYHAH-  59

Query  247  SELRKERYVLERTVNGFSKR  306
             +L +E Y LER ++GFSK+
Sbjct  60   -KLHQEPYALERNLSGFSKK  78



>ref|XP_010916252.1| PREDICTED: vam6/Vps39-like protein isoform X1 [Elaeis guineensis]
Length=997

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRS--DRSTASEFHH  240
            MVHSAYDS  LL  CP +I+AV SYGS + + CSDGSLR+Y P S  +  D    S    
Sbjct  1    MVHSAYDSVELLKGCPARIEAVASYGSKILLGCSDGSLRIYAPSSALAAGDDGPLSP---  57

Query  241  HTSELRKERYVLERTVNGFSKRA  309
                +R+E Y+LERTV GF KRA
Sbjct  58   -NPGIRREPYILERTVTGFWKRA  79



>ref|XP_010916253.1| PREDICTED: vam6/Vps39-like protein isoform X2 [Elaeis guineensis]
Length=852

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRS--DRSTASEFHH  240
            MVHSAYDS  LL  CP +I+AV SYGS + + CSDGSLR+Y P S  +  D    S    
Sbjct  1    MVHSAYDSVELLKGCPARIEAVASYGSKILLGCSDGSLRIYAPSSALAAGDDGPLSP---  57

Query  241  HTSELRKERYVLERTVNGFSKRA  309
                +R+E Y+LERTV GF KRA
Sbjct  58   -NPGIRREPYILERTVTGFWKRA  79



>gb|AET03930.2| vam6/Vps39-like protein [Medicago truncatula]
Length=992

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 10/81 (12%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL +  +KI+++ESYGS L + CS+GSL VY PE +      A E     
Sbjct  1    MVHTAYDSFELLTNSTSKIESIESYGSKLLLGCSNGSLLVYAPEHS----VPAPE-----  51

Query  247  SELRKERYVLERTVNGFSKRA  309
             E+RKE YVLER VNGF+K+A
Sbjct  52   -EMRKEAYVLERNVNGFAKKA  71



>ref|XP_003629454.1| Tubby-like F-box protein [Medicago truncatula]
Length=1399

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 10/81 (12%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL +  +KI+++ESYGS L + CS+GSL VY PE +      A E     
Sbjct  1    MVHTAYDSFELLTNSTSKIESIESYGSKLLLGCSNGSLLVYAPEHS----VPAPE-----  51

Query  247  SELRKERYVLERTVNGFSKRA  309
             E+RKE YVLER VNGF+K+A
Sbjct  52   -EMRKEAYVLERNVNGFAKKA  71



>ref|XP_009409101.1| PREDICTED: vam6/Vps39-like protein [Musa acuminata subsp. malaccensis]
Length=1006

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRS------DRSTAS  228
            MVHSAYDS  LL  CP +IDA  +YGS L + CSD SLR+Y P S               
Sbjct  1    MVHSAYDSVELLKGCPVRIDAAAAYGSKLLLGCSDASLRIYAPSSAPPAPLASGGGGGDD  60

Query  229  EFHHHTSELRKERYVLERTVNGFSKRA  309
                   E+R+E Y+ ERTV+GF KRA
Sbjct  61   GPPPPDVEIRREPYLPERTVSGFWKRA  87



>emb|CDX72591.1| BnaC07g46130D [Brassica napus]
Length=997

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 9/80 (11%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDSF LL +CP +IDAVES+ S LF  C DGSLR+Y         S  S     +
Sbjct  1    MVHNAYDSFQLLTNCPARIDAVESHNSKLFAGCYDGSLRIY---------SPQSPSSSSS  51

Query  247  SELRKERYVLERTVNGFSKR  306
             ELR++ Y+LE TV GF+K+
Sbjct  52   DELRQDSYLLETTVTGFAKK  71



>ref|XP_010258480.1| PREDICTED: vam6/Vps39-like protein isoform X1 [Nelumbo nucifera]
Length=1003

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+A+DSF LL +CP KI+   SYGS L + C+DGS+R+Y PES+ S    +S      
Sbjct  1    MVHNAFDSFQLLRNCPAKIECAASYGSKLLLSCTDGSIRIYAPESSTSSDGHSSPPDRGK  60

Query  247  SELRKERYVLERTVNGFSKR  306
            + + +E YVLE+ V GF K+
Sbjct  61   AGILREPYVLEKAVMGFWKK  80



>ref|XP_010258481.1| PREDICTED: vam6/Vps39-like protein isoform X2 [Nelumbo nucifera]
Length=975

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+A+DSF LL +CP KI+   SYGS L + C+DGS+R+Y PES+ S    +S      
Sbjct  1    MVHNAFDSFQLLRNCPAKIECAASYGSKLLLSCTDGSIRIYAPESSTSSDGHSSPPDRGK  60

Query  247  SELRKERYVLERTVNGFSKR  306
            + + +E YVLE+ V GF K+
Sbjct  61   AGILREPYVLEKAVMGFWKK  80



>ref|XP_007156942.1| hypothetical protein PHAVU_002G030300g [Phaseolus vulgaris]
 gb|ESW28936.1| hypothetical protein PHAVU_002G030300g [Phaseolus vulgaris]
Length=989

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 13/80 (16%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYD   L+ +CP KI+++ESYGS L + CSDGSLR++ PE+  S   + S      
Sbjct  1    MVHSAYDCVELVRECPAKIESIESYGSKLLLGCSDGSLRIFAPETESSSDGSNS------  54

Query  247  SELRKERYVLERTVNGFSKR  306
                   Y LER + GF+K+
Sbjct  55   -------YALERNIVGFAKK  67



>ref|XP_003517237.2| PREDICTED: vam6/Vps39-like protein-like [Glycine max]
Length=1015

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 13/80 (16%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYD   L+ +CP KI+++ESYGS L + CSDGSLR++ PE+  S   + S      
Sbjct  27   MVHSAYDCLELVRECPAKIESIESYGSKLLVGCSDGSLRIFAPETESSSDGSKS------  80

Query  247  SELRKERYVLERTVNGFSKR  306
                   Y LE+ + GF+K+
Sbjct  81   -------YALEKNLAGFAKK  93



>gb|KHN36129.1| Vam6/Vps39-like protein [Glycine soja]
Length=945

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 13/80 (16%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYD   L+ +CP KI+++ESYGS L + CSDGSLR++ PE+  S   + S      
Sbjct  1    MVHSAYDCLELVRECPAKIESIESYGSKLLVGCSDGSLRIFAPETESSSDGSKS------  54

Query  247  SELRKERYVLERTVNGFSKR  306
                   Y LE+ + GF+K+
Sbjct  55   -------YALEKNLAGFAKK  67



>ref|XP_010070055.1| PREDICTED: vam6/Vps39-like protein [Eucalyptus grandis]
 gb|KCW58609.1| hypothetical protein EUGRSUZ_H01269 [Eucalyptus grandis]
Length=1017

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 53/89 (60%), Gaps = 9/89 (10%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVY---------VPESTRSDRS  219
            MVH+AYDSF LL+DCP +I+AVES  S + + CSDGSLR+Y               SDRS
Sbjct  1    MVHNAYDSFELLSDCPARIEAVESSASKILLGCSDGSLRIYGPDPSSSSSSSPPPPSDRS  60

Query  220  TASEFHHHTSELRKERYVLERTVNGFSKR  306
                     +ELRKE Y L R V GF+KR
Sbjct  61   APPSSSDSRAELRKEPYALHRHVAGFTKR  89



>ref|XP_004512043.1| PREDICTED: vam6/Vps39-like protein-like [Cicer arietinum]
Length=980

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 50/80 (63%), Gaps = 14/80 (18%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYD   L+ D   KI+A+ESYGSNL +  SDGSLR+Y PE+  SDRS         
Sbjct  1    MVHSAYDCLQLIPDSNGKIEAIESYGSNLLLGYSDGSLRIYSPETESSDRS---------  51

Query  247  SELRKERYVLERTVNGFSKR  306
                 + YVLE+ + GF+K+
Sbjct  52   -----KPYVLEKNLVGFTKK  66



>ref|XP_003537587.1| PREDICTED: vam6/Vps39-like protein-like [Glycine max]
Length=989

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 12/81 (15%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYD   L+ +CP KI+++ESY S L + CSDGSLR++ PE+  S  + +       
Sbjct  1    MVHSAYDCLELVRECPAKIESIESYDSKLLVGCSDGSLRIFAPETESSSSNGSK------  54

Query  247  SELRKERYVLERTVNGFSKRA  309
                   Y LE+ + GF+K++
Sbjct  55   ------SYALEKNLAGFAKKS  69



>gb|KHN41977.1| Vam6/Vps39-like protein [Glycine soja]
Length=988

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 12/81 (15%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYD   L+ +CP KI+++ESY S L + CSDGSLR++ PE+  S  + +       
Sbjct  1    MVHSAYDCLELVRECPAKIESIESYDSKLLVGCSDGSLRIFAPETESSSSNGSK------  54

Query  247  SELRKERYVLERTVNGFSKRA  309
                   Y LE+ + GF+K++
Sbjct  55   ------SYALEKNLAGFAKKS  69



>ref|XP_003611995.1| Vam6/Vps39-like protein [Medicago truncatula]
 gb|AES94953.1| vam6/Vps39-like protein [Medicago truncatula]
Length=899

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 14/80 (18%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVHSAYDSF L+ +   KI+++ESYG  L + CSDGSLR+Y PE+  SD S         
Sbjct  1    MVHSAYDSFELVPNFNGKIESIESYGPKLLLGCSDGSLRIYSPETEFSDHSKP-------  53

Query  247  SELRKERYVLERTVNGFSKR  306
                   Y LE+ +  F+K+
Sbjct  54   -------YTLEKNLVNFAKK  66



>ref|XP_006858768.1| hypothetical protein AMTR_s00066p00149360 [Amborella trichopoda]
 gb|ERN20235.1| hypothetical protein AMTR_s00066p00149360 [Amborella trichopoda]
Length=1009

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAVESYGSNLFIVCSDGSLRVYVPESTRSDRSTASEFHHHT  246
            MVH+AYDS  L+ DCP+ ++ V  + S L I C D SLR+Y P    S  S +++     
Sbjct  1    MVHNAYDSLQLIKDCPSTVECVGLWDSKLLISCIDCSLRIYAPPPESSQPSISNDPPSSR  60

Query  247  SELRKERYVLERTVNGFSKRA  309
            + +    Y LER+++GFS++ 
Sbjct  61   AGVAGTPYALERSISGFSRKG  81



>ref|XP_002973518.1| hypothetical protein SELMODRAFT_149115 [Selaginella moellendorffii]
 gb|EFJ25178.1| hypothetical protein SELMODRAFT_149115 [Selaginella moellendorffii]
Length=974

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 51/87 (59%), Gaps = 14/87 (16%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAV-----ESYGSNLFIVCSDGSLRVY-VPESTRSDRSTAS  228
            MVH+A+D   ++ DCP++I++       + G  L + C DGSLR+Y +P+S++ +    +
Sbjct  1    MVHNAFDDVCVVRDCPSRIESAIVTESGTRGEFLHVGCIDGSLRIYSLPDSSQDEEDLGA  60

Query  229  EFHHHTSELRKERYVLERTVNGFSKRA  309
            E        R   YVL RT+ GF+K+A
Sbjct  61   E--------RSRSYVLRRTIVGFAKKA  79



>ref|XP_002975550.1| hypothetical protein SELMODRAFT_442906 [Selaginella moellendorffii]
 gb|EFJ23179.1| hypothetical protein SELMODRAFT_442906 [Selaginella moellendorffii]
Length=962

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 14/87 (16%)
 Frame = +1

Query  67   MVHSAYDSFVLLNDCPTKIDAV-----ESYGSNLFIVCSDGSLRVY-VPESTRSDRSTAS  228
            MVH+A+D   ++ DCP++I++       + G  L + C DGSLR+Y +P+S++ +    +
Sbjct  1    MVHNAFDDVCVVRDCPSRIESAIVTESSTRGEFLHVGCIDGSLRIYSLPDSSQDEEDLGA  60

Query  229  EFHHHTSELRKERYVLERTVNGFSKRA  309
            E        R    VL RT+ GF+K+A
Sbjct  61   E--------RSRSCVLRRTIVGFAKKA  79



Lambda      K        H        a         alpha
   0.316    0.126    0.352    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558850726180