BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005D19

Length=504
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AEX26931.1|  squalene synthase 1-3                                   211   1e-66   Solanum tuberosum [potatoes]
ref|XP_009759256.1|  PREDICTED: squalene synthase-like                  219   2e-66   Nicotiana sylvestris
ref|XP_009594336.1|  PREDICTED: squalene synthase-like                  219   2e-66   Nicotiana tomentosiformis
gb|AAB02945.1|  squalene synthase                                       216   3e-65   Nicotiana tabacum [American tobacco]
dbj|BAA82093.1|  squalene synthase                                      216   3e-65   Solanum tuberosum [potatoes]
gb|AGB05603.1|  squalene synthase                                       216   3e-65   Camellia oleifera [abura-tsubaki]
gb|AEX26930.1|  squalene synthase 1-2                                   216   4e-65   Solanum tuberosum [potatoes]
gb|AAD20626.1|  squalene synthase                                       216   4e-65   Capsicum annuum
gb|AFR77735.1|  squalene synthase                                       216   4e-65   Camellia oleifera [abura-tsubaki]
ref|XP_006362006.1|  PREDICTED: squalene synthase-like isoform X1       216   5e-65   Solanum tuberosum [potatoes]
gb|AEX26932.1|  squalene synthase                                       216   5e-65   Solanum chacoense
ref|NP_001234716.1|  squalene synthase                                  216   7e-65   
ref|NP_001236365.1|  squalene synthase                                  216   7e-65   
gb|AGS57530.1|  squalene synthase                                       216   7e-65   Solanum nigrum
gb|AAM27472.1|  squalene synthase                                       211   1e-64   Nicotiana tabacum [American tobacco]
gb|AAB08578.1|  squalene synthase                                       215   1e-64   Nicotiana tabacum [American tobacco]
gb|AEX26929.1|  squalene synthase 1-1                                   215   1e-64   Solanum tuberosum [potatoes]
ref|XP_008236983.1|  PREDICTED: squalene synthase-like                  214   2e-64   Prunus mume [ume]
gb|KDP41726.1|  hypothetical protein JCGZ_26744                         214   2e-64   Jatropha curcas
ref|XP_006591920.1|  PREDICTED: squalene synthase isoform X2            214   3e-64   
ref|XP_009631700.1|  PREDICTED: squalene synthase                       214   4e-64   Nicotiana tomentosiformis
ref|XP_009802568.1|  PREDICTED: squalene synthase                       213   6e-64   Nicotiana sylvestris
ref|XP_006360639.1|  PREDICTED: squalene synthase-like                  213   6e-64   
gb|ADW27427.1|  squalene synthase                                       213   6e-64   Astragalus membranaceus
gb|ADG36717.1|  squalene synthase 2                                     213   6e-64   Glycyrrhiza uralensis [Chinese licorice]
emb|CAJ77655.1|  squalene synthase 2                                    213   6e-64   Glycyrrhiza eurycarpa
gb|ACS66749.1|  squalene synthase                                       213   6e-64   Glycyrrhiza uralensis [Chinese licorice]
gb|ACT52825.1|  squalene synthase 2                                     213   6e-64   Glycyrrhiza uralensis [Chinese licorice]
emb|CDP20866.1|  unnamed protein product                                213   7e-64   Coffea canephora [robusta coffee]
gb|ADV57358.1|  squalene synthase                                       213   7e-64   Astragalus membranaceus
ref|XP_006591919.1|  PREDICTED: squalene synthase isoform X1            214   7e-64   
gb|ADG36719.1|  squalene synthase 2                                     213   7e-64   Glycyrrhiza uralensis [Chinese licorice]
dbj|BAH23428.1|  squalene synthetase                                    213   8e-64   Euphorbia tirucalli
emb|CAJ77653.1|  squalene synthase 2                                    213   8e-64   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_011047507.1|  PREDICTED: squalene synthase isoform X2            211   9e-64   Populus euphratica
dbj|BAC56854.1|  squalene synthase                                      213   1e-63   Lotus japonicus
gb|ACN69082.1|  squalene synthase                                       212   1e-63   Diospyros kaki [Japanese persimmon]
ref|XP_003537842.1|  PREDICTED: squalene synthase-like isoform X1       212   1e-63   Glycine max [soybeans]
ref|XP_011047498.1|  PREDICTED: squalene synthase isoform X1            212   2e-63   Populus euphratica
gb|AEA41713.1|  squalene synthase                                       212   2e-63   Eleutherococcus senticosus
gb|AEA41712.1|  squalene synthase                                       212   2e-63   Eleutherococcus senticosus
gb|ADD54645.1|  squalene synthase                                       211   3e-63   Bruguiera gymnorhiza [Burma mangrove]
gb|AHA84150.1|  squalene synthase                                       211   3e-63   Phaseolus vulgaris [French bean]
ref|XP_009376518.1|  PREDICTED: squalene synthase-like                  211   4e-63   Pyrus x bretschneideri [bai li]
gb|AFI33135.3|  squalene synthase                                       211   4e-63   Eriobotrya japonica [loquat]
gb|KDO43896.1|  hypothetical protein CISIN_1g015087mg                   207   4e-63   Citrus sinensis [apfelsine]
ref|XP_002512982.1|  farnesyl-diphosphate farnesyltransferase, pu...    211   5e-63   
ref|XP_011088477.1|  PREDICTED: squalene synthase-like                  211   5e-63   Sesamum indicum [beniseed]
ref|XP_011458278.1|  PREDICTED: squalene synthase-like isoform X2       211   5e-63   Fragaria vesca subsp. vesca
ref|XP_004290304.1|  PREDICTED: squalene synthase-like isoform X1       211   5e-63   Fragaria vesca subsp. vesca
gb|AGS78117.1|  squalene synthase 1                                     211   6e-63   Malus domestica [apple tree]
gb|KDO43895.1|  hypothetical protein CISIN_1g015087mg                   209   6e-63   Citrus sinensis [apfelsine]
sp|P53800.1|FDFT_NICBE  RecName: Full=Squalene synthase; Short=SQ...    211   6e-63   Nicotiana benthamiana
ref|XP_010066209.1|  PREDICTED: squalene synthase                       210   7e-63   Eucalyptus grandis [rose gum]
ref|XP_006487314.1|  PREDICTED: squalene synthase isoform X1            210   8e-63   
ref|XP_004248691.1|  PREDICTED: squalene synthase-like                  210   8e-63   Solanum lycopersicum
ref|XP_002266150.1|  PREDICTED: squalene synthase                       210   9e-63   Vitis vinifera
gb|KDO43893.1|  hypothetical protein CISIN_1g015087mg                   209   9e-63   Citrus sinensis [apfelsine]
gb|ADC95435.1|  squalene synthase                                       210   9e-63   Withania somnifera [ashwagandha]
gb|KDO43892.1|  hypothetical protein CISIN_1g015087mg                   209   1e-62   Citrus sinensis [apfelsine]
gb|ADG36706.1|  squalene synthase 1                                     210   1e-62   Glycyrrhiza uralensis [Chinese licorice]
emb|CAN81937.1|  hypothetical protein VITISV_028001                     210   1e-62   Vitis vinifera
gb|AER23670.1|  squalene synthase                                       209   1e-62   Eleutherococcus senticosus
gb|ACU21003.1|  unknown                                                 209   2e-62   Glycine max [soybeans]
ref|XP_004150142.1|  PREDICTED: squalene synthase-like                  209   2e-62   
gb|AFK29283.1|  putative squalene synthase 1                            209   2e-62   Salvia miltiorrhiza [Chinese salvia]
dbj|BAA13084.1|  squalene synthase                                      209   2e-62   Glycyrrhiza glabra
emb|CAJ77652.1|  squalene synthase 1                                    209   2e-62   Glycyrrhiza uralensis [Chinese licorice]
emb|CAD23250.1|  farnesyl-diphosphate farnesyltransferase               209   3e-62   Medicago truncatula
gb|ACR57219.1|  squalene synthase                                       209   3e-62   Salvia miltiorrhiza [Chinese salvia]
gb|ADG36711.1|  squalene synthase 1                                     209   3e-62   Glycyrrhiza uralensis [Chinese licorice]
gb|ADX01171.1|  putative squalene synthase                              209   3e-62   Bacopa monnieri
gb|AFZ93644.1|  squalene synthetase                                     208   4e-62   Euphorbia lathyris
ref|NP_001280921.1|  squalene synthase-like                             208   5e-62   Malus domestica [apple tree]
gb|AED99863.1|  squalene synthase                                       208   5e-62   Panax quinquefolius
gb|ABA29019.1|  squalene synthase                                       208   5e-62   Panax notoginseng [san-qi]
ref|XP_007199882.1|  hypothetical protein PRUPE_ppa006420mg             208   5e-62   
gb|ACS66750.1|  squalene synthase                                       208   5e-62   Glycyrrhiza uralensis [Chinese licorice]
gb|AGI19256.1|  squalene synthase                                       208   5e-62   Panax notoginseng [san-qi]
gb|ADG36704.1|  squalene synthase 1                                     208   6e-62   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36703.1|  squalene synthase 1                                     208   6e-62   Glycyrrhiza uralensis [Chinese licorice]
emb|CAJ58418.1|  squalene synthase                                      208   6e-62   Panax quinquefolius
gb|ACV88718.1|  squalene synthase                                       208   6e-62   Panax ginseng [Asiatic ginseng]
gb|AAV58897.1|  squalene synthase                                       208   6e-62   Centella asiatica [Asiatic pennywort]
gb|ADG36709.1|  squalene synthase 1                                     208   7e-62   Glycyrrhiza uralensis [Chinese licorice]
gb|ADC32654.1|  squalene synthase                                       208   7e-62   Aralia elata
gb|AIK21786.1|  squalene synthase                                       208   7e-62   Panax notoginseng [san-qi]
gb|ADG36705.1|  squalene synthase 1                                     208   7e-62   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36702.1|  squalene synthase 1                                     208   7e-62   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_007131767.1|  hypothetical protein PHAVU_011G040100g             207   7e-62   Phaseolus vulgaris [French bean]
gb|ADG36708.1|  squalene synthase 1                                     207   8e-62   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_003607040.1|  Squalene synthase                                  208   8e-62   
ref|XP_006423442.1|  hypothetical protein CICLE_v10028537mg             207   1e-61   
ref|XP_009378420.1|  PREDICTED: squalene synthase-like                  207   1e-61   Pyrus x bretschneideri [bai li]
ref|XP_011037190.1|  PREDICTED: squalene synthase-like                  207   1e-61   Populus euphratica
dbj|BAA24289.1|  squalene synthase                                      207   1e-61   Panax ginseng [Asiatic ginseng]
ref|XP_010526913.1|  PREDICTED: squalene synthase-like                  207   2e-61   
gb|ACA66014.1|  squalene synthase                                       207   2e-61   Panax ginseng [Asiatic ginseng]
gb|ADG36701.1|  squalene synthase 1                                     206   2e-61   Glycyrrhiza uralensis [Chinese licorice]
gb|AEM42980.1|  squalene synthase                                       206   2e-61   Siraitia grosvenorii [arhat fruit]
gb|KHG01756.1|  Squalene synthase                                       206   3e-61   Gossypium arboreum [tree cotton]
gb|ACT52826.1|  squalene synthase 1                                     206   3e-61   Glycyrrhiza uralensis [Chinese licorice]
gb|ACQ90302.1|  squalene synthase                                       206   3e-61   Gynostemma pentaphyllum [jiaogulan]
gb|ADG36707.1|  squalene synthase 1                                     206   3e-61   Glycyrrhiza uralensis [Chinese licorice]
gb|ADG36699.1|  squalene synthase 1                                     206   3e-61   Glycyrrhiza uralensis [Chinese licorice]
ref|XP_010263865.1|  PREDICTED: squalene synthase-like                  206   4e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010548076.1|  PREDICTED: squalene synthase-like isoform X2       206   4e-61   Tarenaya hassleriana [spider flower]
dbj|BAA13083.1|  squalene synthase                                      206   4e-61   Glycyrrhiza glabra
ref|XP_010548075.1|  PREDICTED: squalene synthase-like isoform X1       206   5e-61   Tarenaya hassleriana [spider flower]
gb|ACX42425.1|  squalene synthase                                       206   5e-61   Bupleurum chinense
gb|ACX42426.1|  squalene synthase                                       206   5e-61   Bupleurum chinense
ref|XP_010109768.1|  hypothetical protein L484_008444                   205   6e-61   Morus notabilis
ref|XP_008461009.1|  PREDICTED: squalene synthase-like                  206   6e-61   Cucumis melo [Oriental melon]
gb|ACX42423.1|  squalene synthase                                       205   7e-61   Bupleurum chinense
gb|KJB12171.1|  hypothetical protein B456_002G004400                    205   8e-61   Gossypium raimondii
gb|AAY46017.1|  squalene synthase                                       205   8e-61   Bupleurum falcatum
gb|AFT92039.1|  squalene synthase                                       205   8e-61   Euphorbia pekinensis
gb|AFK36923.1|  unknown                                                 205   8e-61   Medicago truncatula
gb|EYU37849.1|  hypothetical protein MIMGU_mgv1a007228mg                203   8e-61   Erythranthe guttata [common monkey flower]
gb|KJB12166.1|  hypothetical protein B456_002G004400                    205   9e-61   Gossypium raimondii
emb|CAJ77654.1|  squalene synthase 1                                    205   1e-60   Glycyrrhiza eurycarpa
ref|XP_004507500.1|  PREDICTED: squalene synthase-like                  205   1e-60   Cicer arietinum [garbanzo]
gb|KJB12169.1|  hypothetical protein B456_002G004400                    205   1e-60   Gossypium raimondii
gb|EYU37850.1|  hypothetical protein MIMGU_mgv1a007228mg                204   2e-60   Erythranthe guttata [common monkey flower]
gb|AFK29284.1|  putative squalene synthase 2                            203   4e-60   Salvia miltiorrhiza [Chinese salvia]
gb|ACZ71037.1|  squalene synthase                                       203   4e-60   Panax ginseng [Asiatic ginseng]
gb|ACX42424.1|  squalene synthase                                       203   4e-60   Bupleurum chinense
gb|ADW78251.1|  squalene synthase                                       203   4e-60   Withania somnifera [ashwagandha]
gb|ABG66304.1|  squalene synthase                                       203   6e-60   Polygala tenuifolia [Chinese senega-root]
gb|EYU42585.1|  hypothetical protein MIMGU_mgv1a007225mg                202   7e-60   Erythranthe guttata [common monkey flower]
emb|CAJ58419.1|  squalene synthase                                      202   2e-59   Panax quinquefolius
gb|AFN61199.1|  squalene synthase                                       201   2e-59   Chlorophytum borivilianum
ref|XP_011092839.1|  PREDICTED: squalene synthase-like                  201   2e-59   Sesamum indicum [beniseed]
ref|XP_007042047.1|  Squalene synthase 1 isoform 1                      201   3e-59   
ref|XP_002313765.1|  squalene synthase family protein                   201   4e-59   Populus trichocarpa [western balsam poplar]
ref|XP_010039888.1|  PREDICTED: squalene synthase-like isoform X2       201   5e-59   Eucalyptus grandis [rose gum]
gb|KJB32574.1|  hypothetical protein B456_005G247700                    200   5e-59   Gossypium raimondii
ref|XP_002305455.2|  hypothetical protein POPTR_0004s16830g             202   6e-59   
ref|XP_010039880.1|  PREDICTED: squalene synthase-like isoform X1       200   9e-59   Eucalyptus grandis [rose gum]
ref|XP_010690774.1|  PREDICTED: squalene synthase-like                  198   3e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_195190.1|  Squalene synthase 1                                   198   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AAG14896.2|AF302464_1  squalene synthase                             198   5e-58   Artemisia annua [sweet Annie]
gb|ABQ96265.1|  squalene synthase                                       198   5e-58   Psammosilene tunicoides
gb|AAR20329.1|  squalene synthase                                       198   6e-58   Artemisia annua [sweet Annie]
gb|ABX10442.1|  squalene synthase 2                                     197   8e-58   Gossypium hirsutum [American cotton]
gb|KHG07441.1|  Squalene synthase                                       197   1e-57   Gossypium arboreum [tree cotton]
ref|XP_006412201.1|  hypothetical protein EUTSA_v10025338mg             196   3e-57   Eutrema salsugineum [saltwater cress]
ref|XP_010437579.1|  PREDICTED: squalene synthase-like isoform X1       195   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010447048.1|  PREDICTED: squalene synthase-like                  195   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010432389.1|  PREDICTED: squalene synthase                       195   5e-57   Camelina sativa [gold-of-pleasure]
gb|AAR20328.1|  squalene synthase                                       195   5e-57   Artemisia annua [sweet Annie]
ref|XP_010437580.1|  PREDICTED: squalene synthase-like isoform X2       195   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002869133.1|  hypothetical protein ARALYDRAFT_912921             195   6e-57   Arabidopsis lyrata subsp. lyrata
gb|AIX97193.1|  squalene synthase                                       194   1e-56   Matricaria chamomilla var. recutita [German chamomile]
gb|KFK30097.1|  hypothetical protein AALP_AA7G216600                    194   1e-56   Arabis alpina [alpine rockcress]
ref|XP_009108714.1|  PREDICTED: squalene synthase-like isoform X1       193   2e-56   Brassica rapa
gb|EPS74249.1|  hypothetical protein M569_00507                         190   2e-56   Genlisea aurea
ref|XP_006283828.1|  hypothetical protein CARUB_v10004929mg             193   2e-56   Capsella rubella
ref|XP_010934354.1|  PREDICTED: squalene synthase-like                  193   3e-56   Elaeis guineensis
ref|XP_009110610.1|  PREDICTED: squalene synthase                       192   5e-56   
gb|AGW25489.1|  squalene synthase                                       192   6e-56   Paris polyphylla var. yunnanensis
ref|XP_009138312.1|  PREDICTED: squalene synthase-like                  192   8e-56   Brassica rapa
gb|KHN25422.1|  Squalene synthase                                       192   9e-56   Glycine soja [wild soybean]
ref|XP_008796682.1|  PREDICTED: squalene synthase-like isoform X3       191   1e-55   
ref|XP_009760451.1|  PREDICTED: squalene synthase-like                  191   2e-55   Nicotiana sylvestris
ref|XP_008796681.1|  PREDICTED: squalene synthase-like isoform X2       190   4e-55   Phoenix dactylifera
ref|XP_008796678.1|  PREDICTED: squalene synthase-like isoform X1       190   4e-55   Phoenix dactylifera
ref|XP_010690775.1|  PREDICTED: squalene synthase-like                  189   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006412200.1|  hypothetical protein EUTSA_v10025392mg             188   2e-54   
ref|XP_008795798.1|  PREDICTED: squalene synthase-like isoform X2       187   3e-54   
gb|AFY63035.1|  squalene synthase                                       188   3e-54   Alisma plantago-aquatica subsp. orientale
ref|XP_009389044.1|  PREDICTED: squalene synthase-like                  186   9e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795796.1|  PREDICTED: squalene synthase-like isoform X1       186   1e-53   Phoenix dactylifera
gb|AGI56082.1|  squalene synthase                                       186   2e-53   Dendrobium officinale
gb|AHB20141.2|  squalene synthase                                       185   3e-53   Fritillaria thunbergii
ref|XP_010447047.1|  PREDICTED: squalene synthase-like                  186   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009396917.1|  PREDICTED: squalene synthase-like                  185   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010025621.1|  PREDICTED: squalene synthase-like                  185   4e-53   Eucalyptus grandis [rose gum]
ref|XP_006285747.1|  hypothetical protein CARUB_v10007220mg             184   7e-53   Capsella rubella
emb|CDX72493.1|  BnaC07g45150D                                          184   9e-53   
ref|XP_010432387.1|  PREDICTED: squalene synthase-like                  184   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006841632.1|  hypothetical protein AMTR_s00003p00232080          183   2e-52   Amborella trichopoda
emb|CDY17472.1|  BnaC03g65910D                                          183   2e-52   Brassica napus [oilseed rape]
ref|XP_002869132.1|  squalene synthase 2                                183   3e-52   
gb|AAB61927.1|  squalene synthase 2                                     182   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437578.1|  PREDICTED: squalene synthase-like isoform X2       182   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010437577.1|  PREDICTED: squalene synthase-like isoform X1       182   4e-52   Camelina sativa [gold-of-pleasure]
ref|NP_195191.2|  squalene synthase 2                                   182   5e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72494.1|  BnaC07g45160D                                          181   6e-52   
gb|KJB32578.1|  hypothetical protein B456_005G247700                    182   6e-52   Gossypium raimondii
gb|AGN32410.1|  squalene synthase                                       181   8e-52   Dioscorea zingiberensis
ref|XP_009591242.1|  PREDICTED: squalene synthase-like                  177   1e-51   
emb|CDY45322.1|  BnaA03g52950D                                          181   2e-51   Brassica napus [oilseed rape]
emb|CDY45323.1|  BnaA03g52960D                                          175   2e-51   Brassica napus [oilseed rape]
emb|CDX69076.1|  BnaC01g03770D                                          181   2e-51   
gb|KFK30098.1|  hypothetical protein AALP_AA7G216700                    180   2e-51   Arabis alpina [alpine rockcress]
ref|XP_009110500.1|  PREDICTED: squalene synthase                       180   4e-51   Brassica rapa
gb|AAY22201.1|  squalene synthase                                       178   7e-51   Datura inoxia [downy thornapple]
ref|XP_006651930.1|  PREDICTED: squalene synthase-like                  179   9e-51   Oryza brachyantha
emb|CDX75451.1|  BnaA01g02510D                                          179   1e-50   
gb|ACI14294.1|  squalene synthase                                       175   1e-50   Linum usitatissimum
ref|NP_001051625.1|  Os03g0805100                                       177   4e-50   
gb|EEE60131.1|  hypothetical protein OsJ_13016                          177   4e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010065915.1|  PREDICTED: squalene synthase-like                  174   4e-49   Eucalyptus grandis [rose gum]
ref|XP_002466259.1|  hypothetical protein SORBIDRAFT_01g004550          174   4e-49   Sorghum bicolor [broomcorn]
ref|NP_001104839.1|  squalene synthase1                                 173   1e-48   Zea mays [maize]
ref|NP_001130502.1|  uncharacterized protein LOC100191601               172   2e-48   
tpg|DAA52014.1|  TPA: hypothetical protein ZEAMMB73_299336              172   2e-48   
gb|ABI14439.1|  squalene synthase                                       169   4e-47   Taxus cuspidata [ichii]
emb|CDX75450.1|  BnaA01g02520D                                          166   7e-46   
emb|CDX76294.1|  BnaA08g11060D                                          165   1e-45   
emb|CDX69075.1|  BnaC01g03780D                                          164   3e-45   
ref|XP_001775898.1|  predicted protein                                  164   3e-45   
gb|AFJ15526.1|  squalene synthase                                       164   3e-45   Azadirachta indica [Indian-lilac]
ref|XP_010025618.1|  PREDICTED: squalene synthase-like                  163   8e-45   Eucalyptus grandis [rose gum]
gb|AHI96421.1|  squalene synthase                                       162   2e-44   Pinus massoniana [Chinese red pine]
ref|XP_006351382.1|  PREDICTED: squalene synthase-like                  162   2e-44   
dbj|BAJ87710.1|  predicted protein                                      160   9e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001773253.1|  predicted protein                                  157   2e-43   
gb|ABK24732.1|  unknown                                                 159   2e-43   Picea sitchensis
ref|XP_003564211.1|  PREDICTED: squalene synthase-like                  158   4e-43   Brachypodium distachyon [annual false brome]
ref|XP_006351216.1|  PREDICTED: squalene synthase-like                  156   3e-42   Solanum tuberosum [potatoes]
ref|XP_010312074.1|  PREDICTED: squalene synthase-like isoform X2       155   3e-42   
ref|XP_004249733.1|  PREDICTED: squalene synthase-like isoform X1       155   7e-42   Solanum lycopersicum
emb|CDM86349.1|  unnamed protein product                                150   2e-40   Triticum aestivum [Canadian hard winter wheat]
gb|AEX58673.1|  squalene synthase                                       151   3e-40   Huperzia serrata [toothed club-moss]
ref|NP_001059129.1|  Os07g0200700                                       149   2e-39   
gb|AIW04729.1|  squalene synthase                                       147   1e-38   Dryopteris fragrans
ref|XP_003559279.1|  PREDICTED: squalene synthase-like                  146   1e-38   Brachypodium distachyon [annual false brome]
ref|XP_004986173.1|  PREDICTED: squalene synthase-like                  138   3e-38   
ref|XP_005851990.1|  hypothetical protein CHLNCDRAFT_18492              142   4e-38   Chlorella variabilis
gb|ACF35716.1|  squalene synthase 1                                     135   2e-37   Glycyrrhiza uralensis [Chinese licorice]
gb|ACF35714.1|  squalene synthase 1                                     134   2e-37   Glycyrrhiza uralensis [Chinese licorice]
gb|EMT23370.1|  Squalene synthetase                                     141   1e-36   
ref|XP_011004277.1|  PREDICTED: squalene synthase-like                  134   3e-36   Populus euphratica
gb|EMT03383.1|  Squalene synthetase                                     139   1e-35   
ref|XP_001417488.1|  predicted protein                                  139   1e-35   Ostreococcus lucimarinus CCE9901
ref|XP_003058046.1|  predicted protein                                  139   1e-35   Micromonas pusilla CCMP1545
ref|XP_011395550.1|  Squalene synthase                                  139   1e-35   Auxenochlorella protothecoides
ref|XP_007512409.1|  squalene synthase                                  139   2e-35   Bathycoccus prasinos
ref|XP_007042048.1|  Squalene synthase 1 isoform 2                      135   5e-35   
ref|XP_005651444.1|  farnesyl-diphosphate farnesyltransferase           135   8e-35   Coccomyxa subellipsoidea C-169
ref|XP_001756673.1|  predicted protein                                  135   2e-34   
ref|XP_003078740.1|  FDFT_NICBE Farnesyl-diphosphate farnesyltran...    128   3e-33   
ref|XP_002946755.1|  hypothetical protein VOLCADRAFT_79344              131   6e-33   Volvox carteri f. nagariensis
ref|XP_001703447.1|  farnesyl-diphosphate farnesyltransferase           130   1e-32   Chlamydomonas reinhardtii
emb|CEF97547.1|  Squalene/phytoene synthase                             128   7e-32   Ostreococcus tauri
ref|XP_002501456.1|  predicted protein                                  128   1e-31   Micromonas commoda
ref|XP_009769885.1|  PREDICTED: squalene synthase-like                  126   3e-31   Nicotiana sylvestris
gb|KIZ04121.1|  farnesyl-diphosphatefarnesyltransferase                 125   1e-30   Monoraphidium neglectum
gb|KDD74507.1|  squalene/phytoene synthase                              122   6e-30   Helicosporidium sp. ATCC 50920
ref|XP_008351286.1|  PREDICTED: squalene synthase-like                  116   9e-30   Malus domestica [apple tree]
sp|G0Y287.1|BOSS_BOTBR  RecName: Full=Botryococcus squalene synth...    122   1e-29   Botryococcus braunii
gb|KCW84806.1|  hypothetical protein EUGRSUZ_B01607                     111   4e-28   Eucalyptus grandis [rose gum]
emb|CAN64028.1|  hypothetical protein VITISV_030715                     114   2e-27   Vitis vinifera
sp|Q9SDW9.1|BSS_BOTBR  RecName: Full=Squalene synthase                  114   1e-26   Botryococcus braunii
ref|XP_002971951.1|  hypothetical protein SELMODRAFT_96714              114   1e-26   
ref|XP_007099547.1|  Squalene synthase 1-like protein                   107   3e-25   
gb|AAI68496.1|  Unknown (protein for MGC:173117)                        108   1e-24   Xenopus tropicalis [western clawed frog]
ref|NP_001135642.2|  farnesyl-diphosphate farnesyltransferase 1         108   1e-24   
ref|XP_005837525.1|  farnesyl-diphosphate farnesyltransferase           109   1e-24   Guillardia theta CCMP2712
ref|XP_005146462.1|  PREDICTED: squalene synthase                       104   2e-23   Melopsittacus undulatus
ref|XP_009560856.1|  PREDICTED: squalene synthase isoform X1            103   4e-23   Cuculus canorus
ref|XP_009560858.1|  PREDICTED: squalene synthase isoform X2            103   4e-23   Cuculus canorus
gb|KJE94382.1|  farnesyl-diphosphate farnesyltransferase 1              103   4e-23   Capsaspora owczarzaki ATCC 30864
sp|G0Y288.1|BOCS_BOTBR  RecName: Full=Botryococcene synthase; Alt...    103   5e-23   Botryococcus braunii
ref|XP_004346713.1|  farnesyl-diphosphate farnesyltransferase 1         103   7e-23   Capsaspora owczarzaki ATCC 30864
gb|ESA03184.1|  hypothetical protein GLOINDRAFT_619                     103   8e-23   
ref|XP_005075330.1|  PREDICTED: squalene synthase                       102   2e-22   Mesocricetus auratus [Syrian golden hamster]
ref|NP_001161120.1|  squalene synthase                                  102   2e-22   Sus scrofa [pigs]
ref|NP_001034383.1|  squalene synthase                                  102   2e-22   Gallus gallus [bantam]
gb|ESL10210.1|  farnesyltransferase                                     101   2e-22   Trypanosoma rangeli SC58
ref|XP_007429056.1|  PREDICTED: squalene synthase isoform X4            101   2e-22   
ref|XP_006774849.1|  PREDICTED: squalene synthase isoform X2            101   2e-22   Myotis davidii
ref|XP_006423443.1|  hypothetical protein CICLE_v10028537mg             101   2e-22   
ref|XP_007128199.1|  PREDICTED: squalene synthase isoform X2            101   2e-22   
ref|XP_003498025.1|  PREDICTED: squalene synthase isoform X2            101   3e-22   Cricetulus griseus [Chinese hamsters]
ref|XP_002756812.1|  PREDICTED: squalene synthase isoform X1            101   3e-22   Callithrix jacchus [common marmoset]
ref|XP_008977274.1|  PREDICTED: squalene synthase isoform X2            101   3e-22   Callithrix jacchus [common marmoset]
ref|XP_007429053.1|  PREDICTED: squalene synthase isoform X1            101   3e-22   
ref|XP_007192741.1|  PREDICTED: squalene synthase isoform X1            101   3e-22   
ref|XP_006681876.1|  hypothetical protein BATDEDRAFT_14137              100   4e-22   
ref|XP_004579357.1|  PREDICTED: squalene synthase                       100   4e-22   
ref|XP_003225597.2|  PREDICTED: squalene synthase                       101   5e-22   
ref|XP_806809.1|  farnesyltransferase                                   100   5e-22   
ref|XP_005044492.1|  PREDICTED: squalene synthase                       100   5e-22   
gb|AAF00038.1|  squalene synthase                                       100   5e-22   
ref|XP_005290732.1|  PREDICTED: squalene synthase-like                  100   6e-22   
ref|XP_006716310.1|  PREDICTED: squalene synthase isoform X1            100   6e-22   
ref|XP_009210757.1|  PREDICTED: squalene synthase isoform X3            100   6e-22   
gb|ERE90221.1|  squalene synthase                                       101   6e-22   
ref|XP_009619298.1|  PREDICTED: squalene synthase-like                  100   7e-22   
ref|XP_005528843.1|  PREDICTED: squalene synthase                       100   7e-22   
dbj|BAE36836.1|  unnamed protein product                                100   7e-22   
ref|NP_034321.2|  squalene synthase                                     100   7e-22   
dbj|BAA06102.1|  squalene synthase                                      100   8e-22   
ref|XP_010993460.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...    100   8e-22   
ref|XP_010971494.1|  PREDICTED: squalene synthase                       100   8e-22   
ref|XP_004046701.1|  PREDICTED: squalene synthase isoform 2           99.8    8e-22   
ref|XP_008529254.1|  PREDICTED: squalene synthase isoform X2            100   8e-22   
ref|XP_003271490.1|  PREDICTED: squalene synthase isoform 2           99.8    8e-22   
dbj|BAG58807.1|  unnamed protein product                              99.8    8e-22   
ref|XP_004046700.1|  PREDICTED: squalene synthase isoform 1             100   9e-22   
ref|XP_003271489.1|  PREDICTED: squalene synthase isoform 1             100   9e-22   
ref|NP_004453.3|  squalene synthase isoform 1                           100   9e-22   
emb|CAA48896.1|  farnesyl-diphosphate farnesyltransferase               100   9e-22   
ref|XP_008170096.1|  PREDICTED: squalene synthase                       100   1e-21   
ref|XP_010382892.1|  PREDICTED: squalene synthase isoform X2            100   1e-21   
gb|AAP36671.1|  Homo sapiens farnesyl-diphosphate farnesyltransfe...    100   1e-21   
ref|NP_001247653.1|  squalene synthase                                  100   1e-21   
gb|AAB33404.1|  squalene synthase                                       100   1e-21   
ref|XP_004707703.1|  PREDICTED: squalene synthase isoform X3          99.8    1e-21   
gb|AAH09251.1|  Farnesyl-diphosphate farnesyltransferase 1            99.8    1e-21   
ref|XP_004433568.1|  PREDICTED: squalene synthase isoform 2           99.8    1e-21   
ref|XP_005683583.1|  PREDICTED: squalene synthase                     99.8    1e-21   
ref|XP_004707702.1|  PREDICTED: squalene synthase isoform X2          99.8    1e-21   
ref|XP_006060304.1|  PREDICTED: squalene synthase                     99.8    1e-21   
ref|NP_001013022.1|  squalene synthase                                99.8    1e-21   
ref|XP_010838568.1|  PREDICTED: squalene synthase                     99.8    1e-21   
sp|Q32KR6.1|FDFT_BOVIN  RecName: Full=Squalene synthase; Short=SQ...  99.8    1e-21   
gb|ELR63024.1|  Squalene synthase                                     99.8    1e-21   
ref|XP_004004500.1|  PREDICTED: squalene synthase                     99.8    1e-21   
ref|XP_008826308.1|  PREDICTED: squalene synthase                     99.8    1e-21   
ref|XP_008574546.1|  PREDICTED: squalene synthase isoform X3          99.0    1e-21   
ref|XP_008148989.1|  PREDICTED: squalene synthase isoform X3          99.4    1e-21   
ref|XP_009438499.1|  PREDICTED: squalene synthase isoform X1          99.4    1e-21   
gb|KFO77427.1|  Squalene synthase                                     99.4    1e-21   
gb|ELT92149.1|  hypothetical protein CAPTEDRAFT_164295                99.4    2e-21   
ref|XP_006864385.1|  PREDICTED: squalene synthase isoform X3          99.0    2e-21   
ref|XP_008148988.1|  PREDICTED: squalene synthase isoform X2          99.4    2e-21   
ref|XP_008997579.1|  PREDICTED: squalene synthase-like isoform X2     99.0    2e-21   
ref|XP_008629248.1|  PREDICTED: squalene synthase                     99.4    2e-21   
ref|XP_008574545.1|  PREDICTED: squalene synthase isoform X2          99.4    2e-21   
ref|XP_002749744.1|  PREDICTED: squalene synthase-like isoform X1     99.4    2e-21   
ref|XP_006864384.1|  PREDICTED: squalene synthase isoform X2          99.4    2e-21   
ref|XP_005800260.1|  PREDICTED: squalene synthase-like                99.4    2e-21   
ref|XP_003793968.1|  PREDICTED: squalene synthase isoform 2           99.0    2e-21   
ref|XP_005859689.1|  PREDICTED: squalene synthase                     99.0    2e-21   
ref|XP_003944232.1|  PREDICTED: squalene synthase isoform X2          99.0    2e-21   
ref|XP_003793967.1|  PREDICTED: squalene synthase isoform 1           99.0    2e-21   
ref|XP_004671442.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...  99.0    3e-21   
ref|XP_004278741.1|  PREDICTED: squalene synthase                     99.0    3e-21   
ref|XP_002186800.1|  PREDICTED: squalene synthase                     99.0    3e-21   
ref|XP_004382267.1|  PREDICTED: squalene synthase isoform 3           98.2    3e-21   
ref|XP_806417.1|  farnesyltransferase                                 98.6    3e-21   
ref|XP_008290524.1|  PREDICTED: squalene synthase-like                97.8    3e-21   
ref|XP_005495474.1|  PREDICTED: squalene synthase                     98.6    3e-21   
ref|XP_006263357.1|  PREDICTED: squalene synthase-like                98.6    3e-21   
ref|XP_006884953.1|  PREDICTED: squalene synthase isoform X3          98.2    3e-21   
gb|EKG06138.1|  squalene synthase, putative                           98.6    3e-21   
ref|XP_004382266.1|  PREDICTED: squalene synthase isoform 2           98.6    4e-21   
ref|XP_002709483.1|  PREDICTED: squalene synthase isoform X2          98.6    4e-21   
ref|XP_007471182.1|  PREDICTED: squalene synthase isoform X3          98.2    4e-21   
ref|XP_006884952.1|  PREDICTED: squalene synthase isoform X2          98.2    4e-21   
ref|XP_007471181.1|  PREDICTED: squalene synthase isoform X2          98.2    5e-21   
ref|XP_010771634.1|  PREDICTED: squalene synthase isoform X2          98.2    5e-21   
ref|XP_006906366.1|  PREDICTED: squalene synthase isoform X2          97.8    5e-21   
ref|XP_007552931.1|  PREDICTED: squalene synthase isoform X2          97.8    6e-21   
ref|XP_008396056.1|  PREDICTED: squalene synthase isoform X2          97.8    6e-21   
ref|XP_003971766.1|  PREDICTED: squalene synthase-like                97.8    7e-21   
gb|AAL91344.1|  squalene synthase                                     94.7    8e-21   
ref|XP_004682604.1|  PREDICTED: uncharacterized protein LOC101623480  97.8    8e-21   
ref|NP_001267081.1|  squalene synthase                                97.4    9e-21   
ref|XP_008311147.1|  PREDICTED: squalene synthase isoform X2          97.1    1e-20   
ref|XP_003386611.1|  PREDICTED: squalene synthase-like                97.1    1e-20   
ref|XP_009046088.1|  hypothetical protein LOTGIDRAFT_56072            95.1    1e-20   
gb|KHN22718.1|  Squalene synthase                                     91.7    2e-20   
gb|EKF38258.1|  squalene synthase, putative                           96.7    2e-20   
ref|XP_007068988.1|  PREDICTED: squalene synthase-like                96.3    2e-20   
ref|XP_005914533.1|  PREDICTED: squalene synthase-like                96.3    2e-20   
ref|XP_005734456.1|  PREDICTED: squalene synthase-like                96.3    2e-20   
ref|XP_004541881.1|  PREDICTED: squalene synthase-like isoform X2     96.3    2e-20   
ref|XP_004766139.1|  PREDICTED: squalene synthase isoform X2          95.5    2e-20   
ref|XP_004395310.1|  PREDICTED: squalene synthase isoform 3           95.5    3e-20   
ref|XP_010863270.1|  PREDICTED: squalene synthase                     95.9    3e-20   
gb|AFJ73943.1|  squalene synthase                                     93.6    3e-20   
ref|XP_007936897.1|  PREDICTED: squalene synthase isoform X3          95.1    4e-20   
ref|XP_006008978.1|  PREDICTED: squalene synthase                     95.5    4e-20   
ref|XP_003449965.1|  PREDICTED: squalene synthase-like                95.5    4e-20   
ref|NP_062111.1|  squalene synthase                                   95.5    4e-20   
ref|XP_006729443.1|  PREDICTED: squalene synthase isoform X2          95.5    4e-20   
ref|XP_534557.2|  PREDICTED: squalene synthase isoformX1              95.5    4e-20   
ref|XP_004395309.1|  PREDICTED: squalene synthase isoform 2           95.5    4e-20   
ref|XP_002923714.1|  PREDICTED: squalene synthase isoform X2          95.5    4e-20   
ref|XP_005095010.1|  PREDICTED: squalene synthase-like isoform X1     95.5    5e-20   
ref|XP_007936895.1|  PREDICTED: squalene synthase isoform X2          95.5    5e-20   
ref|XP_004766138.1|  PREDICTED: squalene synthase isoform X1          95.1    5e-20   
ref|XP_004614762.1|  PREDICTED: squalene synthase                     95.1    6e-20   
ref|XP_004198715.1|  Piso0_002102                                     95.5    6e-20   
ref|XP_004707701.1|  PREDICTED: squalene synthase isoform X1          95.5    8e-20   
gb|EMP27211.1|  Squalene synthase                                     96.3    8e-20   
ref|XP_008116142.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...  94.7    9e-20   
emb|CCC50058.1|  putative farnesyltransferase                         94.0    1e-19   
sp|G0Y286.1|PSDS_BOTBR  RecName: Full=Presqualene diphosphate syn...  94.4    1e-19   
gb|KFW77295.1|  Squalene synthase                                     94.0    1e-19   
ref|NP_001189454.1|  squalene synthase                                94.4    1e-19   
gb|KFO99755.1|  Squalene synthase                                     94.0    1e-19   
ref|XP_007374454.1|  hypothetical protein SPAPADRAFT_60279            94.4    1e-19   
ref|XP_003868895.1|  GTP-binding protein                              93.2    1e-19   
gb|EDL20655.1|  mCG10034                                              93.6    1e-19   
ref|XP_008120692.1|  PREDICTED: squalene synthase-like                94.0    1e-19   
ref|XP_007517289.1|  PREDICTED: squalene synthase isoform X2          93.6    2e-19   
ref|XP_008116141.1|  PREDICTED: LOW QUALITY PROTEIN: squalene syn...  94.0    2e-19   
ref|XP_009590360.1|  PREDICTED: squalene synthase-like                89.0    2e-19   
dbj|BAO39180.1|  squalene synthetase                                  94.0    2e-19   
gb|KFW01543.1|  Squalene synthase                                     93.6    2e-19   
ref|XP_007517287.1|  PREDICTED: squalene synthase isoform X1          93.6    2e-19   
ref|XP_007882609.1|  PREDICTED: squalene synthase                     93.6    2e-19   
emb|CDQ56795.1|  unnamed protein product                              90.9    2e-19   
ref|XP_004848518.1|  PREDICTED: squalene synthase isoform X2          93.6    2e-19   
gb|AFJ73947.1|  squalene synthase                                     91.3    3e-19   
ref|XP_002588446.1|  hypothetical protein BRAFLDRAFT_198828           90.5    3e-19   
gb|AFJ73951.1|  squalene synthase                                     91.3    3e-19   
ref|XP_004382265.1|  PREDICTED: squalene synthase isoform 1           94.0    3e-19   
ref|XP_003757973.1|  PREDICTED: squalene synthase                     94.0    3e-19   
gb|KFP31735.1|  Squalene synthase                                     92.8    3e-19   
gb|AFJ73953.1|  squalene synthase                                     91.3    3e-19   
ref|XP_006642983.1|  PREDICTED: squalene synthase-like                93.2    3e-19   
gb|AFJ73959.1|  squalene synthase                                     91.3    3e-19   
ref|XP_004083804.1|  PREDICTED: squalene synthase                     92.8    3e-19   
gb|AFJ73957.1|  squalene synthase                                     90.9    3e-19   
gb|AEP82679.1|  farnesyltransferase                                   90.9    4e-19   
gb|AFJ73955.1|  squalene synthase                                     90.9    4e-19   
gb|EFA80770.1|  farnesyl-diphosphate farnesyltransferase              93.2    4e-19   
pdb|3WCA|A  Chain A, The Complex Structure Of Tcsqs With Ligand, ...  92.4    4e-19   
ref|XP_003479432.1|  PREDICTED: squalene synthase isoform X1          92.8    4e-19   
pdb|3WCB|A  Chain A, The Complex Structure Of Tcsqs With Ligand, ...  92.0    4e-19   
gb|AFJ73941.1|  squalene synthase                                     90.5    5e-19   
ref|XP_005535962.1|  squalene synthase                                93.2    6e-19   
ref|XP_008311146.1|  PREDICTED: squalene synthase isoform X1          92.8    6e-19   
emb|CCE44873.1|  hypothetical protein CPAR2_406760                    92.8    6e-19   
ref|XP_001372440.1|  PREDICTED: squalene synthase isoform X1          92.4    6e-19   
ref|XP_006906365.1|  PREDICTED: squalene synthase isoform X1          92.8    6e-19   
gb|AFJ73961.1|  squalene synthase                                     90.1    6e-19   
ref|XP_005425026.1|  PREDICTED: squalene synthase                     93.2    6e-19   
ref|XP_458579.1|  DEHA2D02552p                                        92.8    6e-19   
gb|AFJ73945.1|  squalene synthase                                     90.1    7e-19   
emb|CCG81491.1|  Probable squalene synthase                           92.8    7e-19   
gb|KCW84805.1|  hypothetical protein EUGRSUZ_B01606                   86.7    7e-19   
pdb|1EZF|A  Chain A, Crystal Structure Of Human Squalene Synthase     91.3    8e-19   
ref|XP_007552930.1|  PREDICTED: squalene synthase isoform X1          92.4    8e-19   
gb|KFV73970.1|  Squalene synthase                                     91.7    8e-19   
pdb|3WEJ|A  Chain A, Crystal Structure Of The Human Squalene Synt...  91.3    8e-19   
gb|AFJ73935.1|  squalene synthase                                     90.1    8e-19   
pdb|3LEE|A  Chain A, Crystal Structure Of The Human Squalene Synt...  91.3    8e-19   
pdb|3WEK|A  Chain A, Crystal Structure Of The Human Squalene Synt...  91.3    8e-19   
ref|XP_006774848.1|  PREDICTED: squalene synthase isoform X1          92.4    8e-19   
pdb|3VJ8|A  Chain A, Crystal Structure Of The Human Squalene Synt...  91.3    8e-19   
ref|XP_009906049.1|  PREDICTED: squalene synthase isoform X1          91.7    8e-19   
ref|XP_006884951.1|  PREDICTED: squalene synthase isoform X1          92.4    8e-19   
gb|KFH73802.1|  farnesyl-diphosphate farnesyltransferase              92.0    9e-19   
ref|XP_008977276.1|  PREDICTED: squalene synthase isoform X4          92.4    9e-19   
ref|XP_001915483.1|  PREDICTED: squalene synthase                     91.7    9e-19   
gb|AHG98484.1|  FDFT1                                                 90.5    9e-19   
pdb|3WC9|A  Chain A, The Complex Structure Of Hssqs Wtih Ligand, ...  91.3    9e-19   
ref|XP_008396055.1|  PREDICTED: squalene synthase isoform X1          92.4    9e-19   
emb|CAG09159.1|  unnamed protein product                              92.0    1e-18   
ref|XP_011243253.1|  PREDICTED: squalene synthase isoform X2          92.4    1e-18   
gb|AFJ73937.1|  squalene synthase                                     89.7    1e-18   
ref|XP_007618604.1|  PREDICTED: squalene synthase isoform X1          92.4    1e-18   
ref|XP_006864383.1|  PREDICTED: squalene synthase isoform X1          92.4    1e-18   
ref|XP_007936894.1|  PREDICTED: squalene synthase isoform X1          92.4    1e-18   
ref|XP_005513697.1|  PREDICTED: squalene synthase                     91.3    1e-18   
ref|XP_005562631.1|  PREDICTED: squalene synthase isoform X3          91.3    1e-18   
ref|XP_004630819.1|  PREDICTED: squalene synthase                     90.9    1e-18   
ref|XP_010771633.1|  PREDICTED: squalene synthase isoform X1          91.7    2e-18   
ref|XP_004088003.1|  PREDICTED: squalene synthase                     90.9    2e-18   
ref|WP_040444080.1|  hypothetical protein                             90.5    2e-18   
ref|XP_010743678.1|  PREDICTED: squalene synthase-like                89.7    2e-18   
ref|XP_790906.1|  PREDICTED: squalene synthase                        90.9    2e-18   
ref|XP_001467618.1|  putative farnesyltransferase                     90.9    2e-18   
ref|XP_003863390.1|  farnesyltransferase, putative                    90.9    2e-18   
ref|XP_001685284.1|  putative squalene synthase                       90.5    2e-18   
gb|AFJ73939.1|  squalene synthase                                     88.6    2e-18   
ref|XP_002554504.1|  KLTH0F06886p                                     90.9    2e-18   
ref|XP_005562629.1|  PREDICTED: squalene synthase isoform X1          91.3    3e-18   
gb|AFJ73933.1|  squalene synthase                                     88.6    3e-18   
ref|XP_009438497.1|  PREDICTED: squalene synthase isoform X2          91.3    3e-18   
ref|XP_010382891.1|  PREDICTED: squalene synthase isoform X1          91.3    3e-18   
gb|AAC17923.1|  squalene synthase                                     90.5    3e-18   
ref|XP_008148987.1|  PREDICTED: squalene synthase isoform X1          91.3    3e-18   
ref|XP_006993063.1|  PREDICTED: squalene synthase                     90.9    3e-18   
ref|XP_004541880.1|  PREDICTED: squalene synthase-like isoform X1     90.9    3e-18   
ref|XP_009241805.1|  PREDICTED: squalene synthase isoform X1          91.3    3e-18   
dbj|BAG60195.1|  unnamed protein product                              91.3    3e-18   
ref|XP_008529253.1|  PREDICTED: squalene synthase isoform X1          91.3    3e-18   
ref|NP_001274679.1|  squalene synthase isoform 3                      91.3    3e-18   
ref|XP_007959826.1|  PREDICTED: squalene synthase isoform X1          90.9    3e-18   
ref|XP_003283681.1|  farnesyl-diphosphate farnesyltransferase         90.5    3e-18   
ref|XP_007128198.1|  PREDICTED: squalene synthase isoform X1          90.9    3e-18   
emb|CDR47668.1|  CYFA0S36e00188g1_1                                   90.5    3e-18   
gb|EMG47120.1|  Squalene synthetase                                   90.5    3e-18   
ref|XP_003225609.1|  PREDICTED: squalene synthase-like                89.4    3e-18   
ref|XP_004328595.1|  PREDICTED: squalene synthase                     90.9    4e-18   
ref|XP_004433567.1|  PREDICTED: squalene synthase isoform 1           90.9    4e-18   
ref|XP_010805999.1|  PREDICTED: squalene synthase isoform X1          90.5    5e-18   
ref|XP_003984893.2|  PREDICTED: squalene synthase                     89.4    5e-18   
ref|XP_007238776.1|  PREDICTED: squalene synthase                     89.7    5e-18   
ref|XP_002735807.1|  PREDICTED: squalene synthase-like                88.6    6e-18   
ref|XP_005635705.1|  PREDICTED: squalene synthase isoform X2          89.4    6e-18   



>gb|AEX26931.1| squalene synthase 1-3 [Solanum tuberosum]
Length=136

 Score =   211 bits (538),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKTPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYK  116



>ref|XP_009759256.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=411

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGAML++P+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML KVSRSF+LVIQQLP+
Sbjct  1    MGSLGAMLRNPEDIYPLMKLKLAARYAEKQIPPQPHWAFCYIMLHKVSRSFSLVIQQLPL  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYK  116



>ref|XP_009594336.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=411

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGAML++P+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML+KVSRSF+LVIQQLP+
Sbjct  1    MGSLGAMLRNPEDIYPLMKLKLAARYAEKQIPPQPHWAFCYIMLRKVSRSFSLVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTS+ATEVK PIL+ FHRH+YDREWHF CGTKDYK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSVATEVKAPILMSFHRHVYDREWHFSCGTKDYK  116



>gb|AAB02945.1| squalene synthase [Nicotiana tabacum]
Length=376

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYK  116



>dbj|BAA82093.1| squalene synthase [Solanum tuberosum]
Length=411

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYK  116



>gb|AGB05603.1| squalene synthase [Camellia oleifera]
Length=414

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR+ EK IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLMKLKMAARRAEKNIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FHRHIYDR+WHF CGTK+YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILMAFHRHIYDRDWHFSCGTKEYK  116



>gb|AEX26930.1| squalene synthase 1-2 [Solanum tuberosum]
Length=411

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYK  116



>gb|AAD20626.1| squalene synthase [Capsicum annuum]
Length=411

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHIYDREWHFSCGTKEYK  116



>gb|AFR77735.1| squalene synthase, partial [Camellia oleifera]
Length=413

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR+ EK IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLMKLKMAARRAEKNIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FHRHIYDR+WHF CGTK+YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILMAFHRHIYDRDWHFSCGTKEYK  116



>ref|XP_006362006.1| PREDICTED: squalene synthase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362007.1| PREDICTED: squalene synthase-like isoform X2 [Solanum tuberosum]
 ref|XP_006362008.1| PREDICTED: squalene synthase-like isoform X3 [Solanum tuberosum]
Length=411

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYK  116



>gb|AEX26932.1| squalene synthase [Solanum chacoense]
Length=411

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYK  116



>ref|NP_001234716.1| squalene synthase [Solanum lycopersicum]
 gb|ACY25092.1| squalene synthase [Solanum lycopersicum]
Length=411

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYK  116



>ref|NP_001236365.1| squalene synthase [Glycine max]
 dbj|BAA22559.1| squalene synthase [Glycine max]
Length=413

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL I
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGI  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>gb|AGS57530.1| squalene synthase [Solanum nigrum]
Length=411

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYK  116



>gb|AAM27472.1| squalene synthase [Nicotiana tabacum]
Length=290

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYK  116



>gb|AAB08578.1| squalene synthase [Nicotiana tabacum]
Length=411

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYK  116



>gb|AEX26929.1| squalene synthase 1-1 [Solanum tuberosum]
Length=411

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHWGFCY MLQKVSR FALVIQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWGFCYLMLQKVSRGFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFACGTKEYK  116



>ref|XP_008236983.1| PREDICTED: squalene synthase-like [Prunus mume]
Length=412

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+LG ++KHPDD+YPL+KLK+AA+ +EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGTLGTLMKHPDDIYPLLKLKMAAKNLEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKDYK  116



>gb|KDP41726.1| hypothetical protein JCGZ_26744 [Jatropha curcas]
Length=413

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD++WHF CG KDYK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDQDWHFSCGAKDYK  116



>ref|XP_006591920.1| PREDICTED: squalene synthase isoform X2 [Glycine max]
Length=413

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>ref|XP_009631700.1| PREDICTED: squalene synthase [Nicotiana tomentosiformis]
Length=411

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+PDD+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPDDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+Y+
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYR  116



>ref|XP_009802568.1| PREDICTED: squalene synthase [Nicotiana sylvestris]
Length=411

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP PHWGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPHWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYK  116



>ref|XP_006360639.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=411

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L A+LKHP+D+YPL+KLK+AAR  EKQIPPQPHW FCY ML KVSRSF+LVI+QLP+
Sbjct  1    MGILRAILKHPEDIYPLLKLKVAARYAEKQIPPQPHWAFCYIMLHKVSRSFSLVIKQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDA+CIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYK
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYK  116



>gb|ADW27427.1| squalene synthase [Astragalus membranaceus]
Length=413

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSF LV QQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFGLVFQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLR LDTVEDDTSIATEVKVPILI FHRHIYD +WHFLCGTK+YK
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIATEVKVPILIAFHRHIYDHDWHFLCGTKEYK  116



>gb|ADG36717.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36718.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>emb|CAJ77655.1| squalene synthase 2 [Glycyrrhiza eurycarpa]
Length=412

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>gb|ACS66749.1| squalene synthase [Glycyrrhiza uralensis]
 gb|ADG36715.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36716.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36720.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36722.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36723.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36724.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>gb|ACT52825.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36714.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>emb|CDP20866.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   213 bits (543),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M +LGA+LKHPDD+YPLIKLK+A  Q EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MRTLGAILKHPDDLYPLIKLKVAVMQAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDA+C+FYLVLRALDTVEDDT+IATEVKVPIL+ FHRHIYDREWHF CGTKDYK
Sbjct  61   DLRDAICVFYLVLRALDTVEDDTNIATEVKVPILMAFHRHIYDREWHFACGTKDYK  116



>gb|ADV57358.1| squalene synthase [Astragalus membranaceus]
Length=405

 Score =   213 bits (541),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSF LV QQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFGLVFQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLR LDTVEDDTSIATEVKVPILI FHRHIYD +WHFLCGTK+YK
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIATEVKVPILIAFHRHIYDHDWHFLCGTKEYK  116



>ref|XP_006591919.1| PREDICTED: squalene synthase isoform X1 [Glycine max]
Length=451

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>gb|ADG36719.1| squalene synthase 2 [Glycyrrhiza uralensis]
 gb|ADG36721.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   213 bits (542),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>dbj|BAH23428.1| squalene synthetase [Euphorbia tirucalli]
 dbj|BAH23429.1| squalene synthetase [Euphorbia tirucalli]
Length=411

 Score =   213 bits (542),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDD YPL+KLK+A++  EKQIP QPHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMASKHAEKQIPAQPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYDREWHF CGTKDYK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHIYDREWHFSCGTKDYK  116



>emb|CAJ77653.1| squalene synthase 2 [Glycyrrhiza uralensis]
Length=412

 Score =   213 bits (542),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>ref|XP_011047507.1| PREDICTED: squalene synthase isoform X2 [Populus euphratica]
Length=346

 Score =   211 bits (536),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIP +PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPSEPHWAFCYSMLHRVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYL+LRALDTVEDDTSI TEVKVPILI FHRHIYDR WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLILRALDTVEDDTSIPTEVKVPILIAFHRHIYDRNWHFSCGTKDYK  116



>dbj|BAC56854.1| squalene synthase [Lotus japonicus]
Length=413

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD+YPL+KLK+AAR  EKQIP +PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVKHPDDLYPLLKLKMAARHAEKQIPSEPHWGFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL  FHRHIYDR+WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATEVKVPILKAFHRHIYDRDWHFSCGTKEYK  116



>gb|ACN69082.1| squalene synthase [Diospyros kaki]
Length=415

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL AML+HPDDVYPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLAAMLRHPDDVYPLVKLKMAARHAEKQIPPEPHWAFCYTMLHKVSRSFGLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSIATEVKVPIL+ FH HIYDR+WHF CGT++YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATEVKVPILLAFHHHIYDRDWHFSCGTREYK  116



>ref|XP_003537842.1| PREDICTED: squalene synthase-like isoform X1 [Glycine max]
 ref|XP_006590871.1| PREDICTED: squalene synthase-like isoform X2 [Glycine max]
 gb|KHN39832.1| Squalene synthase [Glycine soja]
Length=413

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LK+PDD YPL+KLK+AAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKNPDDFYPLLKLKMAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>ref|XP_011047498.1| PREDICTED: squalene synthase isoform X1 [Populus euphratica]
Length=413

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK+AAR  EKQIP +PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKMAARHAEKQIPSEPHWAFCYSMLHRVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYL+LRALDTVEDDTSI TEVKVPILI FHRHIYDR WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLILRALDTVEDDTSIPTEVKVPILIAFHRHIYDRNWHFSCGTKDYK  116



>gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41715.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41717.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPILI FHRHIYD +WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILIAFHRHIYDNDWHFSCGTKEYK  116



>gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41714.1| squalene synthase [Eleutherococcus senticosus]
 gb|AEA41716.1| squalene synthase [Eleutherococcus senticosus]
Length=415

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPILI FHRHIYD +WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILIAFHRHIYDNDWHFSCGTKEYK  116



>gb|ADD54645.1| squalene synthase [Bruguiera gymnorhiza]
Length=416

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ KHPDD+YPL+KLK+A +  EKQIPPQPHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIFKHPDDLYPLLKLKMAMKHAEKQIPPQPHWGFCYTMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVC+FYLVLRALDTVEDDTSIAT+VKVPILI FH H+YDR+WHF CGTKDYK
Sbjct  61   QLRDAVCVFYLVLRALDTVEDDTSIATDVKVPILIAFHHHLYDRDWHFSCGTKDYK  116



>gb|AHA84150.1| squalene synthase [Phaseolus vulgaris]
Length=413

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L ++LKHPDD YPL+KLKIAAR  EKQIPP+PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGTLRSILKHPDDFYPLLKLKIAARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>ref|XP_009376518.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=412

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  MLKHPDD+YPL+KLKIA+RQIEKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+A+C+FYLVLRALDTVEDDTS+AT+VKVPIL+ FHRHIYD  WHF CGTK+YK
Sbjct  61   ELRNAICLFYLVLRALDTVEDDTSVATDVKVPILLAFHRHIYDPNWHFACGTKNYK  116



>gb|AFI33135.3| squalene synthase [Eriobotrya japonica]
 gb|AGU36305.1| squalene synthase [Eriobotrya japonica]
Length=412

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  MLKHPDD+YPL+KLKIA+RQI+KQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIKKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSIAT+VKVPIL+ FHRHIYD EWHF CGT +YK
Sbjct  61   ELRNAVCLFYLVLRALDTVEDDTSIATDVKVPILLAFHRHIYDPEWHFACGTNNYK  116



>gb|KDO43896.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=294

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYK  116



>ref|XP_002512982.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
 gb|EEF49485.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis]
Length=412

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+GA+L+HPDD YPL+KLK+AAR  EKQIPP+P WGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSVGAILRHPDDFYPLLKLKMAARNAEKQIPPEPRWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFH+HIY+ EWHF CGTKDYK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIDFHKHIYNPEWHFSCGTKDYK  116



>ref|XP_011088477.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011088478.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YP++KLK+A R  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPMVKLKLAVRSAEKQIPAEPHWAFCYSMLHKVSRSFGLVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSIATEVKVPIL+DFHRHIYDREWHF CGTKDYK
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIATEVKVPILMDFHRHIYDREWHFSCGTKDYK  116



>ref|XP_011458278.1| PREDICTED: squalene synthase-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GAMLKHPDD+YPL+KLK+AAR +EKQIPPQPHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAMLKHPDDIYPLLKLKMAARNLEKQIPPQPHWAFCYTMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDT++ T+VK+PILI FHRHIYD +WHF CGTK+YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTAVETDVKLPILIAFHRHIYDPKWHFACGTKEYK  116



>ref|XP_004290304.1| PREDICTED: squalene synthase-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GAMLKHPDD+YPL+KLK+AAR +EKQIPPQPHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAMLKHPDDIYPLLKLKMAARNLEKQIPPQPHWAFCYTMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDT++ T+VK+PILI FHRHIYD +WHF CGTK+YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTAVETDVKLPILIAFHRHIYDPKWHFACGTKEYK  116



>gb|AGS78117.1| squalene synthase 1 [Malus domestica]
Length=412

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  MLKHPDD+YPL+KLKIA+RQIEKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMLKHPDDIYPLLKLKIASRQIEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTS+AT+VKVPIL+ FHRHIYD +WHF CGT +YK
Sbjct  61   ELRNAVCLFYLVLRALDTVEDDTSVATDVKVPILLAFHRHIYDPDWHFACGTNNYK  116



>gb|KDO43895.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=340

 Score =   209 bits (531),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYK  116



>sp|P53800.1|FDFT_NICBE RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Nicotiana benthamiana]
 gb|AAA87048.1| squalene synthetase [Nicotiana benthamiana]
Length=411

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LK+P+D+YPL+KLK+AAR  EKQIPP P+WGFCY+ML KVSRSFALVIQQLP+
Sbjct  1    MGSLRAILKNPEDLYPLVKLKLAARHAEKQIPPSPNWGFCYSMLHKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILISFHQHVYDREWHFSCGTKEYK  116



>ref|XP_010066209.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 ref|XP_010066210.1| PREDICTED: squalene synthase [Eucalyptus grandis]
 gb|KCW64053.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64054.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64055.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
 gb|KCW64056.1| hypothetical protein EUGRSUZ_G01720 [Eucalyptus grandis]
Length=413

 Score =   210 bits (535),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EK+IPPQPHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARNAEKRIPPQPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYK  116



>ref|XP_006487314.1| PREDICTED: squalene synthase isoform X1 [Citrus sinensis]
 gb|KDO43888.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43889.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=413

 Score =   210 bits (535),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYK  116



>ref|XP_004248691.1| PREDICTED: squalene synthase-like [Solanum lycopersicum]
Length=411

 Score =   210 bits (535),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L A+LKHP+D+YPL+KLK+AA+  EKQIP QPHW FCY ML KVSRSF+LVIQQLP+
Sbjct  1    MGILRAILKHPEDIYPLLKLKVAAQYAEKQIPSQPHWAFCYIMLHKVSRSFSLVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDA+CIFYLVLRALDTVEDDTS+ATEVKVPIL+ FHRH+YDREWHF CGTKDYK
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSVATEVKVPILMSFHRHVYDREWHFSCGTKDYK  116



>ref|XP_002266150.1| PREDICTED: squalene synthase [Vitis vinifera]
 ref|XP_010647676.1| PREDICTED: squalene synthase [Vitis vinifera]
 emb|CBI38008.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   210 bits (535),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L HPDD+YPL+KLK+A R  EKQIPP+PHW FCYT+L KVSRSF LVIQQL  
Sbjct  1    MGSLGAILTHPDDIYPLLKLKMAVRHAEKQIPPEPHWAFCYTLLHKVSRSFGLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+A+CIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYK
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIRTDVKVPILIAFHRHIYDRDWHFACGTKDYK  116



>gb|KDO43893.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
 gb|KDO43894.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=386

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYK  116



>gb|ADC95435.1| squalene synthase [Withania somnifera]
Length=411

 Score =   210 bits (535),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG++ A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHW FCY MLQKVSRSFALVIQQLP+
Sbjct  1    MGTVRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWAFCYLMLQKVSRSFALVIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI  +VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPADVKVPILISFHQHVYDREWHFSCGTKEYK  116



>gb|KDO43892.1| hypothetical protein CISIN_1g015087mg [Citrus sinensis]
Length=384

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYK  116



>gb|ADG36706.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>emb|CAN81937.1| hypothetical protein VITISV_028001 [Vitis vinifera]
Length=431

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L HPDD+YPL+KLK+A R  EKQIPP+PHW FCYT+L KVSRSF LVIQQL  
Sbjct  1    MGSLGAILTHPDDIYPLLKLKMAVRHAEKQIPPEPHWAFCYTLLHKVSRSFGLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+A+CIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYK
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIRTDVKVPILIAFHRHIYDRDWHFACGTKDYK  116



>gb|AER23670.1| squalene synthase [Eleutherococcus senticosus]
Length=414

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLDA  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYK  116



>gb|ACU21003.1| unknown [Glycine max]
Length=413

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW F YTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARNAEKQIPPEPHWAFRYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>ref|XP_004150142.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 ref|XP_004167323.1| PREDICTED: squalene synthase-like [Cucumis sativus]
 gb|KGN61845.1| hypothetical protein Csa_2G251460 [Cucumis sativus]
Length=417

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLKP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYK  116



>gb|AFK29283.1| putative squalene synthase 1 [Salvia miltiorrhiza]
 gb|AFV13322.1| putative squalene synthase 1 [Salvia miltiorrhiza]
Length=413

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK AAR  EKQIPP+PHWGFCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPLLKLKYAARNAEKQIPPEPHWGFCYTMLHKVSRSFGLVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDA+CIFYLVLRALDTVEDDTSIATE+KVPIL+ FHRHI+DREWHF CGTK+Y+
Sbjct  61   DLRDAICIFYLVLRALDTVEDDTSIATELKVPILMAFHRHIFDREWHFSCGTKEYR  116



>dbj|BAA13084.1| squalene synthase [Glycyrrhiza glabra]
Length=412

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLKIAARQ EKQIP +PHW FCYTML KVSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKIAARQAEKQIPREPHWSFCYTMLHKVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYD +WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDCDWHFSCGTKEYK  116



>emb|CAJ77652.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>emb|CAD23250.1| farnesyl-diphosphate farnesyltransferase [Medicago truncatula]
 gb|AES89237.2| squalene synthase [Medicago truncatula]
Length=413

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD +WHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDWHFGCGTKEYK  116



>gb|ACR57219.1| squalene synthase [Salvia miltiorrhiza]
Length=413

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK AAR  EKQIPP+PHWGFCYTML KVSRSF LVIQQL  
Sbjct  1    MGSLRAILRHPDDLYPLLKLKYAARNAEKQIPPEPHWGFCYTMLHKVSRSFGLVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDA+CIFYLVLRALDTVEDDTSIATE+KVPIL+ FHRHI+DREWHF CGTK+Y+
Sbjct  61   DLRDAICIFYLVLRALDTVEDDTSIATELKVPILMAFHRHIFDREWHFSCGTKEYR  116



>gb|ADG36711.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=412

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>gb|ADX01171.1| putative squalene synthase [Bacopa monnieri]
Length=414

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LKHPDD+YP++KLK+A R  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLRAILKHPDDLYPMVKLKLAVRNAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAV IFYLVLRALDTVEDDTSI+ EVKVPIL  FHRHIYDREWHF CGTKDYK
Sbjct  61   DLRDAVRIFYLVLRALDTVEDDTSISAEVKVPILKAFHRHIYDREWHFACGTKDYK  116



>gb|AFZ93644.1| squalene synthetase [Euphorbia lathyris]
Length=410

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AA+  EKQIP QPHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAAKHAEKQIPAQPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILI FH+HIYD EWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHIYDPEWHFSCGTKEYK  116



>ref|NP_001280921.1| squalene synthase-like [Malus domestica]
 ref|XP_008382334.1| PREDICTED: squalene synthase-like [Malus domestica]
 gb|AGS78118.1| squalene synthase 2 [Malus domestica]
Length=410

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  M+KHPDD+YPL+KLKIA+R +EKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMIKHPDDIYPLLKLKIASRHVEKQIPSEPHWAFCYTMLQKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSIAT+VKVPIL+ FH+HIYD EWHF CGT +YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIATDVKVPILLAFHQHIYDPEWHFACGTNNYK  116



>gb|AED99863.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYK  116



>gb|ABA29019.1| squalene synthase [Panax notoginseng]
 gb|AGS79226.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYK  116



>ref|XP_007199882.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
 gb|EMJ01081.1| hypothetical protein PRUPE_ppa006420mg [Prunus persica]
Length=412

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+LG ++KHPDD+YPL+KLK+AA+ +EKQIPP+PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGTLGTLMKHPDDIYPLLKLKMAAKNLEKQIPPEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSIA +VKVPIL+ FHRHIYD +WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIAADVKVPILLAFHRHIYDPDWHFSCGTKDYK  116



>gb|ACS66750.1| squalene synthase [Glycyrrhiza uralensis]
Length=413

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>gb|AGI19256.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYK  116



>gb|ADG36704.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>gb|ADG36703.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>emb|CAJ58418.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYK  116



>gb|ACV88718.1| squalene synthase [Panax ginseng]
Length=415

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYK  116



>gb|AAV58897.1| squalene synthase [Centella asiatica]
Length=415

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL  FHRHIYD  WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILKAFHRHIYDNNWHFSCGTKEYK  116



>gb|ADG36709.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>gb|ADC32654.1| squalene synthase [Aralia elata]
Length=414

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIY+++WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYEKDWHFSCGTKEYK  116



>gb|AIK21786.1| squalene synthase [Panax notoginseng]
Length=415

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPIL+ FHRHIYD +WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPILMAFHRHIYDNDWHFSCGTKEYK  116



>gb|ADG36705.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>gb|ADG36702.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36710.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36712.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36713.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>ref|XP_007131767.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 ref|XP_007131768.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03761.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
 gb|ESW03762.1| hypothetical protein PHAVU_011G040100g [Phaseolus vulgaris]
Length=413

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L ++LKHPDD YPL+KLKIAAR  EKQIPP+ HW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGTLRSILKHPDDFYPLLKLKIAARNAEKQIPPELHWAFCYTMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>gb|ADG36708.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=410

 Score =   207 bits (528),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPGEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>ref|XP_003607040.1| Squalene synthase [Medicago truncatula]
Length=423

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD +WHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDWHFGCGTKEYK  116



>ref|XP_006423442.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
 gb|ESR36682.1| hypothetical protein CICLE_v10028537mg [Citrus clementina]
Length=413

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L+HPDD+YPL+KLK+A+RQ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLAAVLRHPDDLYPLLKLKMASRQAEKQIPSEPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRH+YDREWHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHVYDREWHFSCGTKEYK  116



>ref|XP_009378420.1| PREDICTED: squalene synthase-like [Pyrus x bretschneideri]
Length=410

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  M+KHPDD+YPL+KLKIA+R +EKQIP +PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGALSTMIKHPDDIYPLLKLKIASRHVEKQIPAEPHWAFCYTMLQKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTS+AT+VKVPIL+ FH HIYD EWHF CGT +YK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSVATDVKVPILLAFHEHIYDPEWHFACGTNNYK  116



>ref|XP_011037190.1| PREDICTED: squalene synthase-like [Populus euphratica]
Length=413

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHP D+YPL+KLK+AA+  EKQIPP+PHW FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPVDIYPLLKLKMAAKHAEKQIPPEPHWAFCYSMLHRVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD +WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDHDWHFSCGTKDYK  116



>dbj|BAA24289.1| squalene synthase [Panax ginseng]
 dbj|BAD08242.1| squalene synthase [Panax ginseng]
Length=415

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHP+D YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPEDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYK  116



>ref|XP_010526913.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526914.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
 ref|XP_010526915.1| PREDICTED: squalene synthase-like [Tarenaya hassleriana]
Length=413

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M +LGA+L+HPD+ YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MRNLGAILRHPDEFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTKDYK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYK  116



>gb|ACA66014.1| squalene synthase [Panax ginseng]
Length=415

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHP+D YPL+KLK AAR  EKQIPP+PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPEDFYPLLKLKFAARHAEKQIPPEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI TEVKVPIL+ FHRHIYD++WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIPTEVKVPILMAFHRHIYDKDWHFSCGTKEYK  116



>gb|ADG36701.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>gb|AEM42980.1| squalene synthase [Siraitia grosvenorii]
Length=417

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDD YPL+KLK+AAR  EKQIPP+PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAARHAEKQIPPEPHWGFCYTMLHKVSRSFALVIQQLAP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+A+CIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYK
Sbjct  61   ELRNAICIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYK  116



>gb|KHG01756.1| Squalene synthase [Gossypium arboreum]
Length=413

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+ HIYDR+WHF CGTK++K
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYHHIYDRDWHFSCGTKEFK  116



>gb|ACT52826.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ADG36700.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>gb|ACQ90302.1| squalene synthase [Gynostemma pentaphyllum]
Length=417

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GA+L+HPDD YPL+KLK+AAR  EKQIP +PHWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSFGAILRHPDDFYPLLKLKMAARNAEKQIPQEPHWGFCYTMLHKVSRSFALVIQQLQP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSI T++KVPILI+FHRHIY+R+WHF CGTK YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIETDIKVPILINFHRHIYNRDWHFSCGTKHYK  116



>gb|ADG36707.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>gb|ADG36699.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=413

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDT IAT+VKVPILI FHRHIYDR WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTGIATDVKVPILIAFHRHIYDRVWHFSCGTKEYK  116



>ref|XP_010263865.1| PREDICTED: squalene synthase-like [Nelumbo nucifera]
Length=415

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +LKHPDD+YPL KLK+AAR + KQIPP+PHWGFCY ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTVLKHPDDIYPLFKLKMAARNVGKQIPPEPHWGFCYKMLHKVSRSFSLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSIA+++KVPIL +FH+HIYD +WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIASDIKVPILKNFHQHIYDGDWHFSCGTKDYK  116



>ref|XP_010548076.1| PREDICTED: squalene synthase-like isoform X2 [Tarenaya hassleriana]
Length=415

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDD YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             LR+AVC+FYLVLR LDTVEDD SI T+VKVPILI FHRHIYDR+WHF CGTKDYK
Sbjct  61   HLRNAVCVFYLVLRGLDTVEDDMSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYK  116



>dbj|BAA13083.1| squalene synthase [Glycyrrhiza glabra]
Length=413

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+++HPD+VYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIVRHPDEVYPLLKLKMAARHAEKQIPAEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VK PILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKEPILIAFHRHIYDRDWHFSCGTKEYK  116



>ref|XP_010548075.1| PREDICTED: squalene synthase-like isoform X1 [Tarenaya hassleriana]
Length=417

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDD YPL+KLK+AA++ EKQIPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILRHPDDFYPLLKLKMAAKKAEKQIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             LR+AVC+FYLVLR LDTVEDD SI T+VKVPILI FHRHIYDR+WHF CGTKDYK
Sbjct  61   HLRNAVCVFYLVLRGLDTVEDDMSIPTDVKVPILIAFHRHIYDRDWHFSCGTKDYK  116



>gb|ACX42425.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYK  116



>gb|ACX42426.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYK  116



>ref|XP_010109768.1| hypothetical protein L484_008444 [Morus notabilis]
 gb|EXC24673.1| hypothetical protein L484_008444 [Morus notabilis]
Length=411

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+L+HPDDVYPLIKLK+AAR  EK+IPP+PHWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALLRHPDDVYPLIKLKMAARNAEKRIPPEPHWGFCYSMLHKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDT+EDDTSI T+VKVPIL +F+RH+Y+ +WHF CGTKDYK
Sbjct  61   DLRDAVCIFYLVLRALDTIEDDTSIPTDVKVPILKEFYRHMYNPKWHFSCGTKDYK  116



>ref|XP_008461009.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461010.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461011.1| PREDICTED: squalene synthase-like [Cucumis melo]
 ref|XP_008461012.1| PREDICTED: squalene synthase-like [Cucumis melo]
Length=417

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AAR  EKQIPP+ HWGFCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAARHAEKQIPPESHWGFCYTMLHKVSRSFALVIQQLKP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI T++KVPIL  FH HIY+R+WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIQTDIKVPILKAFHCHIYNRDWHFSCGTKDYK  116



>gb|ACX42423.1| squalene synthase [Bupleurum chinense]
Length=414

 Score =   205 bits (522),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNSSWHFSCGTKEYK  116



>gb|KJB12171.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=412

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YK
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYK  116



>gb|AAY46017.1| squalene synthase [Bupleurum falcatum]
Length=415

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAFLKHPDDLYPLLKLKYAVKHAEKQIPPQPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYK  116



>gb|AFT92039.1| squalene synthase [Euphorbia pekinensis]
Length=411

 Score =   205 bits (521),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+AA+  EK IP  PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKMAAKNAEKHIPALPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDA+CIFYLVLRALDTVEDDTSI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   ELRDAICIFYLVLRALDTVEDDTSIPTDVKVPILIAFHKHVYDREWHFPCGTKEYK  116



>gb|AFK36923.1| unknown [Medicago truncatula]
Length=413

 Score =   205 bits (521),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+ A+LK+PDD +PL+KLKIAAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSIKAILKNPDDFFPLLKLKIAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPILIDFHRHIYD + HF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIETDVKVPILIDFHRHIYDNDRHFGCGTKEYK  116



>gb|EYU37849.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=346

 Score =   203 bits (517),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L++P+D+YPL+KLK+A+R  EKQIP +PHWGFCY+MLQKVSRSFA VIQQL  
Sbjct  1    MGSLRAILRNPEDLYPLLKLKLASRNAEKQIPSEPHWGFCYSMLQKVSRSFAFVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI TE+KVPIL+ FH+HIYDREWHF CGTK+YK
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIKTEIKVPILMAFHQHIYDREWHFACGTKEYK  116



>gb|KJB12166.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=413

 Score =   205 bits (521),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YK
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYK  116



>emb|CAJ77654.1| squalene synthase 1 [Glycyrrhiza eurycarpa]
Length=413

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PH  FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHRAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  61   QLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIAFHRHIYDRDWHFSCGTKEYK  116



>ref|XP_004507500.1| PREDICTED: squalene synthase-like [Cicer arietinum]
Length=413

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SLGA+LK+PDD +PL+KLK+AAR  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  
Sbjct  1    MASLGAILKNPDDFFPLLKLKMAARNAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FHRHIYD +WHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIDTDVKVPILKAFHRHIYDHDWHFACGTKEYK  116



>gb|KJB12169.1| hypothetical protein B456_002G004400 [Gossypium raimondii]
Length=427

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+AAR  EKQIP +PHWGFC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALMKHPDDFYPLLKLKMAARNAEKQIPSEPHWGFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR AVCIFYLVLRALDTVEDDTS+A +VKVPILIDF+RHIYD +WHF CGTK+YK
Sbjct  61   ELRHAVCIFYLVLRALDTVEDDTSVAADVKVPILIDFYRHIYDPDWHFSCGTKEYK  116



>gb|EYU37850.1| hypothetical protein MIMGU_mgv1a007228mg [Erythranthe guttata]
Length=414

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+L++P+D+YPL+KLK+A+R  EKQIP +PHWGFCY+MLQKVSRSFA VIQQL  
Sbjct  1    MGSLRAILRNPEDLYPLLKLKLASRNAEKQIPSEPHWGFCYSMLQKVSRSFAFVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI TE+KVPIL+ FH+HIYDREWHF CGTK+YK
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIKTEIKVPILMAFHQHIYDREWHFACGTKEYK  116



>gb|AFK29284.1| putative squalene synthase 2 [Salvia miltiorrhiza]
 gb|AGE45641.1| squalene synthase 2 [Salvia miltiorrhiza]
 gb|AJR21118.1| squalene synthase 2 [Salvia miltiorrhiza]
Length=414

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M +LGA+LKHP+D+YP++KLK+AARQ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVNLGAILKHPEDLYPMVKLKLAARQAEKQIPAEPHWAFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSIA+EVKVPIL  FHRHIY+ EWHF CGTK+YK
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSIASEVKVPILKAFHRHIYNSEWHFSCGTKEYK  116



>gb|ACZ71037.1| squalene synthase [Panax ginseng]
Length=415

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI+TEVKVPI++ FH HIYD +WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISTEVKVPIVMAFHCHIYDNDWHFSCGTKEYK  116



>gb|ACX42424.1| squalene synthase [Bupleurum chinense]
Length=415

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA LKHPDD+YPL+KLK A +  EKQIPPQPHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAFLKHPDDLYPLLKLKYAVKLAEKQIPPQPHWAFCYSMLHKVSRSFCLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI++EVKVPIL++FHRHIY+  WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSISSEVKVPILMEFHRHIYNNSWHFSCGTKEYK  116



>gb|ADW78251.1| squalene synthase [Withania somnifera]
 gb|ADO22708.1| squalene synthase [Withania somnifera]
Length=413

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+LK+PDD+YPLIKLK+AAR  EKQIPP+PHW FCY MLQKVSRSFAL IQQLP+
Sbjct  1    MGTLRAILKNPDDLYPLIKLKLAARHAEKQIPPEPHWAFCYLMLQKVSRSFALAIQQLPV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHF--LCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI  +VKVPILI FH+H+YDREWHF  L GTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPADVKVPILISFHQHVYDREWHFSLLGGTKEYK  118



>gb|ABG66304.1| squalene synthase [Polygala tenuifolia]
Length=413

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLK+A R  EKQIP +PHWGF Y+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAVLKHPDDFYPLLKLKLAVRHAEKQIPHEPHWGFSYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTS+ T+VKVPIL  FHRHIYDREWHF CGTK+YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSVPTDVKVPILKAFHRHIYDREWHFSCGTKEYK  116



>gb|EYU42585.1| hypothetical protein MIMGU_mgv1a007225mg [Erythranthe guttata]
Length=414

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SL A+LKHPDD+YP++KLK+AAR+ EKQI  +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLRAILKHPDDLYPMVKLKLAARKAEKQIRSEPHWAFCYSMLLKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTS+AT+VKVPIL+DFH+HIYDREWHF CGTK+YK
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSVATDVKVPILMDFHQHIYDREWHFSCGTKEYK  116



>emb|CAJ58419.1| squalene synthase [Panax quinquefolius]
Length=415

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPDD YPL+KLKIAAR  EKQIP +PHW FCY+ML KVSRSF LVIQQL  
Sbjct  1    MGSLGAILKHPDDFYPLLKLKIAARHAEKQIPSEPHWAFCYSMLHKVSRSFGLVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRA DTVEDDTSI+TEVKVPI++ FH HIYD +WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRAFDTVEDDTSISTEVKVPIVMAFHCHIYDNDWHFSCGTKEYK  116



>gb|AFN61199.1| squalene synthase [Chlorophytum borivilianum]
Length=410

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+ GA+LKHPDD YP++KL +A +   KQIPPQPHW FCYTML KVSRSFALVIQQL +
Sbjct  1    MGTFGAILKHPDDFYPIMKLAMAMKSAAKQIPPQPHWAFCYTMLHKVSRSFALVIQQLDV  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             LRDAVC+FYLVLRALDTVEDDTSI T+VKVPIL  FHRHIYD EWHF CGTKDYK
Sbjct  61   NLRDAVCVFYLVLRALDTVEDDTSIPTDVKVPILNSFHRHIYDCEWHFSCGTKDYK  116



>ref|XP_011092839.1| PREDICTED: squalene synthase-like [Sesamum indicum]
 ref|XP_011092841.1| PREDICTED: squalene synthase-like [Sesamum indicum]
Length=414

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SL A+ +HPDD+YP++KLK+AAR+ EKQIP +PHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLQAIWRHPDDLYPMVKLKLAARRAEKQIPAEPHWAFCYSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSI+ EVKVPIL+ FHRHIYDREWHF CGTKDYK
Sbjct  61   DLRDAVCIFYLVLRALDTVEDDTSISMEVKVPILMAFHRHIYDREWHFSCGTKDYK  116



>ref|XP_007042047.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
 gb|EOX97878.1| Squalene synthase 1 isoform 1 [Theobroma cacao]
Length=413

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++++PDD YPL KLK+AAR  EKQIP +PHW FC++ML KVSRSFA VIQQL  
Sbjct  1    MGSLGALVRNPDDFYPLFKLKMAARHAEKQIPSEPHWAFCFSMLLKVSRSFAFVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILIDFHRHIY+R+WHF CGTK YK
Sbjct  61   KLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIDFHRHIYNRDWHFSCGTKHYK  116



>ref|XP_002313765.1| squalene synthase family protein [Populus trichocarpa]
 gb|EEE87720.1| squalene synthase family protein [Populus trichocarpa]
Length=413

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHP D+YPL+KLK+AA+   KQIP +PHW FCY+ML +VSRSFA VIQQL  
Sbjct  1    MGSLGAILKHPADLYPLLKLKMAAKHAAKQIPSEPHWAFCYSMLHRVSRSFAFVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR WHF CGT DY+
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDRNWHFSCGTNDYR  116



>ref|XP_010039888.1| PREDICTED: squalene synthase-like isoform X2 [Eucalyptus grandis]
Length=414

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GA+L+HP D YPL+KLK+AA   EKQIPPQPHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSWGAILRHPGDFYPLMKLKMAASNAEKQIPPQPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYK  116



>gb|KJB32574.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
 gb|KJB32576.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=412

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR+WHF CGTK+YK
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDRDWHFSCGTKNYK  116



>ref|XP_002305455.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
 gb|EEE85966.2| hypothetical protein POPTR_0004s16830g [Populus trichocarpa]
Length=476

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  109  KMGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLP  288
            KMGSLGA+LKHP D+YPL+KLK+AA+  EKQIP +PHW FCY+ML +VSRSFALVIQQL 
Sbjct  63   KMGSLGAILKHPVDIYPLLKLKMAAKHAEKQIPREPHWAFCYSMLPRVSRSFALVIQQLD  122

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             ELR+AVC+FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYD +WHF CGTK+YK
Sbjct  123  TELRNAVCVFYLVLRALDTVEDDTSIPTDVKVPILIAFHRHIYDHDWHFSCGTKEYK  179



>ref|XP_010039880.1| PREDICTED: squalene synthase-like isoform X1 [Eucalyptus grandis]
Length=419

 Score =   200 bits (508),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS GA+L+HP D YPL+KLK+AA   EKQIPPQPHW FCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSWGAILRHPGDFYPLMKLKMAASNAEKQIPPQPHWAFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCIFYLVLRALDTVEDDTSI T+VKVPIL  FH+H+YD+EWHF CGTK+YK
Sbjct  61   ELRDAVCIFYLVLRALDTVEDDTSIPTDVKVPILKAFHQHVYDKEWHFSCGTKEYK  116



>ref|XP_010690774.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPD+ YPL+KLK+A ++ EKQIPP+ HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKHPDEFYPLLKLKMAVKEAEKQIPPEAHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSI  +VK+PIL +FH+HIYDR+WHF CGTK YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIDNDVKLPILRNFHQHIYDRDWHFSCGTKHYK  116



>ref|NP_195190.1| Squalene synthase 1 [Arabidopsis thaliana]
 sp|P53799.1|FDFT_ARATH RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: 
Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate 
farnesyltransferase [Arabidopsis thaliana]
 emb|CAA60385.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 dbj|BAA06103.1| squalene synthase [Arabidopsis thaliana]
 gb|AAB62242.1| squalene synthase 1 [Arabidopsis thaliana]
 emb|CAA18843.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAD00296.1| squalene synthase [Arabidopsis thaliana]
 emb|CAB80181.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana]
 gb|AAM20719.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AAO30082.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86403.1| Squalene synthase [Arabidopsis thaliana]
Length=410

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIYD +WH+ CGTK+YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYDTDWHYSCGTKEYK  116



>gb|AAG14896.2|AF302464_1 squalene synthase [Artemisia annua]
 gb|AAK92539.1|AF405310_1 squalene synthase [Artemisia annua]
Length=418

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  
Sbjct  1    MSSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYK  116



>gb|ABQ96265.1| squalene synthase [Psammosilene tunicoides]
Length=414

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LK+PD+ YPL+KLK+A ++ EKQIP + HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MGSLGAILKYPDEFYPLLKLKMAIKEAEKQIPQEHHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSIATEVKVPIL  FH+HIYDR+WHF CGTK YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIATEVKVPILRAFHQHIYDRDWHFSCGTKHYK  116



>gb|AAR20329.1| squalene synthase [Artemisia annua]
Length=418

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  
Sbjct  1    MSSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYK  116



>gb|ABX10442.1| squalene synthase 2 [Gossypium hirsutum]
Length=412

 Score =   197 bits (501),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHP D YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPGDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR+WHF CGTK+YK
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILEEFYRHIYDRDWHFSCGTKNYK  116



>gb|KHG07441.1| Squalene synthase [Gossypium arboreum]
Length=412

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYD +WHF CGTK+YK
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDPDWHFSCGTKNYK  116



>ref|XP_006412201.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 ref|XP_006412202.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53654.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
 gb|ESQ53655.1| hypothetical protein EUTSA_v10025338mg [Eutrema salsugineum]
Length=409

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  Q EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEQAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PIL  FHRHIYD +WH+ CGTK+YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILKAFHRHIYDTDWHYSCGTKEYK  116



>ref|XP_010437579.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=419

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YK
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYK  116



>ref|XP_010447048.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=410

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YK
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYK  116



>ref|XP_010432389.1| PREDICTED: squalene synthase [Camelina sativa]
Length=410

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YK
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYK  116



>gb|AAR20328.1| squalene synthase [Artemisia annua]
Length=413

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +1

Query  115  GSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIE  294
             SL A+LKHPDD YPL+KLK+AA++ EKQIP QPHW F Y+ML KVSRSFALVIQQL  +
Sbjct  1    SSLKAVLKHPDDFYPLLKLKMAAKKAEKQIPSQPHWAFSYSMLHKVSRSFALVIQQLNPQ  60

Query  295  LRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YK
Sbjct  61   LRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHKHIYNRDWHFACGTKEYK  115



>ref|XP_010437580.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=410

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGTK+YK
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTKEYK  116



>ref|XP_002869133.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45392.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FHRHIY+ +WH+ CGT +YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHRHIYNTDWHYSCGTNEYK  116



>gb|AIX97193.1| squalene synthase [Matricaria chamomilla var. recutita]
Length=409

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL A+LKHPDD +PL+KLK+AA + EKQIP +PHW F Y+ML KVSR+FALVIQQL  
Sbjct  1    MGSLKAVLKHPDDFFPLLKLKMAANKAEKQIPSEPHWAFSYSMLHKVSRNFALVIQQLNP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVCIFYLVLRALDTVEDDTSIA ++KVPILI FH+HIY+R+WHF CGTK+YK
Sbjct  61   QLRDAVCIFYLVLRALDTVEDDTSIAADIKVPILIAFHQHIYNRDWHFACGTKEYK  116



>gb|KFK30097.1| hypothetical protein AALP_AA7G216600 [Arabis alpina]
Length=412

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SLG +L++PDD+YPL+K+K A  Q EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MASLGTILRYPDDIYPLLKMKRAIEQAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYK  116



>ref|XP_009108714.1| PREDICTED: squalene synthase-like isoform X1 [Brassica rapa]
 ref|XP_009108715.1| PREDICTED: squalene synthase-like isoform X2 [Brassica rapa]
Length=410

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YK
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYK  116



>gb|EPS74249.1| hypothetical protein M569_00507, partial [Genlisea aurea]
Length=292

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG++GA+L+HP+D  P++KLK+A ++ EKQIP +P W FCY+ML +VSRSFALVIQQL  
Sbjct  1    MGTVGAILRHPNDFIPMLKLKMAMKKAEKQIPEEPQWRFCYSMLHRVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDA+C+FYLVLRALDTVEDDTSIAT+VKVPILI FH H+YDR WHF CGTKDYK
Sbjct  61   DLRDAICVFYLVLRALDTVEDDTSIATDVKVPILISFHSHLYDRGWHFSCGTKDYK  116



>ref|XP_006283828.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
 gb|EOA16726.1| hypothetical protein CARUB_v10004929mg [Capsella rubella]
Length=414

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG ML++PDD++PL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTMLRYPDDIFPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLNT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+ KVPILI FH+HIY+ +WH+ CGTK+YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKVPILIAFHQHIYNTDWHYSCGTKEYK  116



>ref|XP_010934354.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
 ref|XP_010910886.1| PREDICTED: squalene synthase-like [Elaeis guineensis]
Length=408

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LGA+++HP+D+YPL+KLK+AA +I++QIP +PHW F Y MLQKVSRSFALVIQQL +
Sbjct  1    MGMLGAIMEHPEDLYPLVKLKMAADRIKRQIPGEPHWAFSYAMLQKVSRSFALVIQQLGL  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FHRHIYD +WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHRHIYDCDWHFSCGTKDYK  116



>ref|XP_009110610.1| PREDICTED: squalene synthase [Brassica rapa]
 ref|XP_009110680.1| PREDICTED: squalene synthase [Brassica rapa]
Length=409

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIY+ +WH+ CGTK+YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYNTDWHYSCGTKEYK  116



>gb|AGW25489.1| squalene synthase [Paris polyphylla var. yunnanensis]
Length=403

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG + A+L HP D+Y L+KLK+AA +IE+QIP +PHW F YTMLQKVSRSFA+VIQQL  
Sbjct  1    MGMMAAVLDHPGDLYVLVKLKMAASRIERQIPAEPHWAFAYTMLQKVSRSFAIVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FHRHIYDR+WHF CGTKDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHRHIYDRDWHFSCGTKDYK  116



>ref|XP_009138312.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138313.1| PREDICTED: squalene synthase-like [Brassica rapa]
 ref|XP_009138314.1| PREDICTED: squalene synthase-like [Brassica rapa]
Length=417

 Score =   192 bits (488),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ CGTK+YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCGTKEYK  116



>gb|KHN25422.1| Squalene synthase [Glycine soja]
Length=408

 Score =   192 bits (487),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  136  KHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCI  315
            +  D+ YPL+KLKI AR  EKQIPP+PHW FCYTML KVSRSFALVIQQL IELR+AVCI
Sbjct  4    RSEDEFYPLLKLKIVARNAEKQIPPEPHWAFCYTMLHKVSRSFALVIQQLGIELRNAVCI  63

Query  316  FYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            FYLVLRALDTVEDDTSI T+VKVPILI FHRHIYDR+WHF CGTK+YK
Sbjct  64   FYLVLRALDTVEDDTSIETDVKVPILIAFHRHIYDRDWHFSCGTKEYK  111



>ref|XP_008796682.1| PREDICTED: squalene synthase-like isoform X3 [Phoenix dactylifera]
Length=378

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYK  116



>ref|XP_009760451.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
 ref|XP_009760452.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=406

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +G +++HP+++YPLIKL + A+  EKQIP +P+W FCY ML+ +SRSF+LVIQQLP+
Sbjct  1    MGIIGDIVRHPNEIYPLIKLLVTAKLAEKQIPSKPNWSFCYLMLRNISRSFSLVIQQLPL  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVC+FYLVLRALDTVEDDTSIATEVKVPILI FHRHIYD EWHF CGT  YK
Sbjct  61   ELRDAVCVFYLVLRALDTVEDDTSIATEVKVPILIAFHRHIYDHEWHFSCGTDAYK  116



>ref|XP_008796681.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=404

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYK  116



>ref|XP_008796678.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008796679.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=409

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LGA+++HP+D+Y L+KLK+A+ +I+KQIP +PHWGF YTMLQKVSRSFALVIQQL  
Sbjct  1    MGLLGAIVEHPEDLYALVKLKMASDRIKKQIPAEPHWGFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI +++KVPIL  FH HIY+R+WHF CG KDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPSDIKVPILESFHHHIYERDWHFSCGAKDYK  116



>ref|XP_010690775.1| PREDICTED: squalene synthase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SLGA++KHPD+ YPL+KLK+A  + EKQIP + HWGFCY+ML KVSRSFALVIQQL  
Sbjct  1    MVSLGAIMKHPDEFYPLLKLKMAVNKAEKQIPSEAHWGFCYSMLHKVSRSFALVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC+FYLVLRALDTVEDDTS+A +VK+PIL  FH HIYDR+WHF CGTK YK
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSLADDVKIPILRAFHEHIYDRDWHFSCGTKHYK  116



>ref|XP_006412200.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
 gb|ESQ53653.1| hypothetical protein EUTSA_v10025392mg [Eutrema salsugineum]
Length=396

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +++HPD++YPL+KLKIA  + + QIP +PH  FCY+MLQKVS+SF+LVIQQL  
Sbjct  1    MGSLSTIVRHPDEIYPLLKLKIAITKAQNQIPLEPHLAFCYSMLQKVSKSFSLVIQQLAT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYL+LRALDTVEDDTSI  E+KVPILI FHRHI+DR WHF CGTKDYK
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSIPVEIKVPILIAFHRHIFDRNWHFSCGTKDYK  116



>ref|XP_008795798.1| PREDICTED: squalene synthase-like isoform X2 [Phoenix dactylifera]
Length=373

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M  LGA+++HP+++YPL+KLK+AA +I+KQIP +PHW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MRMLGAIVEHPEELYPLVKLKMAAARIKKQIPGEPHWAFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI  ++KVPIL  FH HIYDR+WHF CGTKDY+
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPCDIKVPILESFHCHIYDRDWHFSCGTKDYR  116



>gb|AFY63035.1| squalene synthase [Alisma plantago-aquatica subsp. orientale]
Length=409

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +GA+L+HP+D+  L+KLK+A R+IEKQIPP+PHWGF YTMLQ+VSRSFA+VIQQL  
Sbjct  1    MGVVGAILEHPEDLVALLKLKVAVRKIEKQIPPEPHWGFSYTMLQRVSRSFAIVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLR LDT+EDDTSI T+ K+PIL  FH+HIYD +WHF CG KDYK
Sbjct  61   ELRNAVCIFYLVLRGLDTIEDDTSIPTDTKLPILNSFHQHIYDPDWHFSCGVKDYK  116



>ref|XP_009389044.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=408

 Score =   186 bits (473),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L AM+ HPD+VYP++KLK+A+ +I +QIP +PHW F Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMLAAMVTHPDEVYPMVKLKLASDRIRRQIPAEPHWSFSYSMLQKVSRSFALVIQQLEP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRDAVC+FYLVLRALDTVEDDTSI +++KVPIL +F+ HIYDR+WHF CG KDYK
Sbjct  61   QLRDAVCVFYLVLRALDTVEDDTSIPSDIKVPILQNFYLHIYDRKWHFSCGAKDYK  116



>ref|XP_008795796.1| PREDICTED: squalene synthase-like isoform X1 [Phoenix dactylifera]
Length=408

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M  LGA+++HP+++YPL+KLK+AA +I+KQIP +PHW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MRMLGAIVEHPEELYPLVKLKMAAARIKKQIPGEPHWAFSYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI  ++KVPIL  FH HIYDR+WHF CGTKDY+
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPCDIKVPILESFHCHIYDRDWHFSCGTKDYR  116



>gb|AGI56082.1| squalene synthase [Dendrobium catenatum]
Length=410

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG + A+L+HP+D+ PL K+ + A QI++QIPP+PHWGF Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMVKAVLEHPEDLIPLTKMMMTAEQIKRQIPPEPHWGFAYSMLQKVSRSFALVIQQLDA  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLRALDTVEDDTSI  ++KVPIL++FH+HIYDR+WHF CGT  YK
Sbjct  61   DLRNAVCIFYLVLRALDTVEDDTSIPVDIKVPILLEFHKHIYDRDWHFSCGTNAYK  116



>gb|AHB20141.2| squalene synthase [Fritillaria thunbergii]
Length=409

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +   L HP+D+Y L+K+K AA Q+EKQIPP PHW FCYTMLQKVSRSFA VIQQL  
Sbjct  1    MGMMKEALMHPEDLYVLVKMKRAAAQVEKQIPPDPHWAFCYTMLQKVSRSFAFVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC+FYLVLRALDTVEDDTSI  ++K+PIL  FHRHIY+ +WHF CGTKDYK
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPEDIKLPILESFHRHIYNPDWHFSCGTKDYK  116



>ref|XP_010447047.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +P+  FCYTML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKQIPLEPNLAFCYTMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YK
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAVEIKLPILIAFHRHIYDGDWHFSCGTKEYK  116



>ref|XP_009396917.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
 ref|XP_009396918.1| PREDICTED: squalene synthase-like [Musa acuminata subsp. malaccensis]
Length=409

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG ++ +P++VYPL+KLK+AA +I +QIP +PHW F Y+MLQKVSRSFALVIQQL  
Sbjct  1    MGMLGTVVAYPEEVYPLVKLKLAADRIRRQIPAEPHWAFSYSMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC+FYLVLRALDTVEDDTSI +++KVPIL +F+RHIYD EWHF CGTKDYK
Sbjct  61   QLRNAVCVFYLVLRALDTVEDDTSIPSDIKVPILQNFYRHIYDCEWHFSCGTKDYK  116



>ref|XP_010025621.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPD++YPL+KLK+ AR  EKQ+P QPHW FCY+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGAILKHPDELYPLLKLKMKARNAEKQLPQQPHWRFCYSMLRKFSKTFAFVIEQLPT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCI YLVLRALDTVEDDTSI  +VKVPIL  F +H++D+EWHF CGTK+ K
Sbjct  61   ELRDAVCILYLVLRALDTVEDDTSIPVDVKVPILKAFLQHVFDKEWHFSCGTKECK  116



>ref|XP_006285747.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
 gb|EOA18645.1| hypothetical protein CARUB_v10007220mg [Capsella rubella]
Length=413

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +PH  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAITKAQKQIPLEPHLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYL+LRALDTVEDDTS+  E+K+PILI FHRHIYD +WHF CGTK+YK
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVEMEIKLPILIAFHRHIYDGDWHFSCGTKEYK  116



>emb|CDX72493.1| BnaC07g45150D [Brassica napus]
Length=426

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 9/125 (7%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLC---------G  444
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C         G
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCKFYSIQTLGG  120

Query  445  TKDYK  459
            TK+YK
Sbjct  121  TKEYK  125



>ref|XP_010432387.1| PREDICTED: squalene synthase-like [Camelina sativa]
Length=413

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +KQIP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKQIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YK
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAVEIKLPILIAFHRHIYDCDWHFSCGTKEYK  116



>ref|XP_006841632.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
 gb|ERN03307.1| hypothetical protein AMTR_s00003p00232080 [Amborella trichopoda]
Length=407

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG++LKHP D+  L+KLK A+   EKQ+PP+PHW FCYTMLQKVSRSFALVIQQL  
Sbjct  1    MGKLGSLLKHPADLPALVKLKFASLYAEKQVPPEPHWAFCYTMLQKVSRSFALVIQQLEP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLR LDTVEDDTSI  +VK+PIL  FHRHIYD  WHF CGT  YK
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIPADVKLPILESFHRHIYDVNWHFSCGTNHYK  116



>emb|CDY17472.1| BnaC03g65910D [Brassica napus]
Length=426

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKD  453
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C +++
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSCKSEE  114



>ref|XP_002869132.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45391.1| squalene synthase 2 [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYL+LRALDTVEDDTSI  E KVPILI FHRH+YD  WHF CGTKDYK
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSIPMETKVPILIAFHRHLYDGGWHFSCGTKDYK  116



>gb|AAB61927.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY++L KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSILHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKF  462
            ELR+AVC+FYL+LRALDTVEDDTS+  E+KVPILI FHRHIYD +WHF CGTK+YK 
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVPVEIKVPILIAFHRHIYDGDWHFSCGTKEYKL  117



>ref|XP_010437578.1| PREDICTED: squalene synthase-like isoform X2 [Camelina sativa]
Length=407

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +K+IP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKKIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YK
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAMEIKLPILIAFHRHIYDGDWHFSCGTKEYK  116



>ref|XP_010437577.1| PREDICTED: squalene synthase-like isoform X1 [Camelina sativa]
Length=410

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLKIA  + +K+IP +P+  FCY+ML KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKIAINKAQKKIPLEPNLAFCYSMLHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYL+LRALDTVEDDTS+A E+K+PILI FHRHIYD +WHF CGTK+YK
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVAMEIKLPILIAFHRHIYDGDWHFSCGTKEYK  116



>ref|NP_195191.2| squalene synthase 2 [Arabidopsis thaliana]
 emb|CAA18844.2| putative squalene synthase [Arabidopsis thaliana]
 emb|CAB80182.1| putative squalene synthase [Arabidopsis thaliana]
 gb|AEE86404.1| squalene synthase 2 [Arabidopsis thaliana]
Length=413

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP +PH  FCY++L KVS+SF+LVIQQL  
Sbjct  1    MGSLSTILRHPDELYPLLKLKLAITKAQKQIPLEPHLAFCYSILHKVSKSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKF  462
            ELR+AVC+FYL+LRALDTVEDDTS+  E+KVPILI FHRHIYD +WHF CGTK+YK 
Sbjct  61   ELRNAVCVFYLILRALDTVEDDTSVPVEIKVPILIAFHRHIYDGDWHFSCGTKEYKL  117



>emb|CDX72494.1| BnaC07g45160D [Brassica napus]
Length=395

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L+HPD++YPL+KLK+A  + +KQIP  PH  FCY+ L KVS++F+L+IQQL  
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAITKAQKQIPLDPHLTFCYSTLNKVSKTFSLIIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVC+FYL+LRALDTVEDDTSI TE+KVPILI FHRHIYDR+WHF+CG + YK
Sbjct  61   ELRDAVCLFYLILRALDTVEDDTSIPTEIKVPILIAFHRHIYDRDWHFVCGEEKYK  116



>gb|KJB32578.1| hypothetical protein B456_005G247700 [Gossypium raimondii]
Length=406

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 6/116 (5%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA++KHPDD YPL+KLK+A+R  E+QIP +PHW FC++ML KVSRSFALVIQQL  
Sbjct  1    MGSLGALVKHPDDFYPLLKLKMASRHAERQIPSEPHWAFCFSMLHKVSRSFALVIQQLDT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            EL++AVCIFYLVLRALDTVEDDTS+AT++KVPIL +F+RHIYDR      GTK+YK
Sbjct  61   ELKNAVCIFYLVLRALDTVEDDTSVATDIKVPILKEFYRHIYDR------GTKNYK  110



>gb|AGN32410.1| squalene synthase [Dioscorea zingiberensis]
Length=409

 Score =   181 bits (460),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +GAM+++P +   L+KLK+AA +I +QIPP+ HW F YTMLQKVSRSFALVIQQL  
Sbjct  1    MGMMGAMVENPGEAVALVKLKVAAARIARQIPPEEHWAFAYTMLQKVSRSFALVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLRALDTVEDDTSI  +VKVPIL  FH HIYDR+WHF CG KDYK
Sbjct  61   ELRNAVCIFYLVLRALDTVEDDTSIPADVKVPILQAFHCHIYDRDWHFSCGAKDYK  116



>ref|XP_009591242.1| PREDICTED: squalene synthase-like [Nicotiana tomentosiformis]
Length=282

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +G +++HPD+VYPL+KL +AA+ IEK  P QPHW FC T L KVSRSFAL+IQQLP 
Sbjct  1    MGMMGKIMRHPDEVYPLMKLMLAAKLIEKGTPLQPHWAFCNTTLHKVSRSFALLIQQLPT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC++YLVLR LDTVEDDTS+ATEV+VPIL + + H YDREWHF CGTK +K
Sbjct  61   DLRNAVCVYYLVLRVLDTVEDDTSLATEVRVPILRNVYCHFYDREWHFSCGTKAFK  116



>emb|CDY45322.1| BnaA03g52950D [Brassica napus]
Length=407

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDD+YPL+K+K A  + EKQIPP+PHW FCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDIYPLLKMKRAIEKAEKQIPPEPHWAFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLC  441
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHRHIYD +WH+ C
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHRHIYDTDWHYSC  110



>emb|CDY45323.1| BnaA03g52960D [Brassica napus]
Length=218

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSL  +L HPD++YPL+KLK+A  + +KQIP  PH  FCY+ L KV ++F+L+IQQL  
Sbjct  1    MGSLSTILIHPDEIYPLLKLKLAITKAQKQIPLDPHLTFCYSTLNKVFKTFSLIIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVC+FYL+LRALDTVEDDTSI TE+KVPI I FHRHIYDR+WHF+CG + YK
Sbjct  61   ELRDAVCVFYLILRALDTVEDDTSIPTEIKVPIRIAFHRHIYDRDWHFVCGEEKYK  116



>emb|CDX69076.1| BnaC01g03770D [Brassica napus]
Length=428

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  288
            MGSL  +L+HPD++YPL+KLK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAIIKAQNQIPLDDPHLALCYSLLQKVSRSFSLVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR+WHF+CGT++YK
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPMEIKVPILLAFHRHIYDRDWHFICGTEEYK  117



>gb|KFK30098.1| hypothetical protein AALP_AA7G216700 [Arabis alpina]
Length=413

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  288
            MGSL  +L HPD++YPL KL IA  + + QIP  +PH  FCY+ML KVS+SF+LVIQQL 
Sbjct  1    MGSLSTILSHPDEIYPLFKLVIAITKAKNQIPFHEPHLAFCYSMLHKVSKSFSLVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             ELR+AVC+FYL+LRALDTVEDDTSI  E+KVPILIDFHRH+YDR+WHF CGTKDYK
Sbjct  61   TELRNAVCLFYLILRALDTVEDDTSIPIEIKVPILIDFHRHMYDRDWHFSCGTKDYK  117



>ref|XP_009110500.1| PREDICTED: squalene synthase [Brassica rapa]
Length=418

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  288
            MGSL  +L+HPD++YPL++LK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLRLKLAIMKAQNQIPLDDPHLAVCYSLLQKVSRSFSLVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR+WHF CGTK+YK
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPIEIKVPILLAFHRHIYDRDWHFTCGTKEYK  117



>gb|AAY22201.1| squalene synthase [Datura inoxia]
Length=387

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  181  ARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDT  360
            AR  EKQIPP+PHWGFCY ML KVSRSFALVIQQLP+ELRDAVCIFYLVLRALDTVEDDT
Sbjct  1    ARHAEKQIPPEPHWGFCYLMLHKVSRSFALVIQQLPVELRDAVCIFYLVLRALDTVEDDT  60

Query  361  SIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            SI T+VKVPILI FH+H+YDREWHF CGTK+YK
Sbjct  61   SIPTDVKVPILISFHQHVYDREWHFSCGTKEYK  93



>ref|XP_006651930.1| PREDICTED: squalene synthase-like [Oryza brachyantha]
Length=403

 Score =   179 bits (453),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V PL+KL++AA ++++QIPP+ HW F YTMLQKVSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRLKRQIPPEEHWAFAYTMLQKVSRSFALVIQQLGPDLRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            VCIFYLVLRALDTVEDDTSI TEVKVPIL  FH+HIY+R+WH+ CGTKDYK
Sbjct  62   VCIFYLVLRALDTVEDDTSIPTEVKVPILQQFHKHIYNRDWHYSCGTKDYK  112



>emb|CDX75451.1| BnaA01g02510D [Brassica napus]
Length=413

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIP-PQPHWGFCYTMLQKVSRSFALVIQQLP  288
            MGSL  +L+HPD++YPL+KLK+A  + + QIP   PH   CY++LQKVSRSF+LVIQQL 
Sbjct  1    MGSLSTILRHPDEIYPLLKLKLAIMKAQNQIPLDDPHLAICYSLLQKVSRSFSLVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             ELRDAVC+FYL+LRALDTVEDDTSI  E+KVPIL+ FHRHIYDR WHF CGT++YK
Sbjct  61   TELRDAVCVFYLILRALDTVEDDTSIPMEIKVPILLAFHRHIYDRGWHFTCGTEEYK  117



>gb|ACI14294.1| squalene synthase [Linum usitatissimum]
Length=271

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  193  EKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIAT  372
            EKQIPP PHWGFCYTML KVSRSFALVIQQL  ELRDAVCIFYLVLRALDTVEDDTSIAT
Sbjct  2    EKQIPPHPHWGFCYTMLLKVSRSFALVIQQLGTELRDAVCIFYLVLRALDTVEDDTSIAT  61

Query  373  EVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            EVKVPIL DFHRHIYD+EWHF CGTKDYK
Sbjct  62   EVKVPILNDFHRHIYDQEWHFSCGTKDYK  90



>ref|NP_001051625.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAA22557.1| squalene synthase [Oryza sativa Japonica Group]
 gb|AAS07223.1| squalene synthase [Oryza sativa Japonica Group]
 gb|ABF99429.1| Squalene synthetase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13539.1| Os03g0805100 [Oryza sativa Japonica Group]
 dbj|BAH01306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V PL+KL++AA +I++QIPP+ HW F YTMLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVSRSFALVIQQLGPDLRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKF  462
            VCIFYLVLRALDTVEDDTSI   VKVPIL +FHRHIY+R+WH+ CGTKDYK 
Sbjct  62   VCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDWHYSCGTKDYKL  113



>gb|EEE60131.1| hypothetical protein OsJ_13016 [Oryza sativa Japonica Group]
Length=413

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V PL+KL++AA +I++QIPP+ HW F YTMLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVLPLVKLRVAAGRIKRQIPPEEHWAFAYTMLQRVSRSFALVIQQLGPDLRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKF  462
            VCIFYLVLRALDTVEDDTSI   VKVPIL +FHRHIY+R+WH+ CGTKDYK 
Sbjct  62   VCIFYLVLRALDTVEDDTSIPAAVKVPILKEFHRHIYNRDWHYSCGTKDYKL  113



>ref|XP_010065915.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=413

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +LKHPD++Y L+KLK+ AR  EKQIP QPHW F Y+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGVILKHPDELYHLLKLKMEARNAEKQIPQQPHWRFGYSMLRKFSKTFAFVIEQLPT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCI YLVLRALDTVEDDTSI  EVKVPIL  F  H++D+EWH  CGTK  K
Sbjct  61   ELRDAVCILYLVLRALDTVEDDTSIPIEVKVPILKAFLEHVFDKEWHLSCGTKKCK  116



>ref|XP_002466259.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
 gb|EER93257.1| hypothetical protein SORBIDRAFT_01g004550 [Sorghum bicolor]
Length=403

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQLP +LR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFGYSMLQKVSRSFALVIQQLPPQLR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RHIY+R+WHF CGT  Y+
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHIYNRDWHFSCGTNHYR  112



>ref|NP_001104839.1| squalene synthase1 [Zea mays]
 dbj|BAA22558.1| squalene synthase [Zea mays]
 gb|ACN34757.1| unknown [Zea mays]
 gb|AFW67298.1| Squalene synthase isoform 1 [Zea mays]
 gb|AFW67299.1| Squalene synthase isoform 2 [Zea mays]
Length=401

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKF  462
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RHIY+R+WH+ CGT  YK 
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHIYNRDWHYSCGTNHYKM  113



>ref|NP_001130502.1| uncharacterized protein LOC100191601 [Zea mays]
 gb|ACF78747.1| unknown [Zea mays]
Length=403

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RH+Y+R+WH+ CGT  YK
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHVYNRDWHYSCGTNHYK  112



>tpg|DAA52014.1| TPA: hypothetical protein ZEAMMB73_299336 [Zea mays]
Length=403

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V  L+KL++AA QI++QIPP+ HW F Y+MLQKVSRSFALVIQQL  ELR
Sbjct  1    MGA-LSRPEEVLALVKLRVAAGQIKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGPELR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +AVCIFYLVLRALDTVEDDTSI TEVKVPIL +F+RH+Y+R+WH+ CGT  YK
Sbjct  60   NAVCIFYLVLRALDTVEDDTSIPTEVKVPILQEFYRHVYNRDWHYSCGTNHYK  112



>gb|ABI14439.1| squalene synthase [Taxus cuspidata]
Length=409

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M S+GA+LKHP+DV  L+K+K AA    KQIP  P   FCYTMLQKVSRSFA VIQQL +
Sbjct  1    MASIGAILKHPEDVPALLKMKFAAAHASKQIPLDPDLAFCYTMLQKVSRSFAFVIQQLGL  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLR LDTVEDD SI  + K+PIL +FH+HIYD  WHF CG  DYK
Sbjct  61   ELRNAVCVFYLVLRGLDTVEDDMSIPVDTKLPILTNFHQHIYDPSWHFSCGVNDYK  116



>emb|CDX75450.1| BnaA01g02520D [Brassica napus]
Length=398

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 11/116 (9%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GTK+YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTKEYK  105



>emb|CDX76294.1| BnaA08g11060D [Brassica napus]
Length=400

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 11/116 (9%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG  L++PDDVYPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTFLRYPDDVYPLLKMKRAIEKAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GTK+YK
Sbjct  61   DLRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTKEYK  105



>emb|CDX69075.1| BnaC01g03780D [Brassica napus]
Length=398

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 93/116 (80%), Gaps = 11/116 (9%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLG +L++PDD+YPL+K+K A  + EKQIPP+PHWGFCY+ML KVSRSF+LVIQQL  
Sbjct  1    MGSLGTLLRYPDDIYPLLKMKRAIERAEKQIPPEPHWGFCYSMLHKVSRSFSLVIQQLRP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVC+FYLVLRALDTVEDDTSI T+ K+PILI FHR           GT +YK
Sbjct  61   ELRNAVCVFYLVLRALDTVEDDTSIPTDEKLPILIAFHR-----------GTNEYK  105



>ref|XP_001775898.1| predicted protein [Physcomitrella patens]
 gb|EDQ59263.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +G ++KHPD++ PLIKLKIAA + +K IP  P+  FCY ML +VSRSF++VIQQL  
Sbjct  1    MGIIGTLVKHPDEIPPLIKLKIAAHRAQKAIPKDPNLAFCYRMLTRVSRSFSIVIQQLSP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVC+FYLVLR LDTVEDD +I  ++KVPIL  FH+HIYD  W F CG KDYK
Sbjct  61   ELRDAVCVFYLVLRGLDTVEDDMAIPIDIKVPILKAFHKHIYDPSWKFSCGEKDYK  116



>gb|AFJ15526.1| squalene synthase [Azadirachta indica]
Length=392

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  175  IAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVED  354
            +A R  EKQIPP+PHWGFCY+ML KVSRSF LVIQQL  +LR+AVCIFYLVLRALDTVED
Sbjct  1    MAVRHAEKQIPPEPHWGFCYSMLHKVSRSFGLVIQQLGTDLRNAVCIFYLVLRALDTVED  60

Query  355  DTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            DTSI  +VKVPILI F  H+YDR WHF CGTK+YK
Sbjct  61   DTSIPADVKVPILIAFRHHVYDRNWHFSCGTKEYK  95



>ref|XP_010025618.1| PREDICTED: squalene synthase-like [Eucalyptus grandis]
Length=407

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 91/116 (78%), Gaps = 6/116 (5%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+LKHPD+      LK+ AR  EK IP QPHW FCY+ML+K S++FA VI+QLP 
Sbjct  1    MGSLGAILKHPDE------LKMEARNAEKLIPQQPHWRFCYSMLRKFSKTFAFVIEQLPT  54

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVCI YLVLRALDTVEDDTSI   VKVPIL  F +H++D+EWH  CG+K+ K
Sbjct  55   ELRDAVCILYLVLRALDTVEDDTSIPVAVKVPILKAFLQHVFDKEWHLSCGSKECK  110



>gb|AHI96421.1| squalene synthase [Pinus massoniana]
Length=409

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+GA+LKHP+DV  L+++KIA     KQIP +P   FC+TMLQ+VSRSFA VIQQL  
Sbjct  1    MGSIGALLKHPEDVPALVRMKIAQTHALKQIPSEPDLAFCFTMLQRVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELR+AVCIFYLVLR LDTVEDDTSI  + K+PIL  F++HIYD  WHF CG   YK
Sbjct  61   ELRNAVCIFYLVLRGLDTVEDDTSIPLDTKLPILKAFYKHIYDPSWHFSCGVNHYK  116



>ref|XP_006351382.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=400

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQLPI  291
            +G ++KHPD++YPL+KL ++A+++EK+      QPHW FCY +L+KVSRSFALVIQQLP 
Sbjct  1    MGEIMKHPDELYPLMKLMLSAKRVEKKTSVWLLQPHWAFCYAILRKVSRSFALVIQQLPS  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LRD VC++YLVLRALDTVEDDTS+ TEV+VPIL DF+ H++D EWHF C T  +K
Sbjct  61   DLRDVVCVYYLVLRALDTVEDDTSLTTEVRVPILKDFYSHLHDPEWHFSCDTIAFK  116



>dbj|BAJ87710.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05111.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=404

 Score =   160 bits (405),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V  L++LK+AA +I +QIPP+ HW F Y MLQ+VSRSFALVIQQL  ELR+A
Sbjct  2    GVLSRPEEVAALVRLKVAAGRIRRQIPPEAHWAFAYDMLQRVSRSFALVIQQLGPELRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            VC+FYLVLRALDTVEDDT I  EVK+PIL DF+RHIY+ +W F CG  DY+
Sbjct  62   VCVFYLVLRALDTVEDDTGIPNEVKLPILRDFYRHIYNPDWLFSCGANDYR  112



>ref|XP_001773253.1| predicted protein [Physcomitrella patens]
 gb|EDQ61943.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +  ++KHPD++ PL+KLK+ A + ++ IP  P+  FCY ML +VSRSF++VIQQL  
Sbjct  1    MGLMETLVKHPDEIRPLVKLKVDAMRAQRAIPKDPYLAFCYRMLMRVSRSFSIVIQQLRT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVC+FYLVLR LDT+EDD +I  ++KVPIL  FH HIYD  W F+CG KDYK
Sbjct  61   ELRDAVCVFYLVLRGLDTIEDDMAIPIDIKVPILKSFHEHIYDPSWKFVCGEKDYK  116



>gb|ABK24732.1| unknown [Picea sitchensis]
Length=409

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGS+  +LKHP+DV  L+++KIA     KQIP +P   FC+TMLQ+VSRSFA VIQQL  
Sbjct  1    MGSIRTILKHPEDVPALVRMKIAQTHALKQIPSEPDLAFCFTMLQRVSRSFAFVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            +LR+AVCIFYLVLR LDTVEDDTSI  + K+PIL  F++HIYD  WHF CG KDYK
Sbjct  61   DLRNAVCIFYLVLRGLDTVEDDTSIPLDTKLPILEAFYKHIYDPSWHFSCGVKDYK  116



>ref|XP_003564211.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=402

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 5/129 (4%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELR  300
            +GA L  P++V PL+K+  AA +I +QIPPQ HW F Y MLQKVSRSFALVIQQL  +LR
Sbjct  1    MGA-LSRPEEVAPLVKMAAAAWRIRRQIPPQEHWAFAYDMLQKVSRSFALVIQQLGPDLR  59

Query  301  DAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKFSWTS--  474
            +AVCIFYLVLRALDTVEDDT + TEVK+PIL +F+RHIY+ +WHF CG   Y+    +  
Sbjct  60   NAVCIFYLVLRALDTVEDDTGVPTEVKLPILQEFYRHIYNPDWHFSCGRGHYRVLMDNFR  119

Query  475  --SIMFLLL  495
              SI FL L
Sbjct  120  HVSIAFLEL  128



>ref|XP_006351216.1| PREDICTED: squalene synthase-like [Solanum tuberosum]
Length=412

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 3/119 (3%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  282
            M  +  +L HPD++YPL+KL + A+++EK+      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MELMQEILMHPDELYPLVKLMLTAKRVEKKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  283  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +WHF CGTK +K
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWHFSCGTKAFK  119



>ref|XP_010312074.1| PREDICTED: squalene synthase-like isoform X2 [Solanum lycopersicum]
Length=384

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 3/119 (3%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  282
            MG +  +L HPD++YPLIKL ++ +++E +      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MGFMQEILMHPDELYPLIKLMLSVKRVENKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  283  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +W+F CGTK +K
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWNFSCGTKAFK  119



>ref|XP_004249733.1| PREDICTED: squalene synthase-like isoform X1 [Solanum lycopersicum]
Length=412

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 94/119 (79%), Gaps = 3/119 (3%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPP---QPHWGFCYTMLQKVSRSFALVIQQ  282
            MG +  +L HPD++YPLIKL ++ +++E +      QPHW FCY  L+KVSRSFALVIQQ
Sbjct  1    MGFMQEILMHPDELYPLIKLMLSVKRVENKTSVWLLQPHWAFCYATLRKVSRSFALVIQQ  60

Query  283  LPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            LP +LR+ VC++YLVLRALDTVEDDTS+A EV+VPIL +F+ + YD +W+F CGTK +K
Sbjct  61   LPSDLRNVVCVYYLVLRALDTVEDDTSLAIEVRVPILRNFYCNFYDPQWNFSCGTKAFK  119



>emb|CDM86349.1| unnamed protein product [Triticum aestivum]
Length=346

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V  L++LK+AA +I +QIPPQ HW F Y MLQ+VSRSFALV+QQL  +LR+A
Sbjct  2    GLLSRPEEVPALLRLKLAAGRIRRQIPPQEHWAFAYHMLQRVSRSFALVVQQLGTDLRNA  61

Query  307  VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            VCIFYLVLRALD VEDDT+I  +VK+PIL DF+RHIY+ +W F CG   Y+
Sbjct  62   VCIFYLVLRALDIVEDDTAIPNKVKLPILRDFYRHIYNLDWLFSCGENYYR  112



>gb|AEX58673.1| squalene synthase [Huperzia serrata]
Length=420

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L  +L+HP++V  L+K+K  A +++ Q+P  PH  FCY MLQKVSRSFA+VIQQL  
Sbjct  1    MGVLTTVLQHPNEVPALLKMKFMASRLKWQLPSDPHRSFCYEMLQKVSRSFAVVIQQLGP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             LRDAVC+FYLVLR LDTVEDD SI  + KVPIL  FH  IYD  W F+CG KDYK
Sbjct  61   NLRDAVCVFYLVLRGLDTVEDDMSIPLDTKVPILKAFHETIYDPAWRFVCGEKDYK  116



>ref|NP_001059129.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAC84212.1| putative squalene synthase [Oryza sativa Japonica Group]
 dbj|BAF21043.1| Os07g0200700 [Oryza sativa Japonica Group]
 dbj|BAG88654.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66758.1| hypothetical protein OsJ_23470 [Oryza sativa Japonica Group]
Length=410

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 6/120 (5%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAA----RQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQ  279
            MG +GA+L    +   L++L+ AA    R++        HW F Y+ML +VSRSFA+VIQ
Sbjct  1    MGVVGALL--GPEAEALVRLRAAAWRLRREVAAATDDDEHWAFAYSMLHRVSRSFAIVIQ  58

Query  280  QLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            QL  +LR+AVC+FYLVLRALDTVEDDTSI TE+KVPIL +FHRHIY+R+WHF CGTKD K
Sbjct  59   QLGPDLRNAVCVFYLVLRALDTVEDDTSIPTEIKVPILQEFHRHIYNRDWHFSCGTKDCK  118



>gb|AIW04729.1| squalene synthase [Dryopteris fragrans]
Length=412

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQ-PHWGFCYTMLQKVSRSFALVIQQLP  288
            MG L  +L+HP+++  L+KL+IAA  +   +P       FCY MLQ+VSRSFALVIQQL 
Sbjct  1    MGLLKGVLEHPEEIPALVKLRIAAATLRLHVPAHDADLSFCYLMLQRVSRSFALVIQQLG  60

Query  289  IELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             ELRDA+CIFYLVLRALDTVEDD SI+ + K+P+L  FH++I+D  WHF CG +DYK
Sbjct  61   TELRDAICIFYLVLRALDTVEDDMSISVDTKLPVLKSFHKNIHDPTWHFPCGERDYK  117



>ref|XP_003559279.1| PREDICTED: squalene synthase-like [Brachypodium distachyon]
Length=403

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 8/118 (7%)
 Frame = +1

Query  148  DVYPLIKLKIAARQIEKQIPPQP---HWGFCYTMLQKVSRSFALVIQQLPIELRDAVCIF  318
            +   L+KL++AA +++ QIPPQ    HW F Y MLQKVSRSFA VIQQL  +LR+AVCIF
Sbjct  6    EAVALVKLRVAAGRVKLQIPPQEEEEHWAFAYDMLQKVSRSFAFVIQQLGPDLRNAVCIF  65

Query  319  YLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDY-----KFSWTSS  477
            YL+LRALDTVEDDTSI TEVK+ IL +FHRH+Y+  WH+ CGT +Y     KF + S+
Sbjct  66   YLLLRALDTVEDDTSIPTEVKLTILQEFHRHVYNPSWHYSCGTGNYRVLMDKFRYVST  123



>ref|XP_004986173.1| PREDICTED: squalene synthase-like [Setaria italica]
Length=127

 Score =   138 bits (348),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 87/117 (74%), Gaps = 12/117 (10%)
 Frame = +1

Query  121  LGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIE-L  297
            +GA L  P++V  L+KL++AA Q+++QIPP+ HW F Y+MLQKVSRSFALVIQQL  E L
Sbjct  1    MGA-LSRPEEVVALVKLRVAAGQLKRQIPPEEHWAFAYSMLQKVSRSFALVIQQLGTECL  59

Query  298  RDA----------VCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFL  438
            R            VCIFYLVLRALDTVEDDTSI T+VKVPIL +F+RHIYD  W  L
Sbjct  60   RGVSKTAVVAIAQVCIFYLVLRALDTVEDDTSIPTDVKVPILQEFYRHIYDPNWVLL  116



>ref|XP_005851990.1| hypothetical protein CHLNCDRAFT_18492 [Chlorella variabilis]
 gb|EFN59888.1| hypothetical protein CHLNCDRAFT_18492 [Chlorella variabilis]
Length=261

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HPD++ P+  + +AAR+  KQ+P +P   FCY ML +VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLTHPDELVPMASMFMAARR-AKQLPQEPGLAFCYDMLNRVSRSFAIVIQQLPH  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDY  456
             LRDAVC+FYLVLRALDTVEDD  +  +VKVP+L  FH   YDR W   CG+ +Y
Sbjct  60   GLRDAVCVFYLVLRALDTVEDDMGLDPKVKVPLLRCFHEKSYDRSWKMSCGSGEY  114



>gb|ACF35716.1| squalene synthase 1 [Glycyrrhiza uralensis]
 gb|ACF35717.1| squalene synthase 1, partial [Glycyrrhiza uralensis]
Length=79

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPEEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTV  348
            +LR+AVCIFYLVLRALDTV
Sbjct  61   QLRNAVCIFYLVLRALDTV  79



>gb|ACF35714.1| squalene synthase 1 [Glycyrrhiza uralensis]
Length=79

 Score =   134 bits (338),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MGSLGA+ +HPDDVYPL+KLK+AAR  EKQIP +PHW FCYTML KVSRSFALVIQQL  
Sbjct  1    MGSLGAIARHPDDVYPLLKLKMAARHAEKQIPXEPHWAFCYTMLLKVSRSFALVIQQLDP  60

Query  292  ELRDAVCIFYLVLRALDTV  348
            +LR+AVCIFYLVLRALDTV
Sbjct  61   QLRNAVCIFYLVLRALDTV  79



>gb|EMT23370.1| Squalene synthetase [Aegilops tauschii]
Length=389

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 87/115 (76%), Gaps = 6/115 (5%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V  L++LK+AA +I ++IPPQ HW F Y MLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVPALVRLKLAAGRIRREIPPQEHWAFAYDMLQRVSRSFALVIQQLGPDLRNA  61

Query  307  VCIFYLVLRALDTV------EDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKD  453
            VC+FYLVLRALDTV      EDDT+I  EVK+PIL DF+RHIY+ +W F  G + 
Sbjct  62   VCVFYLVLRALDTVAISITAEDDTAIPNEVKLPILRDFYRHIYNPDWLFSFGQEQ  116



>ref|XP_011004277.1| PREDICTED: squalene synthase-like [Populus euphratica]
Length=163

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            M SLG +LKHPDD+YPL+KLK+AA+  EKQIP +PHW FCY++L +VSRSFA VIQQL  
Sbjct  1    MVSLGEILKHPDDLYPLLKLKMAAKHAEKQIPSEPHWAFCYSLLHRVSRSFAPVIQQLGT  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIAT  372
            ELR+ VCIFYLVLRALDTVEDDT+ ++
Sbjct  61   ELRNVVCIFYLVLRALDTVEDDTAESS  87



>gb|EMT03383.1| Squalene synthetase [Aegilops tauschii]
Length=450

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 90/149 (60%), Gaps = 38/149 (26%)
 Frame = +1

Query  127  AMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA  306
             +L  P++V  L++LK+AA +I +QIPPQ HW F Y MLQ+VSRSFALVIQQL  +LR+A
Sbjct  2    GVLSRPEEVPALLRLKLAAGRIRRQIPPQDHWAFAYDMLQRVSRSFALVIQQLGPDLRNA  61

Query  307  V--------------------------------------CIFYLVLRALDTVEDDTSIAT  372
            V                                      C+FYLVLRALDTVEDDT+I  
Sbjct  62   VSTQFSPFPFPSGSPPIRIPEISETFTAADVALVLTLQVCVFYLVLRALDTVEDDTAIPN  121

Query  373  EVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            EVK+PIL DF+RHIY+ +W F CG  DY+
Sbjct  122  EVKLPILRDFYRHIYNPDWLFSCGANDYR  150



>ref|XP_001417488.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95781.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=456

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L A+L HP DV PL+++K+ A    K++P  P   +CY +L KVSRSFA+VIQ+L  
Sbjct  1    MGALRAVLSHPGDVAPLVRVKMMA-NAAKRLPKDPDLAYCYDVLNKVSRSFAIVIQRLDA  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVC+FYLVLRALDTVEDD SI  E KVP L+ FH +IYD  +   CG K YK
Sbjct  60   ELRDAVCVFYLVLRALDTVEDDMSIPIERKVPDLLAFHEYIYDANYSADCGEKHYK  115



>ref|XP_003058046.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57997.1| predicted protein [Micromonas pusilla CCMP1545]
Length=454

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  +LKHP D  PL+++K+ A +  K++P +P+  FCY ML KVSRSFA+VIQQLP 
Sbjct  1    MGALTLLLKHPSDFIPLVRVKMMADK-AKKLPKEPNLAFCYDMLNKVSRSFAIVIQQLPH  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            EL+DAVCIFYLVLRALDT+EDD +I  + K P L  FH+ IYD ++ + CG K YK
Sbjct  60   ELQDAVCIFYLVLRALDTIEDDMAIPEKTKCPELEKFHQKIYDPKYVYPCGEKHYK  115



>ref|XP_011395550.1| Squalene synthase [Auxenochlorella protothecoides]
 gb|KFM22694.1| Squalene synthase [Auxenochlorella protothecoides]
Length=458

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HPD++ P+  + +AAR+    +P  P   FCY+ML KVSRSFA+VIQQLP 
Sbjct  1    MGKLGELLSHPDEIIPMAAMYLAARRA-AVLPHDPDLAFCYSMLNKVSRSFAIVIQQLPE  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDY  456
            +LRDAVC+FYLVLRALDTVEDD +I    KVPIL+ FH   Y+++W   CG   Y
Sbjct  60   QLRDAVCVFYLVLRALDTVEDDMAIDQAEKVPILLSFHEKTYEKDWSMKCGHGHY  114



>ref|XP_007512409.1| squalene synthase [Bathycoccus prasinos]
 emb|CCO17009.1| squalene synthase [Bathycoccus prasinos]
Length=462

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG++  +L+HP DV+PL+++K  A +  K++P + +  FCY ML KVSRSFA+VIQQL  
Sbjct  1    MGAISVLLRHPFDVFPLLRVKKMADEA-KKLPKEENLAFCYDMLNKVSRSFAIVIQQLDE  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREW-HFLCGTKDYK  459
            ELRDAVCIFYLVLRALDT+EDD +I    KVP L+ FH  IYD E+ H  CG K YK
Sbjct  60   ELRDAVCIFYLVLRALDTIEDDMAIDNAEKVPQLLKFHEDIYDPEYKHLTCGEKHYK  116



>ref|XP_007042048.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 ref|XP_007042049.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97879.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
 gb|EOX97880.1| Squalene synthase 1 isoform 2 [Theobroma cacao]
Length=305

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  238  MLQKVSRSFALVIQQLPIELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIY  417
            ML KVSRSFALVIQQL  +LR+AVCIFYLVLRALDTVEDDTSIAT+VKVPILIDFHRHIY
Sbjct  1    MLHKVSRSFALVIQQLDTKLRNAVCIFYLVLRALDTVEDDTSIATDVKVPILIDFHRHIY  60

Query  418  DREWHFLCGTKDYK  459
            +R+WHF CGTK YK
Sbjct  61   NRDWHFSCGTKHYK  74



>ref|XP_005651444.1| farnesyl-diphosphate farnesyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26900.1| farnesyl-diphosphate farnesyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=347

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG L  +L+HPD++ PL+++  AA++  K +P      FCY ML +VSRSFA+VIQ+LP 
Sbjct  1    MGKLREVLEHPDELIPLVQMAFAAKRA-KVLPKDKSLAFCYDMLNRVSRSFAVVIQRLPT  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDY  456
            ELRDAVC+FYLVLRALDTVEDD ++    KVP+L  FH  IYDR W   CG   Y
Sbjct  60   ELRDAVCLFYLVLRALDTVEDDMAVPVATKVPLLRVFHEKIYDRSWKMSCGYGPY  114



>ref|XP_001756673.1| predicted protein [Physcomitrella patens]
 gb|EDQ78627.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG +GA+LK+P+D++ L+KLK+A+    + IP  P+  FCY ML++VS SF++VI QL  
Sbjct  1    MGIIGAILKNPEDLHHLLKLKMASAAANRAIPSDPNLAFCYQMLRRVSGSFSIVILQLEP  60

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYKFSWT  471
             LR+AVC+FYLVLR L  VEDD +I  ++KV +L + H+ I+DR++HF CG  DYK    
Sbjct  61   GLRNAVCVFYLVLRGLQAVEDDLTIPYDLKVELLRNLHKKIFDRDFHFPCGNNDYKLLMD  120

Query  472  SSIMFLLLF  498
               + +L F
Sbjct  121  KFYLVILAF  129



>ref|XP_003078740.1| FDFT_NICBE Farnesyl-diphosphate farnesyltransferase (ISS), partial 
[Ostreococcus tauri]
Length=210

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+LG +L HP DV  L+++ + A +  K++P   +  +CY +L KVSRSFA+VIQQL  
Sbjct  1    MGALGMILTHPGDVPSLLRVAMMANRA-KRLPRDANLAYCYDVLNKVSRSFAIVIQQLDE  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVC+FYL LRALDTVEDD SI  + K+P L DFH +I+D ++   CG K Y+
Sbjct  60   ELRDAVCVFYLALRALDTVEDDMSIPIDEKLPQLYDFHEYIFDPKYSTECGEKHYR  115



>ref|XP_002946755.1| hypothetical protein VOLCADRAFT_79344 [Volvox carteri f. nagariensis]
 gb|EFJ51981.1| hypothetical protein VOLCADRAFT_79344 [Volvox carteri f. nagariensis]
Length=447

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HPD+  PL+++  AA Q   ++P  P   FCY +L  VSRSFA+VIQQLP 
Sbjct  1    MGKLGEVLSHPDEFLPLVRMARAA-QKATRLPKDPDLAFCYGILNDVSRSFAIVIQQLPN  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             LRDA+C+FYLVLR LDTVEDD ++    KVP L  FH  IYDR +   CG K YK
Sbjct  60   PLRDAICVFYLVLRGLDTVEDDMALEVSFKVPQLRSFHERIYDRGFTMACGYKHYK  115



>ref|XP_001703447.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
 gb|EDP06129.1| farnesyl-diphosphate farnesyltransferase [Chlamydomonas reinhardtii]
Length=378

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HP+++ PL+++  AA++  K +P  P   FCY ML  VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLSHPNEIMPLLRMYRAAKRATK-LPKDPDLAFCYGMLNDVSRSFAIVIQQLPN  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
             LRD++C+FYLVLR LDTVEDD ++  + K+P L  FH  IYDR +   CG   YK
Sbjct  60   PLRDSICVFYLVLRGLDTVEDDMALDVDFKLPELRRFHERIYDRGFTMECGYNHYK  115



>emb|CEF97547.1| Squalene/phytoene synthase, partial [Ostreococcus tauri]
Length=397

 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+LG +L HP DV  L+++ + A +  K++P   +  +CY +L KVSRSFA+VIQQL  
Sbjct  1    MGALGMILTHPGDVPSLLRVAMMANRA-KRLPRDANLAYCYDVLNKVSRSFAIVIQQLDE  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            ELRDAVC+FYL LRALDTVEDD SI  + K+P L DFH +I+D ++   CG K Y+
Sbjct  60   ELRDAVCVFYLALRALDTVEDDMSIPIDEKLPQLYDFHEYIFDPKYSTECGEKHYR  115



>ref|XP_002501456.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62714.1| predicted protein [Micromonas sp. RCC299]
Length=455

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG+L  +LKHP D+ PL ++K  A Q  K++P +P+  FCY ML  VSRSFA+VIQQLP 
Sbjct  1    MGALSLILKHPGDILPLYRVKCMADQA-KKLPKEPNLRFCYHMLNLVSRSFAIVIQQLPH  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            EL+DAVC+FYLVLRALDTVEDD SI  + K   L  F + IYD E+ + CG K YK
Sbjct  60   ELQDAVCVFYLVLRALDTVEDDMSIPDKPKCAELEIFWKKIYDPEYVYPCGEKHYK  115



>ref|XP_009769885.1| PREDICTED: squalene synthase-like [Nicotiana sylvestris]
Length=398

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 14/106 (13%)
 Frame = +1

Query  175  IAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPIELRDA-----------VCIFY  321
            +AA+ IEK+ P QPHW FCYT L+ VS   AL+IQQLP +LR +           VC++Y
Sbjct  2    VAAKLIEKRTPLQPHWAFCYTTLRNVS---ALLIQQLPTDLRTSLSLVNFRPTLQVCVYY  58

Query  322  LVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDYK  459
            LV RALDTVEDDTS+A EV+VPIL +F+ H YDREWHF CGT  +K
Sbjct  59   LVRRALDTVEDDTSLAIEVRVPILRNFYCHFYDREWHFSCGTNAFK  104



>gb|KIZ04121.1| farnesyl-diphosphatefarnesyltransferase [Monoraphidium neglectum]
Length=493

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +1

Query  112  MGSLGAMLKHPDDVYPLIKLKIAARQIEKQIPPQPHWGFCYTMLQKVSRSFALVIQQLPI  291
            MG LG +L HP+++ PL K+  A++Q  K +P  P   FCY +L  VSRSFA+VIQQLP 
Sbjct  1    MGKLGELLAHPEEIIPLAKMFYASKQACK-LPLDPKLAFCYDILNTVSRSFAVVIQQLPN  59

Query  292  ELRDAVCIFYLVLRALDTVEDDTSIATEVKVPILIDFHRHIYDREWHFLCGTKDY  456
             LRDA+C+FYLVLR LDTVEDD +I  + K+P L+ FH +IY   ++  CG   Y
Sbjct  60   PLRDAICVFYLVLRGLDTVEDDMAIPNDKKIPDLLKFHEYIYQPGFNMQCGYGHY  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905