BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF005B10

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006363155.1|  PREDICTED: uncharacterized protein LOC102588654    208   1e-64   Solanum tuberosum [potatoes]
ref|XP_004232611.1|  PREDICTED: deSI-like protein At4g17486             207   4e-64   Solanum lycopersicum
ref|XP_009622250.1|  PREDICTED: uncharacterized protein LOC104113704    201   1e-60   Nicotiana tomentosiformis
ref|XP_009629049.1|  PREDICTED: desumoylating isopeptidase 2-like       195   1e-60   Nicotiana tomentosiformis
ref|XP_009803660.1|  PREDICTED: uncharacterized protein LOC104248996    200   2e-60   Nicotiana sylvestris
ref|XP_008380101.1|  PREDICTED: deSI-like protein At4g17486             183   2e-54   Malus domestica [apple tree]
ref|XP_009375518.1|  PREDICTED: deSI-like protein At4g17486             182   5e-54   Pyrus x bretschneideri [bai li]
ref|XP_008376635.1|  PREDICTED: deSI-like protein At4g17486             182   6e-54   Malus domestica [apple tree]
ref|XP_010255243.1|  PREDICTED: deSI-like protein At4g17486             181   9e-54   Nelumbo nucifera [Indian lotus]
ref|XP_009368740.1|  PREDICTED: deSI-like protein At4g17486             181   1e-53   Pyrus x bretschneideri [bai li]
emb|CDP05149.1|  unnamed protein product                                181   2e-53   Coffea canephora [robusta coffee]
ref|XP_007221005.1|  hypothetical protein PRUPE_ppa010466mg             180   3e-53   Prunus persica
ref|XP_008234843.1|  PREDICTED: deSI-like protein At4g17486             179   5e-53   Prunus mume [ume]
gb|KHG28577.1|  hypothetical protein F383_12435                         179   5e-53   Gossypium arboreum [tree cotton]
gb|KHN09305.1|  UPF0326 protein                                         179   8e-53   Glycine soja [wild soybean]
ref|XP_009377608.1|  PREDICTED: deSI-like protein At4g17486             179   8e-53   Pyrus x bretschneideri [bai li]
gb|EYU19578.1|  hypothetical protein MIMGU_mgv1a012735mg                179   9e-53   Erythranthe guttata [common monkey flower]
ref|XP_004309182.1|  PREDICTED: deSI-like protein At4g17486             179   1e-52   Fragaria vesca subsp. vesca
ref|XP_011084455.1|  PREDICTED: deSI-like protein At4g17486             178   2e-52   Sesamum indicum [beniseed]
ref|XP_002273259.1|  PREDICTED: deSI-like protein At4g17486             177   3e-52   Vitis vinifera
emb|CBI22663.3|  unnamed protein product                                177   4e-52   Vitis vinifera
ref|XP_006829047.1|  hypothetical protein AMTR_s00001p00256510          176   2e-51   Amborella trichopoda
ref|XP_008439288.1|  PREDICTED: deSI-like protein At4g17486             176   2e-51   Cucumis melo [Oriental melon]
ref|XP_004140760.1|  PREDICTED: deSI-like protein At4g17486-like        176   2e-51   Cucumis sativus [cucumbers]
ref|XP_007038797.1|  PPPDE thiol peptidase family protein, putati...    176   2e-51   
ref|XP_002305910.1|  hypothetical protein POPTR_0004s07790g             176   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010671635.1|  PREDICTED: deSI-like protein At4g17486             174   5e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB37310.1|  hypothetical protein B456_006G199100                    175   8e-51   Gossypium raimondii
ref|XP_003533983.1|  PREDICTED: UPF0326 protein At4g17486-like          174   9e-51   Glycine max [soybeans]
ref|XP_010105750.1|  hypothetical protein L484_014240                   174   1e-50   Morus notabilis
ref|XP_010276907.1|  PREDICTED: desumoylating isopeptidase 2-like       173   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_007152194.1|  hypothetical protein PHAVU_004G109400g             174   1e-50   Phaseolus vulgaris [French bean]
ref|XP_011043866.1|  PREDICTED: uncharacterized protein LOC105139200    174   2e-50   Populus euphratica
ref|XP_004234227.1|  PREDICTED: desumoylating isopeptidase 2            173   2e-50   Solanum lycopersicum
gb|KJB34156.1|  hypothetical protein B456_006G050800                    172   3e-50   Gossypium raimondii
ref|XP_010555681.1|  PREDICTED: deSI-like protein At4g17486             172   4e-50   Tarenaya hassleriana [spider flower]
ref|XP_006353912.1|  PREDICTED: deSI-like protein At4g17486-like        171   6e-50   Solanum tuberosum [potatoes]
ref|XP_010448389.1|  PREDICTED: deSI-like protein At4g17486             171   8e-50   Camelina sativa [gold-of-pleasure]
gb|EPS61570.1|  hypothetical protein M569_13226                         171   8e-50   Genlisea aurea
gb|KDP22234.1|  hypothetical protein JCGZ_26065                         171   1e-49   Jatropha curcas
ref|XP_010433598.1|  PREDICTED: deSI-like protein At4g17486             171   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009109194.1|  PREDICTED: deSI-like protein At4g17486             171   1e-49   Brassica rapa
emb|CDX89402.1|  BnaA01g14910D                                          171   1e-49   
ref|XP_009798709.1|  PREDICTED: deSI-like protein At4g17486             171   1e-49   Nicotiana sylvestris
ref|XP_010433604.1|  PREDICTED: uncharacterized protein LOC104717692    171   1e-49   Camelina sativa [gold-of-pleasure]
emb|CDX94426.1|  BnaC01g17580D                                          171   2e-49   
gb|AFK44900.1|  unknown                                                 171   2e-49   Lotus japonicus
emb|CDX89404.1|  BnaA01g14890D                                          170   2e-49   
emb|CDX94429.1|  BnaC01g17550D                                          170   2e-49   
ref|XP_009139416.1|  PREDICTED: deSI-like protein At4g17486             170   2e-49   Brassica rapa
ref|XP_006422019.1|  hypothetical protein CICLE_v10005686mg             170   3e-49   Citrus clementina [clementine]
ref|XP_010035174.1|  PREDICTED: deSI-like protein At4g17486             170   3e-49   Eucalyptus grandis [rose gum]
ref|XP_003606789.1|  PPPDE peptidase domain-containing protein          170   4e-49   
ref|NP_194296.1|  PPPDE putative thiol peptidase family protein         169   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438844.1|  PREDICTED: uncharacterized protein LOC104722396    169   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006284399.1|  hypothetical protein CARUB_v10005569mg             169   6e-49   Capsella rubella
ref|XP_008796908.1|  PREDICTED: deSI-like protein At4g17486 isofo...    167   7e-49   
gb|KFK29065.1|  hypothetical protein AALP_AA7G084100                    169   8e-49   Arabis alpina [alpine rockcress]
ref|XP_006413282.1|  hypothetical protein EUTSA_v10026034mg             169   9e-49   Eutrema salsugineum [saltwater cress]
ref|XP_006413284.1|  hypothetical protein EUTSA_v10026072mg             169   9e-49   Eutrema salsugineum [saltwater cress]
ref|NP_194298.1|  PPPDE putative thiol peptidase family protein         169   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139388.1|  PREDICTED: deSI-like protein At4g17486             169   1e-48   Brassica rapa
ref|XP_002869660.1|  hypothetical protein ARALYDRAFT_492258             168   2e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_006284384.1|  hypothetical protein CARUB_v10005552mg             168   2e-48   Capsella rubella
ref|XP_011038376.1|  PREDICTED: uncharacterized protein LOC105135271    168   2e-48   Populus euphratica
emb|CDY49480.1|  BnaCnng17460D                                          168   2e-48   Brassica napus [oilseed rape]
gb|KFK29064.1|  hypothetical protein AALP_AA7G083900                    167   2e-48   Arabis alpina [alpine rockcress]
ref|XP_010448394.1|  PREDICTED: uncharacterized protein LOC104730857    168   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_011076114.1|  PREDICTED: uncharacterized protein LOC105160...    167   3e-48   
ref|XP_010933984.1|  PREDICTED: desumoylating isopeptidase 2-like       167   3e-48   Elaeis guineensis
ref|XP_011076113.1|  PREDICTED: uncharacterized protein LOC105160...    168   3e-48   Sesamum indicum [beniseed]
ref|XP_008796907.1|  PREDICTED: uncharacterized protein LOC103712...    167   3e-48   Phoenix dactylifera
ref|XP_006372440.1|  hypothetical protein POPTR_0017s01650g             167   3e-48   
ref|XP_006661997.1|  PREDICTED: desumoylating isopeptidase 2-like       167   4e-48   Oryza brachyantha
ref|XP_003574249.1|  PREDICTED: desumoylating isopeptidase 2-like       167   4e-48   Brachypodium distachyon [annual false brome]
ref|XP_008796906.1|  PREDICTED: deSI-like protein sdu1 isoform X1       167   5e-48   
tpg|DAA46059.1|  TPA: hypothetical protein ZEAMMB73_195984              165   6e-48   
ref|XP_004513185.1|  PREDICTED: uncharacterized protein LOC101510879    167   6e-48   Cicer arietinum [garbanzo]
ref|XP_010537155.1|  PREDICTED: deSI-like protein At4g17486             166   9e-48   Tarenaya hassleriana [spider flower]
ref|NP_001143918.1|  uncharacterized protein LOC100276728               166   1e-47   Zea mays [maize]
gb|KJB23840.1|  hypothetical protein B456_004G117500                    166   2e-47   Gossypium raimondii
ref|XP_006422020.1|  hypothetical protein CICLE_v10005686mg             166   2e-47   
ref|NP_001065158.1|  Os10g0533900                                       165   2e-47   
ref|XP_004983828.1|  PREDICTED: deSI-like protein hag1-like             165   2e-47   Setaria italica
gb|KJB23839.1|  hypothetical protein B456_004G117500                    166   2e-47   Gossypium raimondii
gb|EEC67357.1|  hypothetical protein OsI_34457                          165   3e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_008807844.1|  PREDICTED: desumoylating isopeptidase 2-like       164   4e-47   Phoenix dactylifera
gb|AFK48534.1|  unknown                                                 164   5e-47   Medicago truncatula
ref|XP_002869661.1|  hypothetical protein ARALYDRAFT_914007             164   7e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_002467590.1|  hypothetical protein SORBIDRAFT_01g030660          163   1e-46   Sorghum bicolor [broomcorn]
ref|XP_008794771.1|  PREDICTED: uncharacterized protein LOC103710694    164   1e-46   
gb|KHG21774.1|  hypothetical protein F383_27627                         163   2e-46   Gossypium arboreum [tree cotton]
ref|XP_009382250.1|  PREDICTED: deSI-like protein At4g17486 isofo...    162   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010228135.1|  PREDICTED: desumoylating isopeptidase 2-like...    161   2e-46   
ref|XP_010941159.1|  PREDICTED: uncharacterized protein LOC105059531    163   3e-46   
ref|XP_009411427.1|  PREDICTED: uncharacterized protein LOC103993183    162   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382251.1|  PREDICTED: desumoylating isopeptidase 2-like...    161   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB34157.1|  hypothetical protein B456_006G050800                    161   1e-45   Gossypium raimondii
ref|XP_006279084.1|  hypothetical protein CARUB_v10012715mg             168   2e-45   
ref|XP_004966587.1|  PREDICTED: uncharacterized protein LOC101773931    160   3e-45   Setaria italica
ref|XP_003557265.2|  PREDICTED: uncharacterized protein LOC100845...    160   3e-45   Brachypodium distachyon [annual false brome]
ref|XP_002436336.1|  hypothetical protein SORBIDRAFT_10g000670          159   7e-45   Sorghum bicolor [broomcorn]
ref|XP_008376975.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    164   1e-44   
ref|XP_004496529.1|  PREDICTED: deSI-like protein At4g17486-like        156   4e-44   Cicer arietinum [garbanzo]
gb|EPS69052.1|  hypothetical protein M569_05713                         155   8e-44   Genlisea aurea
ref|XP_009386602.1|  PREDICTED: uncharacterized protein LOC103973689    155   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008659380.1|  PREDICTED: uncharacterized protein LOC103638177    155   4e-43   Zea mays [maize]
ref|XP_003592207.1|  PPPDE peptidase domain-containing protein          153   4e-43   
gb|AES62458.2|  PPPDE thiol peptidase family protein, putative          153   5e-43   Medicago truncatula
gb|EMT20329.1|  hypothetical protein F775_52552                         154   1e-42   
gb|EMS56568.1|  hypothetical protein TRIUR3_04780                       158   1e-42   Triticum urartu
gb|EEE64952.1|  hypothetical protein OsJ_19839                          152   4e-42   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79844.1|  hypothetical protein OsI_21315                          152   4e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_001784588.1|  predicted protein                                  144   5e-40   
gb|EMS61224.1|  hypothetical protein TRIUR3_07091                       146   1e-39   Triticum urartu
ref|XP_001762496.1|  predicted protein                                  138   1e-37   
ref|XP_009385238.1|  PREDICTED: uncharacterized protein LOC103972614    139   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004987201.1|  PREDICTED: deSI-like protein At4g17486-like        140   1e-37   Setaria italica
ref|XP_002968463.1|  hypothetical protein SELMODRAFT_16111              130   8e-35   
ref|XP_002509086.1|  predicted protein                                  122   4e-32   Micromonas commoda
ref|XP_003061681.1|  predicted protein                                  122   1e-31   Micromonas pusilla CCMP1545
gb|KDO56773.1|  hypothetical protein CISIN_1g025261mg                   122   6e-31   Citrus sinensis [apfelsine]
ref|XP_006422021.1|  hypothetical protein CICLE_v10005686mg             122   7e-31   
ref|XP_003535600.1|  PREDICTED: deSI-like protein At4g17486-like        122   7e-31   Glycine max [soybeans]
ref|XP_002513658.1|  conserved hypothetical protein                     122   1e-30   
ref|XP_006490645.1|  PREDICTED: uncharacterized protein LOC102607...    120   1e-30   
ref|XP_001764813.1|  predicted protein                                  115   1e-28   
emb|CEF99575.1|  PPPDE putative peptidase domain                        113   8e-28   Ostreococcus tauri
gb|KCW46466.1|  hypothetical protein EUGRSUZ_K002931                    112   2e-27   Eucalyptus grandis [rose gum]
gb|KCW46465.1|  hypothetical protein EUGRSUZ_K002931                    112   2e-27   Eucalyptus grandis [rose gum]
emb|CDY54090.1|  BnaC08g47300D                                          118   2e-27   Brassica napus [oilseed rape]
ref|XP_007509551.1|  predicted protein                                  112   6e-27   Bathycoccus prasinos
ref|XP_003081907.1|  putative protein (ISS)                             114   7e-27   
ref|XP_009621011.1|  PREDICTED: uncharacterized protein LOC104112711    110   1e-26   Nicotiana tomentosiformis
emb|CDY52367.1|  BnaA08g31020D                                          115   1e-26   Brassica napus [oilseed rape]
ref|XP_009109196.1|  PREDICTED: uncharacterized protein LOC103834...    112   2e-25   Brassica rapa
ref|XP_001701830.1|  predicted protein                                  105   1e-23   Chlamydomonas reinhardtii
ref|XP_001420272.1|  predicted protein                                  100   4e-23   Ostreococcus lucimarinus CCE9901
ref|XP_002782648.1|  hypothetical protein Pmar_PMAR021197             92.4    7e-19   Perkinsus marinus ATCC 50983
ref|XP_008659205.1|  PREDICTED: deSI-like protein At4g17486           84.3    8e-17   Zea mays [maize]
gb|AFW85568.1|  hypothetical protein ZEAMMB73_042236                  84.3    8e-17   
gb|EEC80134.1|  hypothetical protein OsI_21921                        83.2    3e-16   Oryza sativa Indica Group [Indian rice]
gb|KDO56774.1|  hypothetical protein CISIN_1g025261mg                 81.3    5e-16   Citrus sinensis [apfelsine]
gb|ACU22856.1|  unknown                                               79.7    2e-15   Glycine max [soybeans]
emb|CDY62507.1|  BnaC04g56370D                                        80.1    3e-15   Brassica napus [oilseed rape]
ref|XP_003560998.1|  PREDICTED: deSI-like protein At4g17486           80.1    3e-15   Brachypodium distachyon [annual false brome]
ref|XP_009140629.1|  PREDICTED: deSI-like protein At4g17486           79.7    4e-15   Brassica rapa
emb|CDY35370.1|  BnaA04g14770D                                        79.7    4e-15   Brassica napus [oilseed rape]
ref|NP_001056566.2|  Os06g0107000                                     79.0    4e-15   
ref|NP_565588.1|  PPPDE putative thiol peptidase-like protein         79.0    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32585.1|  hypothetical protein AALP_AA6G262400                  78.6    9e-15   Arabis alpina [alpine rockcress]
ref|XP_006655688.1|  PREDICTED: uncharacterized protein LOC102722...  78.2    9e-15   
ref|XP_002878832.1|  hypothetical protein ARALYDRAFT_481377           78.2    1e-14   
ref|XP_009117078.1|  PREDICTED: deSI-like protein At4g17486           77.8    2e-14   Brassica rapa
ref|XP_006405117.1|  hypothetical protein EUTSA_v10000310mg           77.8    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_010472522.1|  PREDICTED: deSI-like protein At4g17486           77.4    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006294896.1|  hypothetical protein CARUB_v10023946mg           77.4    3e-14   Capsella rubella
ref|XP_009037509.1|  hypothetical protein AURANDRAFT_6447             74.7    4e-14   Aureococcus anophagefferens
gb|ACJ85321.1|  unknown                                               76.3    4e-14   Medicago truncatula
ref|XP_010417284.1|  PREDICTED: deSI-like protein At4g17486           76.6    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002437960.1|  hypothetical protein SORBIDRAFT_10g005540        76.6    5e-14   
emb|CDX76766.1|  BnaC08g33520D                                        76.3    6e-14   
ref|XP_010429510.1|  PREDICTED: deSI-like protein At4g17486           76.3    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002140825.1|  hypothetical protein                             75.9    9e-14   Cryptosporidium muris RN66
emb|CDY56277.1|  BnaA09g55810D                                        77.8    1e-13   Brassica napus [oilseed rape]
ref|XP_008452873.1|  PREDICTED: deSI-like protein At4g17486           74.3    3e-13   Cucumis melo [Oriental melon]
emb|CDJ26229.1|  hypothetical protein                                 73.9    3e-13   Brassica oleracea
ref|XP_009383188.1|  PREDICTED: deSI-like protein At4g17486           73.9    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009126505.1|  PREDICTED: deSI-like protein At4g17486           73.6    5e-13   Brassica rapa
emb|CDX68806.1|  BnaC01g06470D                                        74.3    5e-13   
ref|XP_004145512.1|  PREDICTED: deSI-like protein At4g17486-like      73.6    5e-13   Cucumis sativus [cucumbers]
ref|XP_010665872.1|  PREDICTED: deSI-like protein At4g17486           73.2    6e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009039394.1|  hypothetical protein AURANDRAFT_7483             71.2    6e-13   Aureococcus anophagefferens
ref|XP_010526233.1|  PREDICTED: deSI-like protein At4g17486           73.2    7e-13   Tarenaya hassleriana [spider flower]
emb|CBI21088.3|  unnamed protein product                              72.8    7e-13   Vitis vinifera
ref|XP_008445255.1|  PREDICTED: deSI-like protein At4g17486           72.8    8e-13   Cucumis melo [Oriental melon]
ref|NP_001174638.1|  Os06g0182100                                     73.2    9e-13   
ref|XP_011036649.1|  PREDICTED: deSI-like protein At4g17486           72.8    9e-13   Populus euphratica
ref|XP_004138707.1|  PREDICTED: deSI-like protein At4g17486-like      72.8    1e-12   Cucumis sativus [cucumbers]
gb|EXX77625.1|  hypothetical protein RirG_022140                      71.6    1e-12   Rhizophagus irregularis DAOM 197198w
ref|XP_009032180.1|  hypothetical protein AURANDRAFT_19518            72.0    1e-12   Aureococcus anophagefferens
gb|KFH04834.1|  putative PPPDE peptidase domain protein               72.4    1e-12   Toxoplasma gondii MAS
ref|XP_002324900.1|  hypothetical protein POPTR_0018s02300g           72.0    2e-12   Populus trichocarpa [western balsam poplar]
gb|EXX77624.1|  hypothetical protein RirG_022140                      71.6    2e-12   Rhizophagus irregularis DAOM 197198w
emb|CDP18789.1|  unnamed protein product                              71.6    2e-12   Coffea canephora [robusta coffee]
ref|XP_010942141.1|  PREDICTED: deSI-like protein At4g17486           71.2    3e-12   
ref|XP_010648702.1|  PREDICTED: deSI-like protein At4g17486           71.2    3e-12   Vitis vinifera
ref|XP_008808226.1|  PREDICTED: deSI-like protein At4g17486           71.2    3e-12   Phoenix dactylifera
ref|XP_011039595.1|  PREDICTED: deSI-like protein At4g17486           71.2    3e-12   Populus euphratica
ref|XP_006285485.1|  hypothetical protein CARUB_v10006919mg           73.9    3e-12   
gb|KFG50460.1|  putative PPPDE peptidase domain protein               72.0    4e-12   Toxoplasma gondii p89
ref|XP_009394943.1|  PREDICTED: deSI-like protein At4g17486           70.9    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412534.1|  hypothetical protein EUTSA_v10025954mg           71.2    4e-12   Eutrema salsugineum [saltwater cress]
ref|XP_002309663.2|  hypothetical protein POPTR_0006s27740g           70.9    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_008883291.1|  hypothetical protein HHA_256780                  72.8    5e-12   
ref|XP_004291942.1|  PREDICTED: deSI-like protein At4g17486           70.5    5e-12   Fragaria vesca subsp. vesca
gb|EYU32380.1|  hypothetical protein MIMGU_mgv1a013824mg              70.5    5e-12   Erythranthe guttata [common monkey flower]
ref|XP_010929119.1|  PREDICTED: deSI-like protein At4g17486           70.5    6e-12   Elaeis guineensis
ref|XP_008605728.1|  hypothetical protein SDRG_01949                  70.1    7e-12   Saprolegnia diclina VS20
ref|XP_821729.1|  hypothetical protein                                70.1    7e-12   Trypanosoma cruzi strain CL Brener
gb|KFK29811.1|  hypothetical protein AALP_AA7G181900                  70.1    7e-12   Arabis alpina [alpine rockcress]
gb|EPR63050.1|  hypothetical protein TGGT1_256780                     72.4    8e-12   Toxoplasma gondii GT1
gb|AAL38722.1|  unknown protein                                       70.1    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005704609.1|  hypothetical protein Gasu_44260                  69.7    8e-12   Galdieria sulphuraria
gb|EPT29210.1|  hypothetical protein TGME49_256780                    72.0    8e-12   Toxoplasma gondii ME49
gb|KFG64955.1|  putative PPPDE peptidase domain protein               72.0    8e-12   Toxoplasma gondii RUB
ref|XP_001347354.2|  PPPDE peptidase, putative                        69.7    9e-12   Plasmodium falciparum 3D7
ref|XP_009794916.1|  PREDICTED: deSI-like protein At4g17486           69.3    9e-12   Nicotiana sylvestris
gb|KFK27777.1|  hypothetical protein AALP_AA8G427400                  69.7    1e-11   Arabis alpina [alpine rockcress]
gb|KDO30954.1|  hypothetical protein SPRG_04142                       69.3    1e-11   Saprolegnia parasitica CBS 223.65
gb|KDO17263.1|  hypothetical protein SPRG_17305                       69.3    1e-11   Saprolegnia parasitica CBS 223.65
ref|XP_002869301.1|  predicted protein                                72.4    1e-11   
ref|XP_001681304.1|  hypothetical protein LMJF_09_1310                69.7    1e-11   Leishmania major strain Friedlin
ref|XP_008378831.1|  PREDICTED: deSI-like protein At4g17486           69.3    1e-11   Malus domestica [apple tree]
ref|XP_002364925.1|  hypothetical protein, conserved                  70.9    1e-11   
ref|XP_002951862.1|  hypothetical protein VOLCADRAFT_92471            71.2    1e-11   Volvox carteri f. nagariensis
gb|ADE75652.1|  unknown                                               69.7    1e-11   Picea sitchensis
emb|CDY65538.1|  BnaCnng47550D                                        69.3    1e-11   Brassica napus [oilseed rape]
ref|XP_002515452.1|  conserved hypothetical protein                   69.3    2e-11   Ricinus communis
ref|XP_953566.1|  hypothetical protein                                70.9    2e-11   Theileria annulata
ref|XP_009151042.1|  PREDICTED: deSI-like protein At4g17486           68.9    2e-11   Brassica rapa
gb|KDP33538.1|  hypothetical protein JCGZ_07109                       69.3    2e-11   Jatropha curcas
emb|CDY07077.1|  BnaA04g22380D                                        68.9    2e-11   
ref|XP_008377676.1|  PREDICTED: deSI-like protein At4g17486           68.9    2e-11   Malus domestica [apple tree]
ref|XP_007223906.1|  hypothetical protein PRUPE_ppa010937mg           68.9    2e-11   Prunus persica
ref|XP_667786.1|  hypothetical protein                                69.3    2e-11   Cryptosporidium hominis TU502
ref|XP_626306.1|  protease                                            69.3    2e-11   Cryptosporidium parvum Iowa II
ref|XP_006450315.1|  hypothetical protein CICLE_v10009362mg           68.9    2e-11   Citrus clementina [clementine]
ref|XP_818745.1|  hypothetical protein                                68.6    2e-11   Trypanosoma cruzi strain CL Brener
ref|XP_006288624.1|  hypothetical protein CARUB_v10001926mg           68.6    2e-11   Capsella rubella
ref|XP_004833685.1|  hypothetical protein BEWA_042710                 69.7    3e-11   Theileria equi strain WA
gb|EKG02185.1|  hypothetical protein TCSYLVIO_006794                  69.7    3e-11   Trypanosoma cruzi
ref|XP_003603314.1|  hypothetical protein MTR_3g106240                68.2    3e-11   Medicago truncatula
ref|XP_010313710.1|  PREDICTED: deSI-like protein At4g17486 isofo...  68.6    3e-11   Solanum lycopersicum
ref|XP_006394766.1|  hypothetical protein EUTSA_v10004898mg           68.2    3e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006366865.1|  PREDICTED: deSI-like protein At4g17486-like      68.2    3e-11   Solanum tuberosum [potatoes]
gb|AFK46726.1|  unknown                                               68.2    3e-11   Lotus japonicus
ref|XP_004251588.1|  PREDICTED: deSI-like protein At4g17486 isofo...  68.2    3e-11   Solanum lycopersicum
ref|XP_006596080.1|  PREDICTED: deSI-like protein At4g17486-like ...  68.2    3e-11   Glycine max [soybeans]
ref|XP_010245553.1|  PREDICTED: deSI-like protein At4g17486           68.2    3e-11   Nelumbo nucifera [Indian lotus]
ref|NP_194926.1|  uncharacterized protein                             70.9    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KHG11379.1|  hypothetical protein F383_11015                       68.6    3e-11   Gossypium arboreum [tree cotton]
gb|AFK47902.1|  unknown                                               68.2    4e-11   Lotus japonicus
ref|XP_009035395.1|  hypothetical protein AURANDRAFT_7465             67.0    4e-11   Aureococcus anophagefferens
ref|XP_010421363.1|  PREDICTED: deSI-like protein At4g17486           67.8    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009593660.1|  PREDICTED: deSI-like protein At4g17486           67.8    4e-11   Nicotiana tomentosiformis
ref|XP_009390569.1|  PREDICTED: deSI-like protein At4g17486           68.2    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003881761.1|  hypothetical protein NCLIV_015220                70.1    4e-11   Neospora caninum Liverpool
ref|XP_003544599.1|  PREDICTED: deSI-like protein At4g17486-like ...  67.8    4e-11   Glycine max [soybeans]
emb|CDU19249.1|  PPPDE peptidase, putative                            67.8    5e-11   Plasmodium yoelii
gb|ESS65763.1|  hypothetical protein TCDM_05734                       68.9    5e-11   Trypanosoma cruzi Dm28c
ref|XP_010089948.1|  hypothetical protein L484_014459                 67.8    5e-11   Morus notabilis
ref|NP_568467.1|  PPPDE putative thiol peptidase family protein       67.8    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003091095.1|  hypothetical protein CRE_24283                   69.3    5e-11   Caenorhabditis remanei
ref|XP_009032864.1|  hypothetical protein AURANDRAFT_6216             66.6    5e-11   Aureococcus anophagefferens
ref|XP_010265674.1|  PREDICTED: deSI-like protein At4g17486           67.4    5e-11   Nelumbo nucifera [Indian lotus]
gb|KHG02026.1|  hypothetical protein F383_26397                       67.4    6e-11   Gossypium arboreum [tree cotton]
ref|XP_010493765.1|  PREDICTED: deSI-like protein At4g17486           67.4    6e-11   Camelina sativa [gold-of-pleasure]
gb|ERZ99306.1|  hypothetical protein GLOINDRAFT_64218                 66.2    7e-11   
ref|XP_006846873.1|  hypothetical protein AMTR_s00150p00063670        67.0    8e-11   Amborella trichopoda
gb|EPS65739.1|  hypothetical protein M569_09039                       67.4    8e-11   Genlisea aurea
ref|XP_007154966.1|  hypothetical protein PHAVU_003G161600g           67.0    8e-11   Phaseolus vulgaris [French bean]
ref|XP_009630833.1|  PREDICTED: deSI-like protein At4g17486           67.0    8e-11   Nicotiana tomentosiformis
ref|XP_009797716.1|  PREDICTED: deSI-like protein At4g17486 isofo...  67.0    8e-11   Nicotiana sylvestris
ref|XP_002948920.1|  hypothetical protein VOLCADRAFT_73996            66.6    9e-11   Volvox carteri f. nagariensis
ref|XP_007215933.1|  hypothetical protein PRUPE_ppa011077mg           67.0    9e-11   Prunus persica
emb|CDS49037.1|  PPPDE peptidase, putative                            67.0    9e-11   
ref|XP_009797717.1|  PREDICTED: deSI-like protein At4g17486 isofo...  67.0    9e-11   Nicotiana sylvestris
ref|XP_009689993.1|  uncharacterized protein TOT_010001146            67.8    9e-11   Theileria orientalis strain Shintoku
ref|XP_010532093.1|  PREDICTED: deSI-like protein At4g17486 isofo...  67.0    9e-11   Tarenaya hassleriana [spider flower]
ref|XP_010532094.1|  PREDICTED: deSI-like protein At4g17486 isofo...  67.0    9e-11   Tarenaya hassleriana [spider flower]
ref|XP_008228762.1|  PREDICTED: deSI-like protein At4g17486           66.6    1e-10   Prunus mume [ume]
ref|XP_008806296.1|  PREDICTED: deSI-like protein At4g17486 isofo...  66.6    1e-10   Phoenix dactylifera
emb|CDP10368.1|  unnamed protein product                              66.6    1e-10   Coffea canephora [robusta coffee]
ref|XP_010537889.1|  PREDICTED: deSI-like protein At4g17486 isofo...  66.6    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_010537890.1|  PREDICTED: deSI-like protein At4g17486 isofo...  66.6    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_011082192.1|  PREDICTED: deSI-like protein At4g17486           66.6    1e-10   Sesamum indicum [beniseed]
ref|XP_007011755.1|  PPPDE thiol peptidase family protein, putative   66.2    1e-10   
ref|XP_010914798.1|  PREDICTED: deSI-like protein At4g17486           66.6    1e-10   Elaeis guineensis
gb|KJB56555.1|  hypothetical protein B456_009G124800                  65.9    1e-10   
ref|XP_004501368.1|  PREDICTED: deSI-like protein At4g17486-like      66.2    1e-10   
gb|KJB68410.1|  hypothetical protein B456_010G243600                  66.6    1e-10   
gb|KJB68408.1|  hypothetical protein B456_010G243600                  66.6    1e-10   
ref|XP_008806295.1|  PREDICTED: deSI-like protein At4g17486 isofo...  66.2    2e-10   
ref|XP_006427585.1|  hypothetical protein CICLE_v10027044mg           66.2    2e-10   
ref|XP_010688066.1|  PREDICTED: deSI-like protein At4g17486 isofo...  66.2    2e-10   
gb|KJB20963.1|  hypothetical protein B456_003G176000                  65.5    2e-10   
ref|XP_010688067.1|  PREDICTED: deSI-like protein At4g17486 isofo...  65.9    2e-10   
ref|XP_006465205.1|  PREDICTED: deSI-like protein At4g17486-like      65.9    2e-10   
gb|KEH28639.1|  PPPDE thiol peptidase family protein, putative        66.2    2e-10   
gb|KJB56553.1|  hypothetical protein B456_009G124800                  65.5    2e-10   
gb|KHF98012.1|  hypothetical protein F383_11751                       65.9    2e-10   
gb|KEH40779.1|  PPPDE thiol peptidase family protein, putative        66.2    2e-10   
gb|KHG29638.1|  hypothetical protein F383_14095                       65.9    2e-10   
gb|EPS60489.1|  hypothetical protein M569_14316                       65.9    2e-10   
emb|CDR14475.1|  PPPDE peptidase, putative                            65.5    2e-10   
ref|XP_011073354.1|  PREDICTED: deSI-like protein At4g17486           65.9    3e-10   
ref|XP_007136969.1|  hypothetical protein PHAVU_009G089100g           65.5    3e-10   
gb|KDP41995.1|  hypothetical protein JCGZ_27013                       65.5    3e-10   
ref|XP_004508531.1|  PREDICTED: deSI-like protein At4g17486-like ...  65.5    3e-10   
ref|XP_003549929.1|  PREDICTED: deSI-like protein At4g17486-like ...  65.5    3e-10   
emb|CDY05376.1|  BnaC02g40840D                                        65.5    3e-10   
ref|XP_010092174.1|  hypothetical protein L484_013492                 65.5    3e-10   
ref|XP_004498191.1|  PREDICTED: deSI-like protein At4g17486-like ...  65.5    3e-10   
ref|XP_004238234.1|  PREDICTED: deSI-like protein At4g17486           65.5    3e-10   
gb|EYU45120.1|  hypothetical protein MIMGU_mgv1a012349mg              65.1    4e-10   
ref|NP_001136827.1|  uncharacterized protein LOC100216975             65.1    4e-10   
gb|KJB56554.1|  hypothetical protein B456_009G124800                  64.3    4e-10   
ref|XP_009129982.1|  PREDICTED: deSI-like protein At4g17486           65.1    4e-10   
gb|KJB14532.1|  hypothetical protein B456_002G129500                  64.7    4e-10   
ref|NP_001240886.1|  uncharacterized protein LOC100777596             65.5    4e-10   
ref|XP_003529195.1|  PREDICTED: deSI-like protein At4g17486-like ...  65.5    4e-10   
ref|XP_002872143.1|  hypothetical protein ARALYDRAFT_910561           64.7    5e-10   
gb|AAF14657.1|AC011713_5  Contains similarity to gb|AF151904 CGI-...  65.1    5e-10   
ref|NP_565243.1|  PPPDE putative thiol peptidase family protein       64.7    5e-10   
gb|KJB65896.1|  hypothetical protein B456_010G117900                  64.7    5e-10   
ref|NP_001241385.1|  uncharacterized protein LOC100778961             64.7    5e-10   
ref|XP_004498779.1|  PREDICTED: deSI-like protein At4g17486-like      64.7    5e-10   
ref|XP_008474133.1|  PREDICTED: desumoylating isopeptidase 2 isof...  64.3    5e-10   
gb|EYU45119.1|  hypothetical protein MIMGU_mgv1a012349mg              65.1    6e-10   
ref|XP_001977781.1|  GG18051                                          64.3    6e-10   
gb|KJB20964.1|  hypothetical protein B456_003G176000                  64.7    6e-10   
gb|KIZ00541.1|  hypothetical protein MNEG_7426                        66.6    6e-10   
ref|XP_011074513.1|  PREDICTED: deSI-like protein At4g17486           64.7    6e-10   
ref|XP_007013353.1|  PPPDE thiol peptidase family protein, putati...  64.3    7e-10   
ref|XP_007161150.1|  hypothetical protein PHAVU_001G046700g           64.3    7e-10   
emb|CDY39951.1|  BnaC06g40290D                                        64.3    7e-10   
ref|XP_001691631.1|  predicted protein                                63.5    7e-10   
ref|XP_010939637.1|  PREDICTED: deSI-like protein At4g17486 isofo...  64.3    7e-10   
ref|XP_009106726.1|  PREDICTED: deSI-like protein At4g17486 isofo...  64.3    7e-10   
gb|EYU21715.1|  hypothetical protein MIMGU_mgv1a024619mg              64.3    7e-10   
ref|XP_009106725.1|  PREDICTED: deSI-like protein At4g17486 isofo...  64.3    7e-10   
ref|XP_010684633.1|  PREDICTED: deSI-like protein At4g17486 isofo...  64.7    7e-10   
ref|XP_003550204.1|  PREDICTED: deSI-like protein At4g17486-like      64.3    8e-10   
ref|XP_011083723.1|  PREDICTED: deSI-like protein At4g17486           64.7    8e-10   
ref|XP_009175460.1|  hypothetical protein T265_10736                  66.6    8e-10   
gb|KJB14531.1|  hypothetical protein B456_002G129500                  64.3    8e-10   
gb|KHG08805.1|  hypothetical protein F383_13118                       63.9    9e-10   
ref|XP_010454838.1|  PREDICTED: deSI-like protein At4g17486           63.9    9e-10   
ref|XP_010474509.1|  PREDICTED: deSI-like protein At4g17486           64.3    9e-10   
gb|KHJ87619.1|  hypothetical protein OESDEN_12604                     64.3    9e-10   
ref|XP_010033686.1|  PREDICTED: deSI-like protein At4g17486           63.9    1e-09   
ref|XP_004515519.1|  PREDICTED: deSI-like protein At4g17486-like      63.9    1e-09   
emb|CDO97080.1|  unnamed protein product                              63.5    1e-09   
ref|XP_010429923.1|  PREDICTED: deSI-like protein At4g17486 isofo...  63.9    1e-09   
ref|XP_010429922.1|  PREDICTED: deSI-like protein At4g17486 isofo...  63.9    1e-09   
gb|EJW77487.1|  hypothetical protein WUBG_11601                       64.7    1e-09   
ref|XP_010048906.1|  PREDICTED: deSI-like protein At4g17486           63.9    1e-09   
ref|XP_010417673.1|  PREDICTED: deSI-like protein At4g17486 isofo...  63.9    1e-09   
ref|XP_004235927.1|  PREDICTED: deSI-like protein At4g17486           63.9    1e-09   
ref|XP_010417675.1|  PREDICTED: deSI-like protein At4g17486 isofo...  63.9    1e-09   
gb|EKF30630.1|  hypothetical protein MOQ_005554                       63.9    1e-09   
ref|XP_007013354.1|  PPPDE thiol peptidase family protein, putati...  64.7    1e-09   
ref|XP_006367307.1|  PREDICTED: deSI-like protein At4g17486-like      64.7    1e-09   
ref|XP_008474132.1|  PREDICTED: desumoylating isopeptidase 2 isof...  63.5    1e-09   
tpg|DAA42785.1|  TPA: hypothetical protein ZEAMMB73_870848            63.9    1e-09   
ref|XP_003526223.1|  PREDICTED: uncharacterized LOC100306675          63.5    1e-09   
ref|XP_004303257.1|  PREDICTED: deSI-like protein At4g17486           63.5    1e-09   
gb|EYU37765.1|  hypothetical protein MIMGU_mgv1a012328mg              63.9    1e-09   
gb|EMT10608.1|  hypothetical protein F775_22117                       63.9    1e-09   
ref|XP_007135801.1|  hypothetical protein PHAVU_010G159700g           63.5    1e-09   
ref|XP_006389825.1|  hypothetical protein EUTSA_v10019085mg           63.5    1e-09   
ref|XP_006389824.1|  hypothetical protein EUTSA_v10019085mg           63.5    1e-09   
ref|XP_011088352.1|  PREDICTED: deSI-like protein At4g17486           63.9    1e-09   
ref|XP_009774099.1|  PREDICTED: deSI-like protein At4g17486           63.5    1e-09   
ref|XP_006341367.1|  PREDICTED: deSI-like protein At4g17486-like ...  63.5    1e-09   
ref|XP_002101021.1|  GE17382                                          63.2    2e-09   
ref|XP_002887815.1|  hypothetical protein ARALYDRAFT_477178           63.5    2e-09   
ref|XP_008347733.1|  PREDICTED: deSI-like protein At4g17486           62.4    2e-09   
gb|KCW64251.1|  hypothetical protein EUGRSUZ_G01894                   63.9    2e-09   
ref|XP_003559047.1|  PREDICTED: deSI-like protein At4g17486           63.5    2e-09   
ref|XP_008375463.1|  PREDICTED: deSI-like protein At4g17486           63.5    2e-09   
ref|XP_008461171.1|  PREDICTED: deSI-like protein At4g17486           63.5    2e-09   
ref|XP_003081736.1|  unnamed protein product                          63.2    2e-09   
ref|XP_010066376.1|  PREDICTED: deSI-like protein At4g17486           63.5    2e-09   
gb|EMS58594.1|  hypothetical protein TRIUR3_25311                     63.2    2e-09   
gb|KEH39865.1|  PPPDE thiol peptidase family protein, putative        63.2    2e-09   
gb|KJB83142.1|  hypothetical protein B456_013G233100                  63.2    2e-09   
ref|XP_006650944.1|  PREDICTED: deSI-like protein At4g17486-like      63.2    2e-09   
emb|CEF99458.1|  PPPDE putative peptidase domain                      63.2    2e-09   
ref|XP_006304132.1|  hypothetical protein CARUB_v10010094mg           63.5    2e-09   
ref|XP_009363938.1|  PREDICTED: LOW QUALITY PROTEIN: deSI-like pr...  63.2    2e-09   
gb|ACR35423.1|  unknown                                               63.9    2e-09   
ref|XP_007138318.1|  hypothetical protein PHAVU_009G198600g           63.2    2e-09   
ref|XP_003523969.1|  PREDICTED: deSI-like protein At4g17486-like      63.2    2e-09   
gb|KHN35524.1|  UPF0326 protein                                       63.2    2e-09   
ref|XP_002468708.1|  hypothetical protein SORBIDRAFT_01g050610        63.2    2e-09   
emb|CDX79359.1|  BnaC06g19440D                                        63.2    2e-09   
tpg|DAA42784.1|  TPA: hypothetical protein ZEAMMB73_870848            63.9    2e-09   
tpg|DAA42783.1|  TPA: EREBP-4 like protein                            63.9    2e-09   
ref|XP_010501867.1|  PREDICTED: deSI-like protein At4g17486           63.9    2e-09   
ref|XP_010479174.1|  PREDICTED: deSI-like protein At4g17486           63.9    2e-09   
gb|KFK42450.1|  hypothetical protein AALP_AA2G258500                  63.2    2e-09   
gb|KFK42451.1|  hypothetical protein AALP_AA2G258500                  63.2    2e-09   
gb|ACJ85570.1|  unknown                                               62.8    2e-09   
ref|XP_002527317.1|  conserved hypothetical protein                   63.2    2e-09   
ref|XP_010063553.1|  PREDICTED: deSI-like protein At4g17486           63.2    2e-09   
emb|CDP07553.1|  unnamed protein product                              63.2    2e-09   
gb|KDP32364.1|  hypothetical protein JCGZ_13289                       62.8    2e-09   
ref|XP_004245799.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.8    2e-09   
ref|XP_004252784.1|  PREDICTED: deSI-like protein At4g17486           63.2    2e-09   
ref|XP_010325507.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.8    2e-09   
ref|XP_006359243.1|  PREDICTED: deSI-like protein At4g17486-like ...  62.8    2e-09   
ref|XP_008242727.1|  PREDICTED: deSI-like protein At4g17486 isofo...  63.9    2e-09   
ref|XP_006342596.1|  PREDICTED: deSI-like protein At4g17486-like ...  63.2    2e-09   
ref|XP_008337328.1|  PREDICTED: deSI-like protein At4g17486           62.8    2e-09   
gb|KHN06115.1|  UPF0326 protein                                       62.8    2e-09   
ref|XP_009797371.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.8    2e-09   
ref|XP_003858815.1|  hypothetical protein, unknown function           63.2    2e-09   
ref|XP_001463594.1|  hypothetical protein, unknown function           63.2    3e-09   
ref|XP_002297801.1|  hypothetical protein POPTR_0001s14750g           62.8    3e-09   
ref|XP_008242728.1|  PREDICTED: deSI-like protein At4g17486 isofo...  63.5    3e-09   
ref|XP_007202644.1|  hypothetical protein PRUPE_ppa012132mg           62.4    3e-09   
ref|XP_004169614.1|  PREDICTED: deSI-like protein At4g17486-like      62.8    3e-09   
ref|XP_011034507.1|  PREDICTED: deSI-like protein At4g17486           62.8    3e-09   
ref|XP_010690923.1|  PREDICTED: deSI-like protein At4g17486           63.2    3e-09   
gb|AFK35683.1|  unknown                                               62.8    3e-09   
ref|XP_010049967.1|  PREDICTED: deSI-like protein At4g17486           62.4    3e-09   
gb|KJB79500.1|  hypothetical protein B456_013G052800                  62.8    3e-09   
ref|XP_010461570.1|  PREDICTED: deSI-like protein At4g17486           63.5    3e-09   
ref|XP_003872813.1|  hypothetical protein, unknown function           63.2    3e-09   
ref|XP_006302776.1|  hypothetical protein CARUB_v10020909mg           62.4    3e-09   
gb|AAM65611.1|  unknown                                               62.8    3e-09   
gb|ACJ85718.1|  unknown                                               62.4    3e-09   
ref|XP_002285036.1|  PREDICTED: deSI-like protein At4g17486           62.4    3e-09   
ref|XP_010325510.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.4    3e-09   
gb|KJB51817.1|  hypothetical protein B456_008G232900                  62.4    3e-09   
ref|XP_010325511.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.4    3e-09   
gb|KJB51816.1|  hypothetical protein B456_008G232900                  62.4    4e-09   
ref|XP_010275412.1|  PREDICTED: deSI-like protein At4g17486           62.4    4e-09   
dbj|BAJ99847.1|  predicted protein                                    62.0    4e-09   
ref|XP_006302777.1|  hypothetical protein CARUB_v10020909mg           62.4    4e-09   
gb|ABR16395.1|  unknown                                               62.4    4e-09   
ref|XP_010322656.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.8    4e-09   
ref|XP_002524445.1|  conserved hypothetical protein                   62.4    4e-09   
ref|XP_008447052.1|  PREDICTED: deSI-like protein At4g17486           63.2    4e-09   
ref|XP_004508944.1|  PREDICTED: deSI-like protein At4g17486-like      62.0    4e-09   
ref|XP_009614901.1|  PREDICTED: deSI-like protein At4g17486           62.4    4e-09   
gb|KJB51815.1|  hypothetical protein B456_008G232900                  61.6    4e-09   
ref|XP_009797369.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.4    4e-09   
ref|XP_009593866.1|  PREDICTED: deSI-like protein At4g17486           62.4    4e-09   
ref|XP_009399806.1|  PREDICTED: deSI-like protein At4g17486           62.0    4e-09   
ref|XP_009855348.1|  hypothetical protein NEUTE1DRAFT_89354           62.4    4e-09   
ref|XP_002304720.2|  hypothetical protein POPTR_0003s17880g           62.0    4e-09   
gb|KCW46463.1|  hypothetical protein EUGRSUZ_K002932                  59.3    4e-09   
ref|NP_001241211.1|  uncharacterized protein LOC100797619             62.0    5e-09   
gb|ACU14336.1|  unknown                                               61.6    5e-09   
ref|XP_003563754.1|  PREDICTED: deSI-like protein At4g17486           62.0    5e-09   
ref|XP_009782757.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.0    5e-09   
gb|EYU19272.1|  hypothetical protein MIMGU_mgv1a013313mg              62.0    5e-09   
gb|KFH64847.1|  hypothetical protein MVEG_09576                       61.6    5e-09   
ref|XP_011494016.1|  PREDICTED: desumoylating isopeptidase 2          61.6    5e-09   
ref|XP_009782759.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.0    5e-09   
gb|AFK49245.1|  unknown                                               62.0    5e-09   
ref|XP_011081298.1|  PREDICTED: deSI-like protein At4g17486           62.0    5e-09   
ref|XP_003523676.1|  PREDICTED: deSI-like protein At4g17486-like      62.0    5e-09   
ref|XP_009104477.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.0    5e-09   
gb|KHN29613.1|  UPF0326 protein                                       61.6    5e-09   
gb|AES91453.2|  PPPDE thiol peptidase family protein, putative        61.6    5e-09   
ref|NP_001148832.1|  EREBP-4 like protein                             61.6    5e-09   
ref|XP_008454170.1|  PREDICTED: deSI-like protein At4g17486           62.0    5e-09   
ref|XP_009104478.1|  PREDICTED: deSI-like protein At4g17486 isofo...  62.0    5e-09   
ref|XP_002891381.1|  hypothetical protein ARALYDRAFT_473914           62.8    6e-09   
gb|KHG03781.1|  hypothetical protein F383_26901                       61.6    6e-09   
ref|NP_564513.1|  PPPDE putative thiol peptidase family protein       62.8    6e-09   
ref|XP_010089496.1|  hypothetical protein L484_006047                 62.0    6e-09   
ref|NP_001048648.1|  Os03g0100900                                     62.0    6e-09   
ref|XP_008354379.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.6    6e-09   
ref|XP_003608667.1|  EREBP-4 like protein                             61.6    6e-09   
ref|XP_008354380.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.6    6e-09   
ref|XP_004152389.1|  PREDICTED: deSI-like protein At4g17486-like      61.6    6e-09   
gb|KHN44096.1|  UPF0326 protein                                       61.6    6e-09   
ref|XP_003524060.1|  PREDICTED: uncharacterized LOC100306242 isof...  61.6    6e-09   
ref|XP_008790840.1|  PREDICTED: deSI-like protein At4g17486           61.6    7e-09   
ref|XP_010677099.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.6    7e-09   
ref|XP_010677100.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.6    7e-09   
ref|XP_004152173.1|  PREDICTED: deSI-like protein At4g17486-like      61.6    7e-09   
ref|XP_007157262.1|  hypothetical protein PHAVU_002G056000g           61.6    7e-09   
gb|AFK36138.1|  unknown                                               61.6    7e-09   
ref|XP_009613780.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.6    7e-09   
ref|XP_009768218.1|  PREDICTED: deSI-like protein At4g17486           62.0    7e-09   
ref|XP_006856111.1|  hypothetical protein AMTR_s00059p00140900        61.2    7e-09   
ref|NP_001242588.1|  uncharacterized protein LOC100788399             61.6    7e-09   
ref|XP_009613792.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.6    7e-09   
ref|XP_009613798.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.6    7e-09   
ref|XP_006647624.1|  PREDICTED: deSI-like protein At4g17486-like      61.2    7e-09   
emb|CDJ81973.1|  Protein of unknown function DUF862 domain contai...  60.8    7e-09   
ref|XP_004953329.1|  PREDICTED: deSI-like protein At4g17486-like      61.2    7e-09   
ref|XP_009613786.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.6    7e-09   
ref|XP_009606009.1|  PREDICTED: deSI-like protein At4g17486           62.0    7e-09   
gb|ACN25150.1|  unknown                                               61.2    7e-09   
emb|CEF62991.1|  Desumoylating isopeptidase 2                         61.2    8e-09   
ref|XP_003531729.1|  PREDICTED: deSI-like protein At4g17486-like      61.2    8e-09   
gb|EGT35336.1|  hypothetical protein CAEBREN_20584                    62.8    8e-09   
ref|XP_009389905.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.2    8e-09   
gb|KJB25512.1|  hypothetical protein B456_004G195500                  60.8    8e-09   
gb|KJB79502.1|  hypothetical protein B456_013G052800                  61.6    8e-09   
ref|XP_009397566.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.2    8e-09   
ref|XP_009397565.1|  PREDICTED: deSI-like protein At4g17486 isofo...  61.2    8e-09   
gb|ACG25871.1|  EREBP-4 like protein                                  61.2    8e-09   



>ref|XP_006363155.1| PREDICTED: uncharacterized protein LOC102588654 [Solanum tuberosum]
Length=212

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 111/134 (83%), Gaps = 1/134 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILH+YD+T S  G+D VN+ VVQMN+LLKD I  GG+FH AVQ+Y  VEWAYG  +
Sbjct  1    MAEVILHVYDITKS-DGHDAVNFGVVQMNRLLKDTIYFGGIFHTAVQVYDNVEWAYGSCE  59

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            KGSG+FSCPATKNPNYT+RE I  GRT CS+ KVN ILK+LRD WPG++Y++VSRNSKHF
Sbjct  60   KGSGVFSCPATKNPNYTHREKIVLGRTECSAHKVNQILKDLRDAWPGNKYNMVSRNSKHF  119

Query  422  CQELLEKLGVPKLP  463
            C E LEKLGVPKLP
Sbjct  120  CDEFLEKLGVPKLP  133



>ref|XP_004232611.1| PREDICTED: deSI-like protein At4g17486 [Solanum lycopersicum]
Length=213

 Score =   207 bits (526),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILH+YDLT S  G D VN+ VVQMN+LLKD I+ GG+FH AVQ+Y  VEWAYG   
Sbjct  1    MAEVILHVYDLTKS-DGQDAVNFGVVQMNRLLKDTISFGGMFHTAVQVYDNVEWAYGSCV  59

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCPATKNPNYTYRE I  GRT CS+ KVN ILK+LRD WPG +Y++VSRNSKHF
Sbjct  60   IGSGVFSCPATKNPNYTYREKIVLGRTECSAHKVNQILKDLRDAWPGSKYNMVSRNSKHF  119

Query  422  CQELLEKLGVPKLP  463
            C E LEKLGVPKLP
Sbjct  120  CDEFLEKLGVPKLP  133



>ref|XP_009622250.1| PREDICTED: uncharacterized protein LOC104113704 [Nicotiana tomentosiformis]
Length=292

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+L++YD+  SG G+D  N+ VVQMN LLKDGIN GG+FH AVQ+YG  EWAYGH +
Sbjct  1    MAEVVLYVYDMNKSG-GHDAHNFAVVQMNNLLKDGINFGGLFHTAVQVYGNDEWAYGHTN  59

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            KGSG+F+CPA KNP+YT RE I  GRT CS SKVN ILKEL D WPG++Y+ VSRNSKHF
Sbjct  60   KGSGVFTCPAGKNPSYTIREKIILGRTECSPSKVNKILKELSDSWPGNKYNFVSRNSKHF  119

Query  422  CQELLEKLGVPKLPA  466
              ELLE+LGVPKLP 
Sbjct  120  SNELLERLGVPKLPG  134



>ref|XP_009629049.1| PREDICTED: desumoylating isopeptidase 2-like [Nicotiana tomentosiformis]
Length=138

 Score =   195 bits (496),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+L++YD+  SG G+D  N  VVQMN LLKDGIN GG+FH AVQIYG  EWAYGH +
Sbjct  1    MAEVVLYVYDMNKSG-GHDAHNLAVVQMNNLLKDGINFGGLFHTAVQIYGNDEWAYGHTN  59

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            KGSG+FSCP  KNP+YT RE I  GRT  SSSKVN ILKEL D WPG++Y+ VSRNSKHF
Sbjct  60   KGSGVFSCPVGKNPSYTIREKIILGRTEYSSSKVNKILKELSDSWPGNKYNFVSRNSKHF  119

Query  422  CQELLEKLGVPKLPA  466
              ELLE+LGVPKLP 
Sbjct  120  SNELLERLGVPKLPG  134



>ref|XP_009803660.1| PREDICTED: uncharacterized protein LOC104248996 [Nicotiana sylvestris]
Length=292

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+L++YD+  SG G+D  N+ VVQMN LLKDGIN GG+FH AVQIYG  EWAYGH +
Sbjct  1    MAEVVLYVYDMNKSG-GHDAHNFAVVQMNNLLKDGINFGGLFHTAVQIYGNDEWAYGHTN  59

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            KGSG+FSCPA KNP+YT RE I  GRTH S SKVN ILKEL D WPG++Y+ VSRNSKHF
Sbjct  60   KGSGVFSCPAGKNPSYTLREKIIMGRTHGSPSKVNKILKELIDSWPGNKYNFVSRNSKHF  119

Query  422  CQELLEKLGVPKLPA  466
              ELLE+LGVPKLP 
Sbjct  120  SNELLERLGVPKLPG  134



>ref|XP_008380101.1| PREDICTED: deSI-like protein At4g17486 [Malus domestica]
Length=248

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRESI  G THCS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTHCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGVPKLP 
Sbjct  119  CDELCERLGVPKLPG  133



>ref|XP_009375518.1| PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri]
 ref|XP_009377548.1| PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri]
Length=249

 Score =   182 bits (462),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRESI  G THCS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTHCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGVP+LP 
Sbjct  119  CDELCERLGVPRLPG  133



>ref|XP_008376635.1| PREDICTED: deSI-like protein At4g17486 [Malus domestica]
Length=249

 Score =   182 bits (462),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRESI  G T CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTDCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGVPKLP 
Sbjct  119  CDELCERLGVPKLPG  133



>ref|XP_010255243.1| PREDICTED: deSI-like protein At4g17486 [Nelumbo nucifera]
Length=246

 Score =   181 bits (460),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEVILH+YD+T SG      N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVILHVYDVTNSGSAK--TNNTIVQINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP++KNP YTYRE I  G T+ S  KVN IL+EL  EWPGD Y L+S+N  HF
Sbjct  59   QGSGVFSCPSSKNPMYTYRECIVLGNTNFSIFKVNQILRELSREWPGDSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLPA
Sbjct  119  CDEFCERLGVPKLPA  133



>ref|XP_009368740.1| PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri]
Length=249

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YGE EW++G+ +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRESI  G T CS  KVN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTDCSIFKVNQILRELSREWPGYSYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGVPKLP 
Sbjct  119  CDELCERLGVPKLPG  133



>emb|CDP05149.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEVILHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQIYG+ EW++G  +
Sbjct  1    MTEVILHIYDVTNSG--SDKTNNTIVQINKIFKDGIGLGGIFHSAVQIYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCPA KNP YTYRE I  G T+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPAAKNPMYTYREPIILGTTNSSIFKVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGVPKLP 
Sbjct  119  CDELCERLGVPKLPG  133



>ref|XP_007221005.1| hypothetical protein PRUPE_ppa010466mg [Prunus persica]
 gb|EMJ22204.1| hypothetical protein PRUPE_ppa010466mg [Prunus persica]
Length=249

 Score =   180 bits (457),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAIQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRE I  G T+CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRECITLGTTNCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFSERLGVPKLPG  133



>ref|XP_008234843.1| PREDICTED: deSI-like protein At4g17486 [Prunus mume]
Length=249

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAIQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRE I  G T CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRECITLGTTDCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFSERLGVPKLPG  133



>gb|KHG28577.1| hypothetical protein F383_12435 [Gossypium arboreum]
Length=250

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV LHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MTEVRLHIYDVTNSG--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRES+  GRT+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESMVLGRTNFSKLKVNQILQELSREWPGSSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  EKLGV KLP 
Sbjct  119  CDEFCEKLGVQKLPG  133



>gb|KHN09305.1| UPF0326 protein [Glycine soja]
Length=245

 Score =   179 bits (454),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+V+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ++G+ EW++G  +
Sbjct  1    MTDVVLHIYDVTNSG--SEKTNNTIVQINKIFKDGIGLGGIFHSAVQVFGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRESI  G+T+CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRESIVLGKTNCSIFKVNQILRELSREWPGSSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>ref|XP_009377608.1| PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri]
Length=249

 Score =   179 bits (454),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRESI  G THCS  KVN IL+EL  EW G  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTHCSIFKVNQILRELSREWSGYSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGVP+LP 
Sbjct  119  CDELCERLGVPRLPG  133



>gb|EYU19578.1| hypothetical protein MIMGU_mgv1a012735mg [Erythranthe guttata]
Length=241

 Score =   179 bits (453),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILH+YD+T SG  N+  N  ++Q+NK+ KDGI+LGG+FH AVQ+YG+ EW++G+ +
Sbjct  1    MMEVILHVYDVTNSG--NEKTNNTIMQINKIFKDGISLGGIFHSAVQVYGDDEWSFGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+TKNP YTYRESI  G+T  S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSTKNPMYTYRESIKLGQTSFSIFKVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>ref|XP_004309182.1| PREDICTED: deSI-like protein At4g17486 [Fragaria vesca subsp. 
vesca]
Length=247

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNSTIMQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRESI  G T CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTDCSIFKVNQILRELSREWPGYTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGVPKLP 
Sbjct  119  CDELCERLGVPKLPG  133



>ref|XP_011084455.1| PREDICTED: deSI-like protein At4g17486 [Sesamum indicum]
Length=248

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV LH+YD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVTLHVYDVTNSG--SEKTNNTIMQINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+TKNP YTYRESI  GRT  S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSTKNPMYTYRESIKLGRTSFSIYKVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>ref|XP_002273259.1| PREDICTED: deSI-like protein At4g17486 [Vitis vinifera]
Length=247

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = +2

Query  53   ISKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG  232
            ++   EV+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G
Sbjct  1    MTTTMEVVLHIYDVTNSG--SEKTNNTIVQINKIFKDGIGLGGIFHSAVQVYGDDEWSFG  58

Query  233  HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  412
              ++G+G+FSCPA+KNP YTYRE I  GRT+ S  KVN IL+EL  EWPG  Y L+++N 
Sbjct  59   FCEQGTGVFSCPASKNPMYTYRECIVLGRTNFSIFKVNQILRELSREWPGSSYDLLAKNC  118

Query  413  KHFCQELLEKLGVPKLPA  466
             HFC EL EKLGVPKLP 
Sbjct  119  NHFCDELCEKLGVPKLPG  136



>emb|CBI22663.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            EV+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G  ++G
Sbjct  2    EVVLHIYDVTNSG--SEKTNNTIVQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCEQG  59

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            +G+FSCPA+KNP YTYRE I  GRT+ S  KVN IL+EL  EWPG  Y L+++N  HFC 
Sbjct  60   TGVFSCPASKNPMYTYRECIVLGRTNFSIFKVNQILRELSREWPGSSYDLLAKNCNHFCD  119

Query  428  ELLEKLGVPKLPA  466
            EL EKLGVPKLP 
Sbjct  120  ELCEKLGVPKLPG  132



>ref|XP_006829047.1| hypothetical protein AMTR_s00001p00256510 [Amborella trichopoda]
 gb|ERM96463.1| hypothetical protein AMTR_s00001p00256510 [Amborella trichopoda]
Length=252

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILHIYD+T SG      N  +V +NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MPEVILHIYDVTNSGSA--KTNNTIVNINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  KNP Y YRESI  G T  S SKVN IL+EL  EWPG+ Y L+SRN  HF
Sbjct  59   NGSGVFSCPPCKNPMYAYRESIALGETGFSISKVNQILRELSREWPGNSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C +L E+LGVPKLPA
Sbjct  119  CDQLCERLGVPKLPA  133



>ref|XP_008439288.1| PREDICTED: deSI-like protein At4g17486 [Cucumis melo]
Length=253

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+VILHIYD+T SG   D  N  +V +NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTDVILHIYDVTNSGS--DKTNNTIVNINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ +NP YTYRESI  GRT+CS  KVN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFSCPSGQNPMYTYRESINLGRTNCSIFKVNQILRELSREWPGSSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C +  E L V KLP 
Sbjct  119  CDQFCEMLNVSKLPG  133



>ref|XP_004140760.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 ref|XP_004157182.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 gb|KGN57407.1| hypothetical protein Csa_3G183900 [Cucumis sativus]
Length=251

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+VILHIYD+T SG   D  N  +V +NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTDVILHIYDVTNSGS--DKTNNTIVNINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ +NP YTYRESI  GRT+CS  KVN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFSCPSGQNPMYTYRESINLGRTNCSIFKVNQILRELSREWPGSSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C +  E L V KLP 
Sbjct  119  CDQFCEMLNVSKLPG  133



>ref|XP_007038797.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007038798.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007038799.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23298.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23299.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23300.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
Length=280

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP++KNP YTYRE +  GRT+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSSKNPMYTYREFMVLGRTNFSIFKVNQILRELSREWPGSSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  ++LGV KLP 
Sbjct  119  CDEFCKRLGVQKLPG  133



>ref|XP_002305910.1| hypothetical protein POPTR_0004s07790g [Populus trichocarpa]
 gb|EEE86421.1| hypothetical protein POPTR_0004s07790g [Populus trichocarpa]
Length=268

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEVILH+YD+T SG  ++  N  ++ +NK+ KD I LGG+FH AVQI+G+ EW++G  +
Sbjct  1    MTEVILHVYDVTNSG--SEKTNNTILNINKIFKDAIGLGGIFHSAVQIHGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP++KNP YTYRE I  G+T CS  KVN IL+EL  EWPGD Y L+++N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTSCSIFKVNQILRELSREWPGDAYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>ref|XP_010671635.1| PREDICTED: deSI-like protein At4g17486 [Beta vulgaris subsp. 
vulgaris]
Length=247

 Score =   174 bits (442),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            +V+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  ++G
Sbjct  2    DVVLHIYDVTNSG--SDKTNNTIMQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCEQG  59

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            +G+FSCP TKNP YTYRE I  G+T+ S+SKVN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  60   TGVFSCPITKNPMYTYREKIVLGQTNLSNSKVNQILRELSREWPGFSYDLLSRNCNHFCD  119

Query  428  ELLEKLGVPKLPA  466
            EL E+L VPKLP 
Sbjct  120  ELCERLDVPKLPG  132



>gb|KJB37310.1| hypothetical protein B456_006G199100 [Gossypium raimondii]
Length=283

 Score =   175 bits (443),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = +2

Query  59   KMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR  238
            KM EVILH+YD+T S   +D  N  +VQ+NK+ KDGI LGG+FH AVQ+YGE EW++G  
Sbjct  3    KMMEVILHVYDVTNSE--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFC  60

Query  239  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  418
            ++GSG+FSCP+ KNP YTYRES+  GRT+ S  KVN IL+EL  EWPG  Y L+S+N  H
Sbjct  61   EQGSGVFSCPSGKNPMYTYRESVVLGRTNFSIFKVNQILRELSREWPGSSYDLLSKNCNH  120

Query  419  FCQELLEKLGVPKLPA  466
            FC +  E+LGV KLP 
Sbjct  121  FCDDFCERLGVQKLPG  136



>ref|XP_003533983.1| PREDICTED: UPF0326 protein At4g17486-like [Glycine max]
 gb|KHN03676.1| UPF0326 protein [Glycine soja]
Length=248

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+V+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ++G+ EW++G  +
Sbjct  1    MTDVVLHIYDVTNSG--SEKTNSTIVQINKIFKDGIGLGGIFHSAVQVFGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRESI  G+T+ S  K+N IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRESIVLGKTNFSIFKLNQILRELSREWPGSSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>ref|XP_010105750.1| hypothetical protein L484_014240 [Morus notabilis]
 gb|EXC05970.1| hypothetical protein L484_014240 [Morus notabilis]
Length=251

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV LHIYD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MAEVKLHIYDVTNSG--SEKTNNTILQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRESI  G T+C++ K N IL+EL  EWPG+ Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRESIVLGTTNCTNLKANQILRELSREWPGNSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E+LGVPKLP 
Sbjct  119  CDVFCERLGVPKLPG  133



>ref|XP_010276907.1| PREDICTED: desumoylating isopeptidase 2-like [Nelumbo nucifera]
Length=230

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILHIYD+T SG      N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAEVILHIYDITNSGSA--KTNNTIVQINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP++KNP YT+RE I  G+T+    KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTHREHIVLGKTNFPIFKVNQILRELSREWPGSSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLPA
Sbjct  119  CDEFCERLGVPKLPA  133



>ref|XP_007152194.1| hypothetical protein PHAVU_004G109400g [Phaseolus vulgaris]
 gb|ESW24188.1| hypothetical protein PHAVU_004G109400g [Phaseolus vulgaris]
Length=253

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+V+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ+Y E EW++G  D
Sbjct  1    MTDVVLHIYDVTNSG--SEKTNNTIVQINKIFKDGIGLGGIFHSAVQVYDEDEWSFGFCD  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRESI  G+T+    KVN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRESIVLGKTNFPCLKVNQILRELSREWPGSSYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>ref|XP_011043866.1| PREDICTED: uncharacterized protein LOC105139200 [Populus euphratica]
Length=268

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEVILH+YD+T SG  ++  N  ++ +NK+ KD I LGG+FH AVQI+G+ EW++G  +
Sbjct  1    MTEVILHVYDVTNSG--SEKTNNTILNINKIFKDAIGLGGIFHSAVQIHGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP++KNP YTYRE I  G+T CS  KVN IL+EL  EWPG +Y L+++N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTSCSIFKVNQILRELSREWPGSDYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>ref|XP_004234227.1| PREDICTED: desumoylating isopeptidase 2 [Solanum lycopersicum]
Length=237

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  +D  N  +VQ+NK  KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNNTIVQINKFFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCPA KNP Y+YRE I  G T+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPAGKNPMYSYRECIVLGNTNHSIFKVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGV KLP 
Sbjct  119  CDELCERLGVQKLPG  133



>gb|KJB34156.1| hypothetical protein B456_006G050800 [Gossypium raimondii]
Length=250

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV LHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MTEVRLHIYDVTNSG--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ KNP YTYRES+  G T+ S   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESMVLGITNFSKLNVNQILQELSREWPGSSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGV KLP 
Sbjct  119  CDEFCERLGVQKLPG  133



>ref|XP_010555681.1| PREDICTED: deSI-like protein At4g17486 [Tarenaya hassleriana]
Length=248

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  ++  N  +VQ+N++ KDGI LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRIFKDGIGLGGIFHSAIQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP++KNP Y+YRE I  GRT CS   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYSYREKIVLGRTECSIFMVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGV KLP 
Sbjct  119  CDEFCERLGVQKLPG  133



>ref|XP_006353912.1| PREDICTED: deSI-like protein At4g17486-like [Solanum tuberosum]
Length=237

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  +D  N  +VQ+NK  KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNNTIVQINKFFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCPA KNP Y+YRE I  G T+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPAGKNPMYSYRECIVLGNTNHSIFKVNEILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGV KLP 
Sbjct  119  CDEFCERLGVQKLPG  133



>ref|XP_010448389.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=251

 Score =   171 bits (434),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSALQVYGDDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTECTKFIVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L +KLGVPK+P 
Sbjct  119  CDLLCDKLGVPKIPG  133



>gb|EPS61570.1| hypothetical protein M569_13226, partial [Genlisea aurea]
Length=224

 Score =   171 bits (432),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            EVILH+YD+T SG  ND  +  +V +NK  KDGI LGG+FH AVQIYG  EW++G   +G
Sbjct  2    EVILHVYDVTNSG--NDKTDNTIVNINKFFKDGIGLGGIFHSAVQIYGADEWSFGFCGQG  59

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            SG+FSCP  KNP YTYRESI  GRT  S SKVN IL+EL  EWPG  Y L+S+N  HFC 
Sbjct  60   SGVFSCPCKKNPMYTYRESISLGRTEFSISKVNQILRELSREWPGYSYDLLSKNCNHFCD  119

Query  428  ELLEKLGVPKLPA  466
            +L E+LGV KLP 
Sbjct  120  KLCERLGVLKLPG  132



>gb|KDP22234.1| hypothetical protein JCGZ_26065 [Jatropha curcas]
Length=260

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+VILHIYD+T SG  ++  N  ++ +NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MTDVILHIYDVTNSG--SEKTNNTIMHINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             G+G+FSCP+ KNP YTYRESI  GRT+    KVN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   HGTGVFSCPSGKNPMYTYRESIVLGRTNFPIYKVNQILRELSREWPGSAYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>ref|XP_010433598.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
 ref|XP_010438841.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=251

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSALQVYGDDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L +KLGVPK+P 
Sbjct  119  CDLLCDKLGVPKIPG  133



>ref|XP_009109194.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
 emb|CDY66007.1| BnaA08g30790D [Brassica napus]
Length=254

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV++HIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW++G+ +
Sbjct  1    MTEVVVHIYDVTNSG--SEKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDDEWSFGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+TKNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSTKNPMYTYREKIVLGKTDCTIFMVNQILRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPKLP 
Sbjct  119  CDVLCDRLGVPKLPG  133



>emb|CDX89402.1| BnaA01g14910D [Brassica napus]
Length=251

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG  +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTILQINRFFKDGIRLGGIFHSAIQVYGDEEWSYGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP++KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTECTIFMVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L + LGVPKLP 
Sbjct  119  CDVLCDVLGVPKLPG  133



>ref|XP_009798709.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana sylvestris]
Length=246

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV++HIYD+T SG  +D  N  +VQ+NK  KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVVHIYDVTNSG--SDKTNNTIVQINKFFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCPA KNP YTYRE I  G T+ S  KVN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPAGKNPMYTYRECIVLGTTNHSIFKVNQILRELSREWPGHSYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGV KLP 
Sbjct  119  CDEFCERLGVQKLPG  133



>ref|XP_010433604.1| PREDICTED: uncharacterized protein LOC104717692 [Camelina sativa]
Length=255

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE I  GRT C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGRTDCTPFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L +KLGVPK+P 
Sbjct  119  CDLLCDKLGVPKIPG  133



>emb|CDX94426.1| BnaC01g17580D [Brassica napus]
Length=252

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG  +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDEEWSYGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP++KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTDCTIFMVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L + LGVPKLP 
Sbjct  119  CDVLCDVLGVPKLPG  133



>gb|AFK44900.1| unknown [Lotus japonicus]
Length=251

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+V+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ+YGE EW++G+ +
Sbjct  1    MTDVMLHIYDVTNSG--SEKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGEEEWSFGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE I  G+T  S  KVN IL+EL  E PG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRECIILGKTSFSIFKVNQILRELSRERPGSSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>emb|CDX89404.1| BnaA01g14890D [Brassica napus]
Length=245

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV++HIYD+T +G  +D  N  ++Q+N++ KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVVHIYDVTNTG--SDKTNNTILQINRIFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+F CP++KNP YTYRE I  GRT C+   VN I +EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFRCPSSKNPMYTYREKIVLGRTDCTIFMVNQIFRELTREWPGHTYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPKLP 
Sbjct  119  CDVLCDRLGVPKLPG  133



>emb|CDX94429.1| BnaC01g17550D [Brassica napus]
Length=245

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV++HIYD+T +G  +D  N  ++Q+N++ KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVVHIYDVTNTG--SDKTNNTILQINRIFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+F CP++KNP YTYRE I  GRT C+   VN I +EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFRCPSSKNPMYTYREKIVLGRTDCTIFMVNQIFRELTREWPGHTYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPKLP 
Sbjct  119  CDVLCDRLGVPKLPG  133



>ref|XP_009139416.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=245

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV++HIYD+T +G  +D  N  ++Q+N++ KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVVHIYDVTNTG--SDKTNNTILQINRIFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+F CP++KNP YTYRE I  GRT C+   VN I +EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFRCPSSKNPMYTYREKIVLGRTDCTIFMVNQIFRELTREWPGHTYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPKLP 
Sbjct  119  CDVLCDRLGVPKLPG  133



>ref|XP_006422019.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
 ref|XP_006490644.1| PREDICTED: uncharacterized protein LOC102607017 isoform X1 [Citrus 
sinensis]
 gb|ESR35259.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
 gb|KDO56772.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
Length=255

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+V LHIYD+T SG   +  N  ++ +NK+ KDGI +GG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTDVRLHIYDVTNSGS--EKTNNTILNINKIFKDGIGVGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ +NP YTYRESI  G+T+ S  KVN IL+EL  EWPG+ Y L+ RN  HF
Sbjct  59   QGSGVFSCPSGRNPMYTYRESIVLGKTNFSIFKVNQILRELSREWPGNSYDLLGRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  ++LGVPKLP 
Sbjct  119  CDEFCDRLGVPKLPG  133



>ref|XP_010035174.1| PREDICTED: deSI-like protein At4g17486 [Eucalyptus grandis]
Length=249

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  ++  N  ++Q+NK+ KDG+ LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIMQINKIFKDGMGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE +  G T+ S  KVN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFSCPSAKNPMYTYRERVVLGSTNFSIFKVNQILRELSREWPGHAYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGV KLP 
Sbjct  119  CDEFCERLGVQKLPG  133



>ref|XP_003606789.1| PPPDE peptidase domain-containing protein [Medicago truncatula]
 gb|KEH26242.1| PPPDE thiol peptidase family protein, putative [Medicago truncatula]
Length=258

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+VILHIYD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ++GE EW++G+ +
Sbjct  1    MTDVILHIYDVTNSG--SEKANNTILQINKIFKDGIGLGGIFHSAVQVFGEDEWSFGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ +NP YTYRESI  G+T+    KVN I++EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGQNPMYTYRESIVLGKTNFPIFKVNQIIRELSREWPGTAYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+L VPKLP 
Sbjct  119  CDEFCERLDVPKLPG  133



>ref|NP_194296.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
 emb|CAB43697.1| putative protein [Arabidopsis thaliana]
 emb|CAB81376.1| putative protein [Arabidopsis thaliana]
 gb|AAN72011.1| putative protein [Arabidopsis thaliana]
 gb|AAQ55277.1| At4g25660 [Arabidopsis thaliana]
 gb|AEE85090.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
Length=255

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQILRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPK+P 
Sbjct  119  CDVLCDRLGVPKIPG  133



>ref|XP_010438844.1| PREDICTED: uncharacterized protein LOC104722396 [Camelina sativa]
Length=255

 Score =   169 bits (429),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTPFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L +KLGVPK+P 
Sbjct  119  CDLLCDKLGVPKIPG  133



>ref|XP_006284399.1| hypothetical protein CARUB_v10005569mg [Capsella rubella]
 gb|EOA17297.1| hypothetical protein CARUB_v10005569mg [Capsella rubella]
Length=252

 Score =   169 bits (428),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGDDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPK+P 
Sbjct  119  CDILCDRLGVPKIPG  133



>ref|XP_008796908.1| PREDICTED: deSI-like protein At4g17486 isoform X3 [Phoenix dactylifera]
Length=177

 Score =   167 bits (422),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV++HIYD+T SG  ++  N  ++Q+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MEEVVVHIYDVTNSG--SEKTNNTILQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  +NP YTYRESI  G+T+CS   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGKTNCSVFMVNQILRELSRAWPGSSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E LGVPKLP 
Sbjct  119  CDSFCELLGVPKLPG  133



>gb|KFK29065.1| hypothetical protein AALP_AA7G084100 [Arabis alpina]
Length=252

 Score =   169 bits (428),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  +D  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+F+CP +KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFNCPRSKNPMYTYREKIVLGKTDCTIFMVNQILRELSKEWPGHTYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPK+P 
Sbjct  119  CDVLCDRLGVPKIPG  133



>ref|XP_006413282.1| hypothetical protein EUTSA_v10026034mg [Eutrema salsugineum]
 gb|ESQ54735.1| hypothetical protein EUTSA_v10026034mg [Eutrema salsugineum]
Length=257

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M +V+L+IYD+T SG   +  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MADVVLYIYDVTNSGS--EKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP++KNP YTYRE I  GRT C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGRTDCTIFMVNQILRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPKLP 
Sbjct  119  CDVLCDRLGVPKLPG  133



>ref|XP_006413284.1| hypothetical protein EUTSA_v10026072mg [Eutrema salsugineum]
 gb|ESQ54737.1| hypothetical protein EUTSA_v10026072mg [Eutrema salsugineum]
Length=250

 Score =   169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M +VILHIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MADVILHIYDVTNSG--SEKTNNTILQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP +KNP YTYRE I  GRT C+   VN I +EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPNSKNPMYTYREKIVLGRTDCTIFMVNQIFRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPKLP 
Sbjct  119  CDVLCDRLGVPKLPG  133



>ref|NP_194298.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
 emb|CAB43699.1| putative protein [Arabidopsis thaliana]
 emb|CAB81378.1| putative protein [Arabidopsis thaliana]
 gb|AAM61523.1| unknown [Arabidopsis thaliana]
 gb|AAO24562.1| At4g25680 [Arabidopsis thaliana]
 dbj|BAE99636.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85094.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
Length=252

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   LGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPK+P 
Sbjct  119  CDVLCDRLGVPKIPG  133



>ref|XP_009139388.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=251

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+  SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG  +
Sbjct  1    MTEVVLHIYDVINSG--SEKTNNTILQINRFFKDGIRLGGIFHSAIQVYGDEEWSYGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP++KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTECTIFMVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L + LGVPKLP 
Sbjct  119  CDVLCDVLGVPKLPG  133



>ref|XP_002869660.1| hypothetical protein ARALYDRAFT_492258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45919.1| hypothetical protein ARALYDRAFT_492258 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGGDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVP++P 
Sbjct  119  CDVLCDRLGVPEIPG  133



>ref|XP_006284384.1| hypothetical protein CARUB_v10005552mg [Capsella rubella]
 gb|EOA17282.1| hypothetical protein CARUB_v10005552mg [Capsella rubella]
Length=255

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPK+P 
Sbjct  119  CDVLCDRLGVPKIPG  133



>ref|XP_011038376.1| PREDICTED: uncharacterized protein LOC105135271 [Populus euphratica]
Length=262

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEVILH+YD+T SG  ++  N  ++ +NK+ KD I LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MTEVILHVYDVTNSG--SEKTNNTILNINKIFKDTIGLGGIFHSAIQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             G+G+FSCP+ KNP YTYRE I  G+T  S  KVN IL+EL  EWPG +Y L+++N  HF
Sbjct  59   HGTGVFSCPSGKNPMYTYRERIVLGKTSFSIFKVNQILRELSREWPGSDYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+LGVPKLP 
Sbjct  119  CDEFCERLGVPKLPG  133



>emb|CDY49480.1| BnaCnng17460D [Brassica napus]
Length=253

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEV++HIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW++G+ +
Sbjct  1    MTEVVVHIYDVTNSG--SEKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDDEWSFGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            + +G+FSCP+TKNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QATGVFSCPSTKNPMYTYREKILLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPKLP 
Sbjct  119  CDVLCDRLGVPKLPG  133



>gb|KFK29064.1| hypothetical protein AALP_AA7G083900 [Arabis alpina]
Length=252

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  +D  N  ++Q+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNNTILQINRFFKDGIGLGGIFHSALQVYGTDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KNP YTYRE +  G+T C+   VN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKVVLGKTDCTIFMVNQILRELSREWPGHTYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPK+P 
Sbjct  119  CDVLCDRLGVPKIPG  133



>ref|XP_010448394.1| PREDICTED: uncharacterized protein LOC104730857 [Camelina sativa]
Length=255

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+F CP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFRCPSGKNPMYTYREKIVLGKTECTPFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L +KLGVPK+P 
Sbjct  119  CDLLCDKLGVPKIPG  133



>ref|XP_011076114.1| PREDICTED: uncharacterized protein LOC105160441 isoform X2 [Sesamum 
indicum]
Length=249

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILH+YD+T SG   D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MREVILHVYDVTNSGY--DKTNNTIMQINKIFKDGIGLGGIFHTAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+T+NP YTYRESI  G+T  S  KVN I +EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPSTQNPMYTYRESINLGKTSFSIFKVNQIRRELSREWPGHSYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E   +LGV KLP 
Sbjct  119  CDEFCRRLGVQKLPG  133



>ref|XP_010933984.1| PREDICTED: desumoylating isopeptidase 2-like [Elaeis guineensis]
Length=239

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVILHVYDVTNSE--SEKTNNTILQINRVFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             G+G+FSCP +KNP YTYRE I  G T+CS  KV+ IL+EL  EWPGD Y L+S+N  HF
Sbjct  59   NGTGVFSCPPSKNPMYTYRERILLGETNCSILKVSQILRELSREWPGDSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E+LGVPKLP 
Sbjct  119  CDAFCERLGVPKLPG  133



>ref|XP_011076113.1| PREDICTED: uncharacterized protein LOC105160441 isoform X1 [Sesamum 
indicum]
Length=274

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILH+YD+T SG   D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MREVILHVYDVTNSGY--DKTNNTIMQINKIFKDGIGLGGIFHTAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+T+NP YTYRESI  G+T  S  KVN I +EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPSTQNPMYTYRESINLGKTSFSIFKVNQIRRELSREWPGHSYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E   +LGV KLP 
Sbjct  119  CDEFCRRLGVQKLPG  133



>ref|XP_008796907.1| PREDICTED: uncharacterized protein LOC103712218 isoform X2 [Phoenix 
dactylifera]
Length=258

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV++HIYD+T SG  ++  N  ++Q+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MEEVVVHIYDVTNSG--SEKTNNTILQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  +NP YTYRESI  G+T+CS   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGKTNCSVFMVNQILRELSRAWPGSSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E LGVPKLP 
Sbjct  119  CDSFCELLGVPKLPG  133



>ref|XP_006372440.1| hypothetical protein POPTR_0017s01650g [Populus trichocarpa]
 gb|ERP50237.1| hypothetical protein POPTR_0017s01650g [Populus trichocarpa]
Length=262

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MTEVILH+YD+T SG  ++  N  ++ +NK+ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MTEVILHVYDVTNSG--SEKTNNTILNINKIFKDTIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             G+G+FSCP+ KNP YTYRE I  G+T  S  KVN IL+EL  EWPG +Y L+++N  HF
Sbjct  59   HGTGVFSCPSGKNPMYTYRERIVLGKTSFSIFKVNQILRELSREWPGSDYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E++GVPKLP 
Sbjct  119  CDEFCERIGVPKLPG  133



>ref|XP_006661997.1| PREDICTED: desumoylating isopeptidase 2-like [Oryza brachyantha]
Length=243

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  KNP YTYRE I  G T CS + VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   SGSGVFSCPIGKNPMYTYRECIVLGETECSIATVNRILRELSRNWPGHSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+L VPKLP 
Sbjct  119  CDELCERLAVPKLPG  133



>ref|XP_003574249.1| PREDICTED: desumoylating isopeptidase 2-like [Brachypodium distachyon]
Length=242

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP +KNP YTYRE I  G T C+ + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   NGSGVFSCPISKNPMYTYRERIVLGETECTIATVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPKLP 
Sbjct  119  CDVLCDRLGVPKLPG  133



>ref|XP_008796906.1| PREDICTED: deSI-like protein sdu1 isoform X1 [Phoenix dactylifera]
Length=275

 Score =   167 bits (424),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV++HIYD+T SG  ++  N  ++Q+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MEEVVVHIYDVTNSG--SEKTNNTILQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  +NP YTYRESI  G+T+CS   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGKTNCSVFMVNQILRELSRAWPGSSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E LGVPKLP 
Sbjct  119  CDSFCELLGVPKLPG  133



>tpg|DAA46059.1| TPA: hypothetical protein ZEAMMB73_195984 [Zea mays]
Length=195

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  KNP YTYRE I  G T C  + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   SGSGVFSCPIGKNPMYTYRERIVLGETECGIAAVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L E+LGVPKLP 
Sbjct  119  CDVLCERLGVPKLPG  133



>ref|XP_004513185.1| PREDICTED: uncharacterized protein LOC101510879 [Cicer arietinum]
Length=251

 Score =   167 bits (422),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 101/133 (76%), Gaps = 2/133 (2%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            +VILHIYD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ++GE EW++G+ ++G
Sbjct  2    DVILHIYDVTNSG--SEKTNNTILQINKIFKDGIGLGGIFHSAVQVFGEDEWSFGYCEQG  59

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            +G+FSCP+ +NP YTYRE+I  G+T+ S  KVN IL+EL  EWPG  Y L+S+N  HFC 
Sbjct  60   TGVFSCPSGQNPMYTYREAIVLGKTNFSIFKVNQILRELSREWPGTAYDLLSKNCNHFCD  119

Query  428  ELLEKLGVPKLPA  466
            E  E+L VPKLP 
Sbjct  120  EFCERLDVPKLPG  132



>ref|XP_010537155.1| PREDICTED: deSI-like protein At4g17486 [Tarenaya hassleriana]
Length=248

 Score =   166 bits (420),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  ++  N  +VQ+N++ KDGI LGG+FH A+Q++G+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRIFKDGIGLGGIFHSAIQVFGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+++NP Y YRE I  GRT CS   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   EGTGVFSCPSSENPMYAYREKIVIGRTECSIFLVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C E  ++LGV KLP 
Sbjct  119  CNEFCDRLGVQKLPG  133



>ref|NP_001143918.1| uncharacterized protein LOC100276728 [Zea mays]
 gb|ACG36388.1| hypothetical protein [Zea mays]
 gb|ACR34243.1| unknown [Zea mays]
 tpg|DAA46058.1| TPA: hypothetical protein ZEAMMB73_195984 [Zea mays]
Length=245

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  KNP YTYRE I  G T C  + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   SGSGVFSCPIGKNPMYTYRERIVLGETECGIAAVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L E+LGVPKLP 
Sbjct  119  CDVLCERLGVPKLPG  133



>gb|KJB23840.1| hypothetical protein B456_004G117500 [Gossypium raimondii]
Length=267

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILHIYD+T SG  +D  N  +V +NK+ KD I LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MAEVILHIYDVTNSG--SDKTNNTIVHINKIFKDRIGLGGIFHSAIQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+F CP+ KNP YTYRE +  GRT+ S  KVN IL EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFCCPSRKNPLYTYREFMVLGRTNSSVFKVNQILCELSREWPGTSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGV KLP 
Sbjct  119  CDELCERLGVQKLPG  133



>ref|XP_006422020.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
 gb|ESR35260.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
Length=256

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 100/136 (74%), Gaps = 3/136 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQI-YGEVEWAYGHR  238
            MT+V LHIYD+T SG   +  N  ++ +NK+ KDGI +GG+FH AVQ+ YG+ EW++G  
Sbjct  1    MTDVRLHIYDVTNSGS--EKTNNTILNINKIFKDGIGVGGIFHSAVQVVYGDEEWSFGFC  58

Query  239  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  418
            ++GSG+FSCP+ +NP YTYRESI  G+T+ S  KVN IL+EL  EWPG+ Y L+ RN  H
Sbjct  59   EQGSGVFSCPSGRNPMYTYRESIVLGKTNFSIFKVNQILRELSREWPGNSYDLLGRNCNH  118

Query  419  FCQELLEKLGVPKLPA  466
            FC E  ++LGVPKLP 
Sbjct  119  FCDEFCDRLGVPKLPG  134



>ref|NP_001065158.1| Os10g0533900 [Oryza sativa Japonica Group]
 gb|AAM88632.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAP54793.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27072.1| Os10g0533900 [Oryza sativa Japonica Group]
 dbj|BAG93509.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96876.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51309.1| hypothetical protein OsJ_32269 [Oryza sativa Japonica Group]
Length=246

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  KNP YTYRE I  G T CS + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   NGSGVFSCPIGKNPMYTYRECIVLGETECSIATVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L E+L VPKLP 
Sbjct  119  CDVLCERLAVPKLPG  133



>ref|XP_004983828.1| PREDICTED: deSI-like protein hag1-like [Setaria italica]
Length=251

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAIQVYGEDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  KNP YTYRE I  G T C  + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   TGSGVFSCPIGKNPMYTYRERIVLGETECGIAAVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L E+LGVPKLP 
Sbjct  119  CDVLCERLGVPKLPG  133



>gb|KJB23839.1| hypothetical protein B456_004G117500 [Gossypium raimondii]
Length=282

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILHIYD+T SG  +D  N  +V +NK+ KD I LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MAEVILHIYDVTNSG--SDKTNNTIVHINKIFKDRIGLGGIFHSAIQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+F CP+ KNP YTYRE +  GRT+ S  KVN IL EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFCCPSRKNPLYTYREFMVLGRTNSSVFKVNQILCELSREWPGTSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGV KLP 
Sbjct  119  CDELCERLGVQKLPG  133



>gb|EEC67357.1| hypothetical protein OsI_34457 [Oryza sativa Indica Group]
Length=262

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  KNP YTYRE I  G T CS + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   NGSGVFSCPIGKNPMYTYRECIVLGETECSIATVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L E+L VPKLP 
Sbjct  119  CDVLCERLAVPKLPG  133



>ref|XP_008807844.1| PREDICTED: desumoylating isopeptidase 2-like [Phoenix dactylifera]
Length=239

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILH+YD+T S   ++  N  ++Q+N++ KD + LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MKEVILHVYDVTNSE--SEKTNNTILQINRIFKDRVGLGGIFHSAIQVYGEEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  KNP YTYRE I  G T CS  KV  IL+EL  EWPGD Y L+S+N  HF
Sbjct  59   NGSGVFSCPPGKNPMYTYREHILLGGTDCSILKVKQILRELSQEWPGDSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E+LGVPKLP 
Sbjct  119  CDAFCERLGVPKLPG  133



>gb|AFK48534.1| unknown [Medicago truncatula]
Length=258

 Score =   164 bits (416),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            MT+VIL+IYD+T SG  ++  N  ++Q+NK+ KDGI LGG FH AVQ++GE EW++G+ +
Sbjct  1    MTDVILYIYDVTNSG--SEKANNTILQINKIFKDGIGLGGTFHSAVQVFGEDEWSFGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP+ +NP YTYRESI  G+T+    KVN I++EL  EWPG  Y L+S+N  H 
Sbjct  59   QGSGVFSCPSGQNPMYTYRESIVLGKTNFPIFKVNQIIRELSREWPGTAYDLLSKNCNHL  118

Query  422  CQELLEKLGVPKLPA  466
            C E  E+L VPKLP 
Sbjct  119  CDEFCERLDVPKLPG  133



>ref|XP_002869661.1| hypothetical protein ARALYDRAFT_914007 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45920.1| hypothetical protein ARALYDRAFT_914007 [Arabidopsis lyrata subsp. 
lyrata]
Length=259

 Score =   164 bits (415),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  242  KG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  418
            +G +G+FSCP+ KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  H
Sbjct  59   QGGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFLVNQILRELSREWPGHTYDLLSKNCNH  118

Query  419  FCQELLEKLGVPKLPA  466
            FC  L ++LGVPK+P 
Sbjct  119  FCDVLCDRLGVPKIPG  134



>ref|XP_002467590.1| hypothetical protein SORBIDRAFT_01g030660 [Sorghum bicolor]
 gb|EER94588.1| hypothetical protein SORBIDRAFT_01g030660 [Sorghum bicolor]
Length=245

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 94/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  KNP YTYRE I  G T C  + VN IL+EL  EW G  Y L+SRN  HF
Sbjct  59   NGSGVFSCPVGKNPMYTYRERIVLGETECGIAAVNRILRELGREWQGQSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L E+LGVPKLP 
Sbjct  119  CDVLCERLGVPKLPG  133



>ref|XP_008794771.1| PREDICTED: uncharacterized protein LOC103710694 [Phoenix dactylifera]
 ref|XP_008794772.1| PREDICTED: uncharacterized protein LOC103710694 [Phoenix dactylifera]
 ref|XP_008794773.1| PREDICTED: uncharacterized protein LOC103710694 [Phoenix dactylifera]
 ref|XP_008794774.1| PREDICTED: uncharacterized protein LOC103710694 [Phoenix dactylifera]
Length=276

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV++HIYD+T SG   +  N  +VQ+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MKEVVVHIYDVTNSGS--EKTNNTIVQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  +NP YTYRESI  G T+CS   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGMTNCSIFMVNQILRELSSAWPGSSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLP  463
            C    E L  PKLP
Sbjct  119  CDAFCELLAAPKLP  132



>gb|KHG21774.1| hypothetical protein F383_27627 [Gossypium arboreum]
Length=269

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EVILHIYD+T SG  +D  N  +V +NK+ KD I LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MAEVILHIYDVTNSG--SDKTNNTIVHINKIFKDRIGLGGIFHSAIQVYGDDEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+F CP+ KNP YTYRE +  GRT+ S  KVN IL EL  EWPG  Y  +S+N  HF
Sbjct  59   QGSGVFCCPSRKNPLYTYREFMVLGRTNSSIFKVNQILHELSREWPGTSYDSLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C EL E+LGV KLP 
Sbjct  119  CDELCERLGVQKLPG  133



>ref|XP_009382250.1| PREDICTED: deSI-like protein At4g17486 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=247

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T SG  ++  N  ++Q+N++ KD I LGG+FH A+Q++G+ EW++G  +
Sbjct  1    MKEVVLHVYDVTNSG--SEKTNNTILQINRVFKDRIGLGGIFHSAIQVFGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP  +NP YTYRE I  G T+CS  KVN +L+EL   WPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPPGRNPMYTYRERIVLGETNCSIFKVNQVLRELGQAWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E+LGVPK+P 
Sbjct  119  CDSFCERLGVPKIPG  133



>ref|XP_010228135.1| PREDICTED: desumoylating isopeptidase 2-like isoform X2 [Brachypodium 
distachyon]
Length=203

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            EV+ H+YD+  SG   +     V+ +N++ KDGI LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  21   EVVAHVYDVACSGA--EGGGATVLHINRIFKDGIGLGGIFHTAIQVYGDEEWSFGYCEQG  78

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            SG+FSCP  KNP YT+RESI  G+T C+   VN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  79   SGVFSCPPCKNPMYTFRESIVLGKTSCTMFTVNQILRELSWEWPGGSYELLSRNCNHFCN  138

Query  428  ELLEKLGVPKLPA  466
            E  +KL VPKLP 
Sbjct  139  EFCDKLDVPKLPG  151



>ref|XP_010941159.1| PREDICTED: uncharacterized protein LOC105059531 [Elaeis guineensis]
Length=276

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV++HIYD+T SG  ++  N  +VQ+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MKEVVVHIYDVTNSG--SEKTNNTIVQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSCP  +NP YTYRESI  G T+ S   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGMTNSSIFTVNQILRELSRAWPGRSYDLLSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E LGVPKLP 
Sbjct  119  CDAFCELLGVPKLPG  133



>ref|XP_009411427.1| PREDICTED: uncharacterized protein LOC103993183 [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  ++  N  ++Q+N++ KD I LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MKEVVLHIYDVTNSG--SEKTNNTILQINRIFKDRIGLGGIFHSAIQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP  KNP YTYRE I  G T+CS  KVN IL+EL   WPG  Y L+++N  HF
Sbjct  59   QGSGVFSCPPGKNPMYTYREHIILGETNCSILKVNQILRELSQAWPGHSYDLLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E+LGV KLP 
Sbjct  119  CDAFCERLGVQKLPG  133



>ref|XP_009382251.1| PREDICTED: desumoylating isopeptidase 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=234

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LH+YD+T SG  ++  N  ++Q+N++ KD I LGG+FH A+Q++G+ EW++G  +
Sbjct  1    MKEVVLHVYDVTNSG--SEKTNNTILQINRVFKDRIGLGGIFHSAIQVFGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+FSCP  +NP YTYRE I  G T+CS  KVN +L+EL   WPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPPGRNPMYTYRERIVLGETNCSIFKVNQVLRELGQAWPGHSYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E+LGVPK+P 
Sbjct  119  CDSFCERLGVPKIPG  133



>gb|KJB34157.1| hypothetical protein B456_006G050800 [Gossypium raimondii]
Length=269

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 99/154 (64%), Gaps = 21/154 (14%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQ-------------  202
            MTEV LHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQ             
Sbjct  1    MTEVRLHIYDVTNSG--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQFSKENILRQYLCG  58

Query  203  ------IYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKEL  364
                  +YGE EW++G  ++GSG+FSCP+ KNP YTYRES+  G T+ S   VN IL+EL
Sbjct  59   QILGSEVYGEEEWSFGFCEQGSGVFSCPSGKNPMYTYRESMVLGITNFSKLNVNQILQEL  118

Query  365  RDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
              EWPG  Y L+S+N  HFC E  E+LGV KLP 
Sbjct  119  SREWPGSSYDLLSKNCNHFCDEFCERLGVQKLPG  152



>ref|XP_006279084.1| hypothetical protein CARUB_v10012715mg [Capsella rubella]
 gb|EOA11982.1| hypothetical protein CARUB_v10012715mg [Capsella rubella]
Length=803

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGDDEWSYGYCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KN  YTYRE I  G+T C+   VN +L+ELR EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNSMYTYREKIVLGKTDCTIFMVNQMLRELRREWPGHTYDLLSKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C  L ++LGVPK+P 
Sbjct  119  CDILCDRLGVPKIPG  133



>ref|XP_004966587.1| PREDICTED: uncharacterized protein LOC101773931 [Setaria italica]
Length=260

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            EV+ H+YD+  +G  N      V+ +N+  KD I LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  4    EVVAHVYDVANAGTDN-----TVLHINRFFKDAIGLGGIFHTAIQVYGDEEWSFGYCERG  58

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            +G+FSCP  KNP YTYRESI  G+T+C   KVN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  59   TGVFSCPPCKNPMYTYRESIVLGKTNCCILKVNQILRELSWEWPGQSYELLSRNCNHFCN  118

Query  428  ELLEKLGVPKLPA  466
               EKL VPKLP 
Sbjct  119  TFCEKLEVPKLPG  131



>ref|XP_003557265.2| PREDICTED: uncharacterized protein LOC100845322 isoform X1 [Brachypodium 
distachyon]
Length=285

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            EV+ H+YD+  SG   +     V+ +N++ KDGI LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  21   EVVAHVYDVACSGA--EGGGATVLHINRIFKDGIGLGGIFHTAIQVYGDEEWSFGYCEQG  78

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            SG+FSCP  KNP YT+RESI  G+T C+   VN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  79   SGVFSCPPCKNPMYTFRESIVLGKTSCTMFTVNQILRELSWEWPGGSYELLSRNCNHFCN  138

Query  428  ELLEKLGVPKLPA  466
            E  +KL VPKLP 
Sbjct  139  EFCDKLDVPKLPG  151



>ref|XP_002436336.1| hypothetical protein SORBIDRAFT_10g000670 [Sorghum bicolor]
 gb|EER87703.1| hypothetical protein SORBIDRAFT_10g000670 [Sorghum bicolor]
Length=268

 Score =   159 bits (403),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 95/133 (71%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            +V+ H+YD+  +G  +DT    V+ +N+  KDG+ LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  4    DVVAHVYDVATAG--SDTT---VLHINRFFKDGLGLGGIFHTAIQVYGDEEWSFGYCERG  58

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            +G+FSCP  KNP YTYRESI  G+T+C   KVN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  59   TGVFSCPPCKNPMYTYRESIVLGKTNCCILKVNQILRELSWEWPGQSYELLSRNCNHFCN  118

Query  428  ELLEKLGVPKLPA  466
               EKL VPKLP 
Sbjct  119  TFCEKLEVPKLPG  131



>ref|XP_008376975.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103440069 
[Malus domestica]
Length=567

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  250
            V+L IYD+T SG  +D  N  + Q+NK+ KDGI LGG+FH  +Q+Y E EW++G  ++GS
Sbjct  153  VVLXIYDVTNSG--SDKTNSTIPQINKIFKDGIGLGGIFHSXIQVYREDEWSFGFCEQGS  210

Query  251  GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQE  430
            G+FSCP+ KNP YTYRESI  G T CS  KVN IL+EL  EWPG  Y L+S+N  HF  E
Sbjct  211  GVFSCPSKKNPMYTYRESIVLGTTDCSIFKVNQILRELSREWPGYSYDLLSKNCNHFLDE  270

Query  431  LLEKLGVPKLP  463
            L E+LGVPKLP
Sbjct  271  LCERLGVPKLP  281



>ref|XP_004496529.1| PREDICTED: deSI-like protein At4g17486-like [Cicer arietinum]
Length=230

 Score =   156 bits (394),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M +V LH+YDLT    G++  N  +V +NK+ K+GI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAKVTLHVYDLT---NGSEKTNSTIVHINKIFKNGIGLGGIFHSAVQVYGDDEWSFGFSE  57

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KN  +TYR S+  G+T+ +  KVN IL+EL  EWPG+ Y   S+N  HF
Sbjct  58   EGTGVFSCPSRKNAMFTYRRSLALGKTNYNIFKVNQILRELSKEWPGNSYDRFSKNCNHF  117

Query  422  CQELLEKLGVPKLPA  466
            C E   +LGVPKLP 
Sbjct  118  CDEFCVRLGVPKLPG  132



>gb|EPS69052.1| hypothetical protein M569_05713, partial [Genlisea aurea]
Length=223

 Score =   155 bits (392),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 94/136 (69%), Gaps = 5/136 (4%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQI-YGEVEWAYG--HR  238
            EV+LH+YD+T SG  N+  N  +VQ+NK+ KDGI LGG+FH AVQ+ YG+ EW++G   R
Sbjct  1    EVVLHVYDVTNSG--NEKTNNTIVQINKIFKDGIGLGGIFHSAVQVVYGDEEWSFGFCER  58

Query  239  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  418
              G+G+FSCP+ KNP YTYRESI  G T  S   VN IL+EL  EWPG  Y L+S+N  H
Sbjct  59   GSGTGVFSCPSKKNPMYTYRESIKLGETPFSIFNVNQILRELSREWPGCSYDLLSKNCNH  118

Query  419  FCQELLEKLGVPKLPA  466
            FC E  E+L V K P 
Sbjct  119  FCDEFSERLAVSKPPG  134



>ref|XP_009386602.1| PREDICTED: uncharacterized protein LOC103973689 [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M EV+ H+YD+T SG  ++  N  ++ +N+  KDGI +GG+FH ++Q+YG+ EW++G  +
Sbjct  1    MMEVVAHVYDVTNSG--SEKANNTILHINRFFKDGIGVGGIFHSSIQVYGDEEWSFGFCE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+FSC   KNP YTYRESI  G T CS   VN IL+EL  EW G  Y L SRN  HF
Sbjct  59   YGSGVFSCQPCKNPMYTYRESIVLGETTCSIFTVNQILRELSREWRGSSYDLFSRNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
            C    E L VPKLPA
Sbjct  119  CDAFCEMLDVPKLPA  133



>ref|XP_008659380.1| PREDICTED: uncharacterized protein LOC103638177 [Zea mays]
 gb|AFW86207.1| hypothetical protein ZEAMMB73_029409 [Zea mays]
Length=268

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 5/133 (4%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            +V+ H+YD+  +G  +DT    V+ +N+  KD I LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  4    DVVAHVYDVATAG--SDTT---VLHINRFFKDAIGLGGIFHTAIQVYGDEEWSFGYCERG  58

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            +G+FSCP  KNP YTYRESI  G+T+C   KVN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  59   TGVFSCPPCKNPMYTYRESIVLGKTNCCILKVNQILRELSWEWPGHSYELLSRNCNHFCN  118

Query  428  ELLEKLGVPKLPA  466
               EKL V KLP 
Sbjct  119  TFCEKLEVSKLPG  131



>ref|XP_003592207.1| PPPDE peptidase domain-containing protein [Medicago truncatula]
Length=218

 Score =   153 bits (386),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 94/135 (70%), Gaps = 3/135 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M +V LH+YDLT    G++  N  VV +NK+ K+GI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAKVTLHVYDLT---NGSEKTNNTVVHINKIFKNGIGLGGIFHGAVQVYGDDEWSFGSCE  57

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KN  YTYR+S+  G+T+ +   VN IL+EL  EWPG+ Y L S+N  HF
Sbjct  58   EGTGVFSCPSRKNARYTYRQSLVLGKTNYNIFMVNQILRELSKEWPGNSYDLFSKNCNHF  117

Query  422  CQELLEKLGVPKLPA  466
            C E   +LGVP  P 
Sbjct  118  CDEFCARLGVPNPPG  132



>gb|AES62458.2| PPPDE thiol peptidase family protein, putative [Medicago truncatula]
Length=230

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 94/135 (70%), Gaps = 3/135 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M +V LH+YDLT    G++  N  VV +NK+ K+GI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAKVTLHVYDLT---NGSEKTNNTVVHINKIFKNGIGLGGIFHGAVQVYGDDEWSFGSCE  57

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G+FSCP+ KN  YTYR+S+  G+T+ +   VN IL+EL  EWPG+ Y L S+N  HF
Sbjct  58   EGTGVFSCPSRKNARYTYRQSLVLGKTNYNIFMVNQILRELSKEWPGNSYDLFSKNCNHF  117

Query  422  CQELLEKLGVPKLPA  466
            C E   +LGVP  P 
Sbjct  118  CDEFCARLGVPNPPG  132



>gb|EMT20329.1| hypothetical protein F775_52552 [Aegilops tauschii]
Length=285

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +2

Query  134  VVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPA  313
            V+Q+N++ KDGI LGG+FH A+Q+YG  EW++G+ + GSG+FSCP  KNP YT+RESI  
Sbjct  39   VLQINRIFKDGIGLGGIFHTAIQVYGNEEWSFGYCENGSGVFSCPPAKNPMYTFRESIVL  98

Query  314  GRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            G+T CS   VN I +EL  EWPG  Y L+SRN  HFC E  +KLGVPKLP 
Sbjct  99   GKTSCSPRTVNQIARELSREWPGASYELLSRNCNHFCNEFCDKLGVPKLPG  149



>gb|EMS56568.1| hypothetical protein TRIUR3_04780 [Triticum urartu]
Length=482

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNY-MVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDK  244
            E + H+YD+  SG          V+Q+N+L KDGI LGG+FH A+Q+YG  EW++G+ + 
Sbjct  25   EGVAHVYDVAGSGPDGAGGGGATVLQINRLFKDGIGLGGIFHTAIQVYGNEEWSFGYCEN  84

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
            GSG+FSCP  KNP YT+RESI  G+T CS   VN I +EL  EWPG  Y L+SRN  HFC
Sbjct  85   GSGVFSCPPAKNPMYTFRESIVLGKTSCSPRTVNQIARELSREWPGASYELLSRNCNHFC  144

Query  425  QELLEKLGVPKLP  463
             E  +KLGVPKLP
Sbjct  145  NEFCDKLGVPKLP  157



>gb|EEE64952.1| hypothetical protein OsJ_19839 [Oryza sativa Japonica Group]
Length=273

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 92/137 (67%), Gaps = 1/137 (1%)
 Frame = +2

Query  59   KMTEVILHIYDLTMSGKGNDTVNY-MVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  235
            ++ EV+ H+YD+  SG          ++ +N+  KD I LGG+FH A+Q+YG+ EW++G+
Sbjct  11   QVQEVVAHVYDVASSGSSEGGGGGTAILHVNRFFKDAIGLGGIFHTAIQVYGDEEWSFGY  70

Query  236  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  415
             + G+G+FSCP  KNP YTYRESI  G+T CS   VN IL+EL  +WPG  Y L+SRN  
Sbjct  71   CENGTGVFSCPPCKNPMYTYRESIVLGKTTCSIFTVNQILRELSWKWPGGSYELLSRNCN  130

Query  416  HFCQELLEKLGVPKLPA  466
            HFC    EKL VPKLPA
Sbjct  131  HFCNTFCEKLDVPKLPA  147



>gb|EEC79844.1| hypothetical protein OsI_21315 [Oryza sativa Indica Group]
Length=271

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 92/137 (67%), Gaps = 1/137 (1%)
 Frame = +2

Query  59   KMTEVILHIYDLTMSGKGNDTVNY-MVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  235
            ++ EV+ H+YD+  SG          ++ +N+  KD I LGG+FH A+Q+YG+ EW++G+
Sbjct  9    QVQEVVAHVYDVASSGSSEGGGGGTAILHVNRFFKDAIGLGGIFHTAIQVYGDEEWSFGY  68

Query  236  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  415
             + G+G+FSCP  KNP YTYRESI  G+T CS   VN IL+EL  +WPG  Y L+SRN  
Sbjct  69   CENGTGVFSCPPCKNPMYTYRESIVLGKTTCSIFTVNQILRELSWKWPGGSYELLSRNCN  128

Query  416  HFCQELLEKLGVPKLPA  466
            HFC    EKL VPKLPA
Sbjct  129  HFCNTFCEKLDVPKLPA  145



>ref|XP_001784588.1| predicted protein [Physcomitrella patens]
 gb|EDQ50607.1| predicted protein, partial [Physcomitrella patens]
Length=197

 Score =   144 bits (364),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            +VILH+YD+T S   N   N ++V +NK+++ GI LGG+FH AV++YG+ EW++G  + G
Sbjct  1    KVILHVYDVTNSA--NVRTNSVIVNLNKIMRGGIGLGGIFHGAVEVYGK-EWSFGFCENG  57

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            SG+FSC   KNP YTYRESIP G+T  + + V  +L+++  EWPG+ Y L+ RN  HFC 
Sbjct  58   SGVFSCSPKKNPMYTYRESIPLGKTVMAKADVQKVLRDISREWPGNRYDLLKRNCNHFCD  117

Query  428  ELLEKLGVPKLP  463
             L  K+G  KLP
Sbjct  118  ALCCKIGAQKLP  129



>gb|EMS61224.1| hypothetical protein TRIUR3_07091 [Triticum urartu]
Length=280

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 97/173 (56%), Gaps = 40/173 (23%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQI------------  205
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+            
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVLHPAPPALPDPG  58

Query  206  --------------------------YGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESI  307
                                      YGE EW++G  + GSG+FSCP +KNP YTYRE I
Sbjct  59   DAFCLRAYPHLLQIPNSHFPMCRVQVYGEEEWSFGFCENGSGVFSCPVSKNPMYTYRERI  118

Query  308  PAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
              G T C+ + VN IL+EL  +WPG  Y L+SRN  HFC  L ++LGVPKLP 
Sbjct  119  VLGETECTIATVNRILRELSRDWPGHSYDLLSRNCNHFCDVLCDRLGVPKLPG  171



>ref|XP_001762496.1| predicted protein [Physcomitrella patens]
 gb|EDQ72619.1| predicted protein, partial [Physcomitrella patens]
Length=186

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  250
            V LH+YD+T SG  N   N  ++ +NK+++ GI LGG+FH AV++ G+ EW++G+ + GS
Sbjct  1    VTLHVYDVTNSG--NVRTNNAIMNLNKIMRGGIGLGGIFHGAVEVDGK-EWSFGYCEIGS  57

Query  251  GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQE  430
            G+FSC  TKN  YTYRES+P G+T  + ++V  +L EL  +WPG+ Y L++RN  HFC+ 
Sbjct  58   GVFSCLPTKNQMYTYRESVPLGKTRKTRAEVQRVLDELSRDWPGNGYDLLARNCNHFCET  117

Query  431  LLEKLGVPKLP  463
               K+GV KLP
Sbjct  118  FCAKIGVDKLP  128



>ref|XP_009385238.1| PREDICTED: uncharacterized protein LOC103972614 [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M  V+ H+YD+T S       N  V ++N + KD I LGG+FH A+Q+YG  EW++G+R+
Sbjct  1    MQAVVAHVYDVTNSPSAK--TNNTVTRINCIFKDCIGLGGIFHSAIQVYGAHEWSFGYRE  58

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG+F C   +N  YTYR+SI  G THCS  +VN IL+EL   W GD Y  +++N  HF
Sbjct  59   RGSGVFHCSPGQNQCYTYRQSIVLGETHCSQYEVNKILRELIRAWTGDSYDPLAKNCNHF  118

Query  422  CQELLEKLGVPKLPA  466
                 EKLGV KLP 
Sbjct  119  SDAFCEKLGVRKLPG  133



>ref|XP_004987201.1| PREDICTED: deSI-like protein At4g17486-like [Setaria italica]
Length=260

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 90/142 (63%), Gaps = 2/142 (1%)
 Frame = +2

Query  41   STIFISKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVE  220
            S+   S   EV+LH+Y++T +G   +  +  +  +N+  KDGI +GG+FH AVQ+YGE E
Sbjct  23   SSASTSSGREVVLHVYEITKTGY--EKTDKTIRMINRFFKDGIGVGGIFHSAVQVYGEEE  80

Query  221  WAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLV  400
            W+YG R   +G+FSCP  +N  YTYRESI  G T  S+S+V  IL +L  EWPG  Y  +
Sbjct  81   WSYGFRYCDTGVFSCPVGQNSMYTYRESIVLGVTTFSNSEVKQILIQLSCEWPGFSYDFL  140

Query  401  SRNSKHFCQELLEKLGVPKLPA  466
            SRN  HF  E  EKLG  K+P 
Sbjct  141  SRNCNHFTNEFCEKLGARKIPG  162



>ref|XP_002968463.1| hypothetical protein SELMODRAFT_16111, partial [Selaginella moellendorffii]
 ref|XP_002970638.1| hypothetical protein SELMODRAFT_16335, partial [Selaginella moellendorffii]
 gb|EFJ28768.1| hypothetical protein SELMODRAFT_16335, partial [Selaginella moellendorffii]
 gb|EFJ30717.1| hypothetical protein SELMODRAFT_16111, partial [Selaginella moellendorffii]
Length=174

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 91/137 (66%), Gaps = 7/137 (5%)
 Frame = +2

Query  62   MTEVILHIYDLT--MSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  235
            M+ V LH+YD+T  MS K N T+      +N+  +DGI +GG+FH AVQ++ E EW++G+
Sbjct  1    MSAVWLHVYDVTNSMSPKTNSTI----AGINRFFRDGIGIGGIFHGAVQVFEE-EWSFGY  55

Query  236  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  415
             + GSG+F CP   NP YTYRE++  G T  S  KVN IL EL  EWPG  Y L++RN  
Sbjct  56   CENGSGVFGCPPKSNPMYTYRETVYIGNTPFSEEKVNQILLELSKEWPGYSYDLLARNCN  115

Query  416  HFCQELLEKLGVPKLPA  466
            HFC EL  +L VPK+PA
Sbjct  116  HFCDELCVRLSVPKIPA  132



>ref|XP_002509086.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO70344.1| predicted protein, partial [Micromonas sp. RCC299]
Length=145

 Score =   122 bits (307),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 84/135 (62%), Gaps = 3/135 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M+ V LH+YD+T +    +  N  +  +N+  KD +  GG+FH AV++ G+ EW++G+ D
Sbjct  1    MSLVTLHVYDITNTQY--EAANASIQGLNRFTKDILGAGGIFHGAVEVNGD-EWSFGYCD  57

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG++ C    N  YTYRESIP G T  S ++V  IL  L+  W G EY L++RN  HF
Sbjct  58   RGSGVYCCRPRGNTGYTYRESIPLGVTALSPARVRNILGALQAAWQGHEYDLLARNCNHF  117

Query  422  CQELLEKLGVPKLPA  466
            C+   E LGV  LPA
Sbjct  118  CEAFAEMLGVGSLPA  132



>ref|XP_003061681.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH54311.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=173

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 85/135 (63%), Gaps = 3/135 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M+ V LH+YD+T +    +T N ++  +N+  KD +  GG+FH AV++ G+ EW+YG  +
Sbjct  1    MSLVTLHVYDITNTTY--ETANNVIQGLNRFTKDALGAGGIFHGAVEVNGD-EWSYGFCE  57

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG++ C    N  YTYRES+P G T  S ++V  ++  L+ +WPG EY L+ +N  HF
Sbjct  58   RGSGVYCCHPRGNTGYTYRESVPLGVTSLSPARVRSVIAVLQAQWPGCEYDLLGKNCNHF  117

Query  422  CQELLEKLGVPKLPA  466
            C+     LGVP  PA
Sbjct  118  CEAFGAMLGVPGPPA  132



>gb|KDO56773.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
Length=252

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +2

Query  164  GINLGGVFHVAV--QIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSS  337
            G+N  G+  ++   Q+YG+ EW++G  ++GSG+FSCP+ +NP YTYRESI  G+T+ S  
Sbjct  28   GLNCRGINSLSFTPQVYGDEEWSFGFCEQGSGVFSCPSGRNPMYTYRESIVLGKTNFSIF  87

Query  338  KVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            KVN IL+EL  EWPG+ Y L+ RN  HFC E  ++LGVPKLP 
Sbjct  88   KVNQILRELSREWPGNSYDLLGRNCNHFCDEFCDRLGVPKLPG  130



>ref|XP_006422021.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
 gb|ESR35261.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
Length=252

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +2

Query  164  GINLGGVFHVAV--QIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSS  337
            G+N  G+  ++   Q+YG+ EW++G  ++GSG+FSCP+ +NP YTYRESI  G+T+ S  
Sbjct  28   GLNCRGINSLSFTPQVYGDEEWSFGFCEQGSGVFSCPSGRNPMYTYRESIVLGKTNFSIF  87

Query  338  KVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            KVN IL+EL  EWPG+ Y L+ RN  HFC E  ++LGVPKLP 
Sbjct  88   KVNQILRELSREWPGNSYDLLGRNCNHFCDEFCDRLGVPKLPG  130



>ref|XP_003535600.1| PREDICTED: deSI-like protein At4g17486-like [Glycine max]
 gb|KHN21780.1| UPF0326 protein [Glycine soja]
Length=240

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 4/136 (3%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M +V+LHIYD+T    G+++    +V +N +L   I LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MVKVMLHIYDVT---NGSESKKRTIVGINNVLYGTIGLGGIFHSAVQVYGDDEWSFGFCE  57

Query  242  KG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  418
             G +G+F CPA KN  Y YR+S   G T+ +  +V  +L +L  EW GD Y  +S+N  H
Sbjct  58   GGDTGVFRCPAGKNTMYKYRKSFVLGDTNFNFFQVIEMLTQLSREWRGDSYDPLSKNCNH  117

Query  419  FCQELLEKLGVPKLPA  466
            FC E   +LGV KLP 
Sbjct  118  FCDEFCARLGVEKLPG  133



>ref|XP_002513658.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49061.1| conserved hypothetical protein [Ricinus communis]
Length=244

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +2

Query  197  VQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEW  376
            +Q+YGE EW++G  ++G+G+FSCP+ KNP YTYRESI  G+T+ S  KVN IL+EL  EW
Sbjct  1    MQVYGEDEWSFGFCEQGTGVFSCPSGKNPMYTYRESIVLGKTNFSIFKVNQILRELSREW  60

Query  377  PGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            PG  Y L+S+N  HFC E  E+LGVPKLP 
Sbjct  61   PGSAYDLLSKNCNHFCDEFCERLGVPKLPG  90



>ref|XP_006490645.1| PREDICTED: uncharacterized protein LOC102607017 isoform X2 [Citrus 
sinensis]
Length=216

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  200  QIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWP  379
            Q+YG+ EW++G  ++GSG+FSCP+ +NP YTYRESI  G+T+ S  KVN IL+EL  EWP
Sbjct  6    QVYGDEEWSFGFCEQGSGVFSCPSGRNPMYTYRESIVLGKTNFSIFKVNQILRELSREWP  65

Query  380  GDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            G+ Y L+ RN  HFC E  ++LGVPKLP 
Sbjct  66   GNSYDLLGRNCNHFCDEFCDRLGVPKLPG  94



>ref|XP_001764813.1| predicted protein [Physcomitrella patens]
 gb|EDQ70512.1| predicted protein, partial [Physcomitrella patens]
Length=192

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 85/134 (63%), Gaps = 3/134 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M  V LH+YD+T S   +D  N  +  +N++++ GI +GG+FH AV++YG+ EW++G+ +
Sbjct  1    MAVVTLHVYDVTNSI--SDGANKAISSLNRIMRGGIGIGGIFHGAVEVYGK-EWSFGYCE  57

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
             GSG+F C   +NP Y YRES+  G T  S   V+  L EL  EW G  Y L++RN  HF
Sbjct  58   SGSGVFPCTPMRNPMYNYRESLTLGSTDLSRLSVDTALLELSREWQGASYDLLARNCNHF  117

Query  422  CQELLEKLGVPKLP  463
            C    E+LGV K+P
Sbjct  118  CDAFCERLGVDKVP  131



>emb|CEF99575.1| PPPDE putative peptidase domain [Ostreococcus tauri]
Length=217

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 79/134 (59%), Gaps = 3/134 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M  V L +YD+     GN+ V   V  +N L +DG+ LGG+FH  V++YG+ EW++G+ D
Sbjct  1    MALVTLSVYDIKH--PGNEGVTSAVASLNALTRDGLRLGGIFHGGVEVYGD-EWSFGYID  57

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G++ C   KNP Y YRES+  G T  S ++V+  +  L+  W G  Y  + RN  HF
Sbjct  58   RGTGVYRCQPKKNPMYAYRESVALGVTSLSPARVSAAVAALKAAWDGPSYDALGRNCNHF  117

Query  422  CQELLEKLGVPKLP  463
            C+ L E LG    P
Sbjct  118  CEALCEALGCEGPP  131



>gb|KCW46466.1| hypothetical protein EUGRSUZ_K002931, partial [Eucalyptus grandis]
Length=204

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +2

Query  203  IYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPG  382
            +YG+ EW++G  ++G+G+FSCP+ KNP YTYRE +  G T+ S  KVN IL+EL  EWPG
Sbjct  1    VYGDDEWSFGFCEQGTGVFSCPSAKNPMYTYRERVVLGSTNFSIFKVNQILRELSREWPG  60

Query  383  DEYSLVSRNSKHFCQELLEKLGVPKLP  463
              Y L+SRN  HFC E  E+LGV KLP
Sbjct  61   HAYDLLSRNCNHFCDEFCERLGVQKLP  87



>gb|KCW46465.1| hypothetical protein EUGRSUZ_K002931, partial [Eucalyptus grandis]
Length=206

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +2

Query  203  IYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPG  382
            +YG+ EW++G  ++G+G+FSCP+ KNP YTYRE +  G T+ S  KVN IL+EL  EWPG
Sbjct  1    VYGDDEWSFGFCEQGTGVFSCPSAKNPMYTYRERVVLGSTNFSIFKVNQILRELSREWPG  60

Query  383  DEYSLVSRNSKHFCQELLEKLGVPKLP  463
              Y L+SRN  HFC E  E+LGV KLP
Sbjct  61   HAYDLLSRNCNHFCDEFCERLGVQKLP  87



>emb|CDY54090.1| BnaC08g47300D, partial [Brassica napus]
Length=779

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR-  238
            M EV++HIY+ T SG   D  +   +        G+    VFH A+Q+YG+ EW+YG+  
Sbjct  1    MREVVVHIYEATNSGSEIDRFHKDGIGPIGGGGGGV----VFHSAIQVYGDDEWSYGYYC  56

Query  239  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  418
            ++ S +FSCP+TKNP YTYRE I  G+T C+   V+ IL++L  EW    Y L S+N  H
Sbjct  57   EQASRVFSCPSTKNPMYTYREKIILGKTDCTIFTVDQILRDLTTEWSEYTYDLFSKNCNH  116

Query  419  FCQELLEKLGVPKLPA  466
            FC  L  +LGVPKLP 
Sbjct  117  FCDVLCHRLGVPKLPG  132



>ref|XP_007509551.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19354.1| predicted protein [Bathycoccus prasinos]
Length=244

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 80/134 (60%), Gaps = 3/134 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M  V L++YD+T +    D  N  +  +N L KD  N GG+FH  ++++G  E++YG+ +
Sbjct  1    MALVTLNVYDITNTKS--DLTNATIQHLNTLTKDTFNAGGIFHGGIEVHG-YEYSYGYCE  57

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G++ C    N  Y +RESIP G T   ++KV  I+  ++  WPG+EY L S+N   F
Sbjct  58   EGTGVYPCQPKMNSAYVFRESIPLGVTSADATKVRAIVAVMKASWPGNEYELFSKNCNTF  117

Query  422  CQELLEKLGVPKLP  463
            C+   + LGVP  P
Sbjct  118  CEAFTKALGVPPPP  131



>ref|XP_003081907.1| putative protein (ISS), partial [Ostreococcus tauri]
Length=429

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 79/134 (59%), Gaps = 3/134 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M  V L +YD+     GN+ V   V  +N L +DG+ LGG+FH  V++YG+ EW++G+ D
Sbjct  213  MALVTLSVYDIKH--PGNEGVTSAVASLNALTRDGLRLGGIFHGGVEVYGD-EWSFGYID  269

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +G+G++ C   KNP Y YRES+  G T  S ++V+  +  L+  W G  Y  + RN  HF
Sbjct  270  RGTGVYRCQPKKNPMYAYRESVALGVTSLSPARVSAAVAALKAAWDGPSYDALGRNCNHF  329

Query  422  CQELLEKLGVPKLP  463
            C+ L E LG    P
Sbjct  330  CEALCEALGCEGPP  343



>ref|XP_009621011.1| PREDICTED: uncharacterized protein LOC104112711, partial [Nicotiana 
tomentosiformis]
Length=215

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +2

Query  197  VQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEW  376
             Q+YG+ EW++G  ++G+G+FSCPA KNP YTYRE I  G T+    +VN IL+EL  EW
Sbjct  13   TQVYGDDEWSFGFCEQGTGVFSCPAGKNPMYTYRECIVLGTTNHQIFEVNQILRELSREW  72

Query  377  PGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            PG  Y L+++N  HFC E  E+LGV KLP 
Sbjct  73   PGHSYDLLAKNCNHFCDEFCERLGVQKLPG  102



>emb|CDY52367.1| BnaA08g31020D, partial [Brassica napus]
Length=779

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 13/140 (9%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGV----FHVAVQIYGEVEWAY  229
            M EV++HIYD T SG  ++ ++      N+  KDGI         FH A+Q+YG+ EW++
Sbjct  1    MREVVVHIYDATNSG--SEEID------NRFHKDGIGPIVGGGGVFHSAIQVYGDDEWSF  52

Query  230  GHR-DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSR  406
            G+  ++ S +FSCP+TKNP YTYRE I  G+T CS   V+ IL++L  EW    Y   S+
Sbjct  53   GYYCEQASRVFSCPSTKNPMYTYREKIILGKTDCSIFTVDQILRDLTREWSEYTYDSFSK  112

Query  407  NSKHFCQELLEKLGVPKLPA  466
            N  HFC  L ++LGVPKLP 
Sbjct  113  NCNHFCDVLCDRLGVPKLPG  132



>ref|XP_009109196.1| PREDICTED: uncharacterized protein LOC103834861 isoform X1 [Brassica 
rapa]
Length=1024

 Score =   112 bits (281),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 61/136 (45%), Positives = 85/136 (63%), Gaps = 3/136 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR-  238
            M EV++HIYD T SG  ++ ++    +       G   GGVFH A+Q+YG+ EW++G+  
Sbjct  1    MREVVVHIYDATNSG--SEEIDNRFHKDGIGPIVGGGGGGVFHSAIQVYGDDEWSFGYYC  58

Query  239  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  418
            ++ S +FSCP+TKNP YTYRE I  G+T CS    + IL++L  EW    Y   S+N  H
Sbjct  59   EQASRVFSCPSTKNPMYTYREKIILGKTDCSIFTFDQILRDLTREWSEYTYDSFSKNCNH  118

Query  419  FCQELLEKLGVPKLPA  466
            FC  L ++LGVPKLP 
Sbjct  119  FCDVLCDRLGVPKLPG  134



>ref|XP_001701830.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06805.1| predicted protein [Chlamydomonas reinhardtii]
Length=457

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 85/132 (64%), Gaps = 4/132 (3%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  250
            V+L++YD+T +   N+  N  + ++N + ++ +++GGVFH A+++  +VEW++G+ + G+
Sbjct  5    VLLNVYDVTNTA--NENTNSFIQRLNSITRE-LSIGGVFHGAIEV-DDVEWSFGYCESGT  60

Query  251  GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQE  430
            G++ C A +N  Y +RE++  G T  S  ++  I+  L+  W G  Y L+ RN  HFC++
Sbjct  61   GVYCCRARQNTMYNFRETLELGVTEKSKQEIKEIVARLKRAWAGTSYDLLQRNCCHFCEQ  120

Query  431  LLEKLGVPKLPA  466
            L  +LGVP  PA
Sbjct  121  LCAELGVPPPPA  132



>ref|XP_001420272.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98565.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=175

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 80/134 (60%), Gaps = 3/134 (2%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  241
            M  V L +YD+  +   N  ++  V  +N L ++ +N+GG+FH  V+++G+ EW++G+  
Sbjct  1    MALVTLSVYDIKHAE--NARISSAVTSLNTLTRNALNVGGIFHGGVEVFGD-EWSFGYCP  57

Query  242  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
            +GSG++ C    NP Y YRES+P G T  S ++ +  +  LR +W G +Y ++ RN  HF
Sbjct  58   EGSGVYRCNPRMNPMYEYRESVPLGVTSLSPARASAAVAALRAQWRGSDYEVLERNCNHF  117

Query  422  CQELLEKLGVPKLP  463
            C+ L E LG    P
Sbjct  118  CEALCEALGCEGPP  131



>ref|XP_002782648.1| hypothetical protein Pmar_PMAR021197 [Perkinsus marinus ATCC 
50983]
 gb|EER14443.1| hypothetical protein Pmar_PMAR021197 [Perkinsus marinus ATCC 
50983]
Length=463

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = +2

Query  143  MNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKN-PNY--TYRESIPA  313
            +N +L + + +GG FH AV++YG VEW+YG+   G G+F+ P T + P    TYRE +P 
Sbjct  112  VNTVLSEVVGVGGAFHAAVEVYG-VEWSYGYCQYGCGVFAVPPTSSEPGSIGTYRECLPV  170

Query  314  GRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKL  445
             R     ++V  IL+EL+ +WPG  Y L+ RN  HFC   L KL
Sbjct  171  ERCRLPVTEVIQILEELKGDWPGSSYDLLHRNCTHFCDVFLRKL  214



>ref|XP_008659205.1| PREDICTED: deSI-like protein At4g17486 [Zea mays]
Length=234

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 69/131 (53%), Gaps = 18/131 (14%)
 Frame = +2

Query  56   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG-  232
            S  + V L++YD+T +   N    ++ +             GV+H  VQ++G VE+AYG 
Sbjct  27   SSSSPVFLNVYDVTPA---NGYARWLGL-------------GVYHSGVQVHG-VEYAYGA  69

Query  233  HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  412
            H    SGIF     + P Y +RES+  G T  S  +V  ++ EL  E+PGD Y+LVSRN 
Sbjct  70   HDGASSGIFEVVPRRCPGYAFRESVAVGATELSRGEVRALMAELAAEFPGDAYNLVSRNC  129

Query  413  KHFCQELLEKL  445
             HFC     +L
Sbjct  130  NHFCDAACRRL  140



>gb|AFW85568.1| hypothetical protein ZEAMMB73_042236 [Zea mays]
Length=223

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 69/131 (53%), Gaps = 18/131 (14%)
 Frame = +2

Query  56   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG-  232
            S  + V L++YD+T +   N    ++ +             GV+H  VQ++G VE+AYG 
Sbjct  27   SSSSPVFLNVYDVTPA---NGYARWLGL-------------GVYHSGVQVHG-VEYAYGA  69

Query  233  HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  412
            H    SGIF     + P Y +RES+  G T  S  +V  ++ EL  E+PGD Y+LVSRN 
Sbjct  70   HDGASSGIFEVVPRRCPGYAFRESVAVGATELSRGEVRALMAELAAEFPGDAYNLVSRNC  129

Query  413  KHFCQELLEKL  445
             HFC     +L
Sbjct  130  NHFCDAACRRL  140



>gb|EEC80134.1| hypothetical protein OsI_21921 [Oryza sativa Indica Group]
Length=268

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+AYG H   GSGIF     + P Y +RE+I  G T  + ++V  ++
Sbjct  72   GVYHSGVQVHG-VEYAYGAHDGAGSGIFEVAPRRCPGYAFREAILVGTTELTRAEVRAVM  130

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
             +L  ++PGD Y+LVSRN  HFC     +L   ++P
Sbjct  131  ADLAADFPGDAYNLVSRNCNHFCDAACRRLVRARIP  166



>gb|KDO56774.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
 gb|KDO56775.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
 gb|KDO56776.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
Length=183

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  287  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            YTYRESI  G+T+ S  KVN IL+EL  EWPG+ Y L+ RN  HFC E  ++LGVPKLP 
Sbjct  2    YTYRESIVLGKTNFSIFKVNQILRELSREWPGNSYDLLGRNCNHFCDEFCDRLGVPKLPG  61



>gb|ACU22856.1| unknown [Glycine max]
Length=176

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  287  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            YTYRESI  G+T+ S  K+N IL+EL  EWPG  Y L+S+N  HFC E  E+LGVPKLP 
Sbjct  2    YTYRESIVLGKTNFSIFKLNQILRELSREWPGSSYDLLSKNCNHFCDEFCERLGVPKLPG  61



>emb|CDY62507.1| BnaC04g56370D [Brassica napus]
Length=241

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 78/138 (57%), Gaps = 20/138 (14%)
 Frame = +2

Query  56   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG  232
            + +  V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G
Sbjct  15   TALLPVYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFG  56

Query  233  -HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRN  409
             H    +GIF     K P +T+R+SI  G+T  ++ +V + +++L +E+ G++Y+L+SRN
Sbjct  57   AHEAPSTGIFEVEPKKCPGFTFRKSILVGKTDMAAKEVRVFMEKLAEEYRGNKYNLISRN  116

Query  410  SKHFCQELLEKLGVPKLP  463
              HFC E+  KL    +P
Sbjct  117  CNHFCNEVCVKLTQKPIP  134



>ref|XP_003560998.1| PREDICTED: deSI-like protein At4g17486 [Brachypodium distachyon]
Length=254

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+AYG H   GSGIF     + P Y +RES+  G T  + ++V  ++
Sbjct  66   GVYHSGVQVHG-VEYAYGAHEGNGSGIFEVLPRRCPGYAFRESVLVGTTELTRAQVRAVM  124

Query  356  K-ELRDEWPGDEYSLVSRNSKHFCQELLEKL  445
              EL  E+PGD Y+LVSRN  HFC     +L
Sbjct  125  AGELAAEFPGDAYNLVSRNCNHFCDAACRRL  155



>ref|XP_009140629.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=249

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  20   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHEAP  61

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T  ++ +V + +++L +E+ G++Y+L+SRN  HFC
Sbjct  62   STGIFEVEPKKCPGFTFRKSILVGKTDMAAKEVRVFMEKLAEEYRGNKYNLISRNCNHFC  121

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  122  NEVCVKLTQKPIP  134



>emb|CDY35370.1| BnaA04g14770D [Brassica napus]
Length=246

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 77/136 (57%), Gaps = 20/136 (15%)
 Frame = +2

Query  62   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-H  235
            +  V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H
Sbjct  17   LLPVYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAH  58

Query  236  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  415
                +GIF     K P +T+R+SI  G+T  ++ +V + +++L +E+ G++Y+L+SRN  
Sbjct  59   EAPSTGIFEVEPKKCPGFTFRKSILVGKTDMAAKEVRVFMEKLAEEYRGNKYNLISRNCN  118

Query  416  HFCQELLEKLGVPKLP  463
            HFC E+  KL    +P
Sbjct  119  HFCNEVCVKLTQKPIP  134



>ref|NP_001056566.2| Os06g0107000 [Oryza sativa Japonica Group]
 dbj|BAD67713.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18480.2| Os06g0107000 [Oryza sativa Japonica Group]
Length=187

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  287  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            YTYRESI  G+T CS   VN IL+EL  +WPG  Y L+SRN  HFC    EKL VPKLPA
Sbjct  2    YTYRESIVLGKTTCSIFTVNQILRELSWKWPGGSYELLSRNCNHFCNTFCEKLDVPKLPA  61



>ref|NP_565588.1| PPPDE putative thiol peptidase-like protein [Arabidopsis thaliana]
 gb|AAK43853.1|AF370476_1 Unknown protein [Arabidopsis thaliana]
 gb|AAD23672.1| expressed protein [Arabidopsis thaliana]
 gb|AAM10253.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62471.1| unknown [Arabidopsis thaliana]
 gb|AEC07669.1| PPPDE putative thiol peptidase-like protein [Arabidopsis thaliana]
Length=240

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T   + +V + +++L +E+ G++Y L++RN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVFMEKLAEEYQGNKYHLITRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  121  NEVCLKLAQKSIP  133



>gb|KFK32585.1| hypothetical protein AALP_AA6G262400 [Arabis alpina]
Length=240

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T  S+ +V + +++L +E+ G++Y L+ RN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDSSAKEVRVFMEKLAEEYKGNKYHLIRRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  121  NEVCLKLTQNPIP  133



>ref|XP_006655688.1| PREDICTED: uncharacterized protein LOC102722125 isoform X1 [Oryza 
brachyantha]
Length=193

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  287  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            YTYRESI  G+T CS   VN IL+EL  +WPG  Y L+SRN  HFC    EKL VPKLPA
Sbjct  2    YTYRESIVLGKTSCSIFTVNQILQELSWKWPGGSYELLSRNCNHFCNAFCEKLEVPKLPA  61



>ref|XP_002878832.1| hypothetical protein ARALYDRAFT_481377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55091.1| hypothetical protein ARALYDRAFT_481377 [Arabidopsis lyrata subsp. 
lyrata]
Length=241

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T   + +V + +++L +E+ G++Y L++RN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVFMEKLAEEYQGNKYHLITRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  121  NEVCLKLTQKSIP  133



>ref|XP_009117078.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=240

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHEYP  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T   +  V + +++L +E+ G++Y+L+SRN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDTCARDVRVYMEKLAEEYRGNKYNLISRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    LP
Sbjct  121  NEVCVKLTQKPLP  133



>ref|XP_006405117.1| hypothetical protein EUTSA_v10000310mg [Eutrema salsugineum]
 gb|ESQ46570.1| hypothetical protein EUTSA_v10000310mg [Eutrema salsugineum]
Length=236

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GVFH  V+I+G VE+A+G H    +GIF     K P +T+R+SI  G+T   + +V + +
Sbjct  39   GVFHSGVEIHG-VEYAFGAHESSSTGIFEVEPKKCPGFTFRKSILVGQTDMGAKEVRVYM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G++Y L++RN  HFC E+  KL   ++P
Sbjct  98   EKLAEEYQGNKYHLITRNCNHFCNEVCIKLTQKQIP  133



>ref|XP_010472522.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=240

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T   + +V + +++L +E+ G++Y L++RN  HFC
Sbjct  61   NTGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVYMEKLAEEYQGNKYHLITRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  121  NEVCVKLTQKSIP  133



>ref|XP_006294896.1| hypothetical protein CARUB_v10023946mg [Capsella rubella]
 gb|EOA27794.1| hypothetical protein CARUB_v10023946mg [Capsella rubella]
Length=241

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T   + +V + +++L +E+ G++Y L++RN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVYMEKLAEEYQGNKYHLITRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  121  NEVCIKLTQKSIP  133



>ref|XP_009037509.1| hypothetical protein AURANDRAFT_6447, partial [Aureococcus anophagefferens]
 gb|EGB07699.1| hypothetical protein AURANDRAFT_6447, partial [Aureococcus anophagefferens]
Length=105

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = +2

Query  176  GGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GG+FH  V++ G VE++YG+ D+G+G+F+         ++R  +P GR    +  +   L
Sbjct  3    GGIFHAGVELAG-VEYSYGYCDRGTGVFTNDPLDAYGASHRSRVPMGRCGLDARAIERRL  61

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
              L   W G+ Y+L++RN  HFC  L  +LGV  +PA
Sbjct  62   ARLVALWQGNTYALLTRNCCHFCDALCAELGVGPIPA  98



>gb|ACJ85321.1| unknown [Medicago truncatula]
 gb|AFK35321.1| unknown [Medicago truncatula]
Length=200

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  287  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            YTYRESI  G+T+    KVN I++EL  EWPG  Y L+S+N  HFC E  E+L VPKLP 
Sbjct  2    YTYRESIVLGKTNFPIFKVNQIIRELSREWPGTAYDLLSKNCNHFCDEFCERLDVPKLPG  61



>ref|XP_010417284.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=236

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (55%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T   + +V + +++L  E+ G++Y L++RN  HFC
Sbjct  61   NTGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVYMEKLAQEYQGNKYHLITRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  121  NEVCVKLTQKSIP  133



>ref|XP_002437960.1| hypothetical protein SORBIDRAFT_10g005540 [Sorghum bicolor]
 gb|EER89327.1| hypothetical protein SORBIDRAFT_10g005540 [Sorghum bicolor]
Length=272

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 80/167 (48%), Gaps = 30/167 (18%)
 Frame = +2

Query  2    EQHRLPQHTELLASTIFISKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGG  181
             Q +L Q      +    S  + V L++YD+T +   N    ++ +             G
Sbjct  15   RQQQLQQRGAGAGAGEAPSSSSPVFLNVYDVTPA---NGYARWLGL-------------G  58

Query  182  VFHVAVQ----------IYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHC  328
            V+H  VQ          ++G VE+AYG H    SGIF     + P YT+RES+  G T  
Sbjct  59   VYHSGVQGTFCSPGSRPLHG-VEYAYGAHDGASSGIFEVVPRRCPGYTFRESVLVGTTEL  117

Query  329  SSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKL--GVPKLP  463
            S ++V  ++ +L  ++PGD Y+LVSRN  HFC     +L  G  ++P
Sbjct  118  SRAEVRALMSDLAADFPGDAYNLVSRNCNHFCDAACRRLVAGRARIP  164



>emb|CDX76766.1| BnaC08g33520D [Brassica napus]
Length=236

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHEYP  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T   +  V + +++L +E+ G++Y+L+SRN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDKCARDVRVYMEKLAEEYRGNKYNLISRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  121  NEVCVKLTQKPIP  133



>ref|XP_010429510.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=240

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (55%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T   + +V + +++L  E+ G++Y L++RN  HFC
Sbjct  61   NTGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVYMEKLAQEYQGNKYHLITRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  121  NEVCVKLTQKSIP  133



>ref|XP_002140825.1| hypothetical protein [Cryptosporidium muris RN66]
 gb|EEA06476.1| hypothetical protein, conserved [Cryptosporidium muris RN66]
Length=256

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 73/133 (55%), Gaps = 16/133 (12%)
 Frame = +2

Query  71   VILHIYDL-TMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG-HRDK  244
            VIL++YDL ++SG             N+L +  I   G FH  V++YG +E+ YG   D 
Sbjct  59   VILNVYDLDSISGS-----------FNRLTR--IFELGAFHAGVEVYG-IEYCYGLTTDG  104

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             SG+      ++P + YRESI  GRT  + ++V L++  L+ +WPG EY++  RN  +F 
Sbjct  105  SSGLTVNMPRQHPTHIYRESITMGRTKYTRNEVKLLITRLKYKWPGSEYNIFRRNCLNFA  164

Query  425  QELLEKLGVPKLP  463
             E  + L V  +P
Sbjct  165  DEFCQILEVGTIP  177



>emb|CDY56277.1| BnaA09g55810D [Brassica napus]
Length=548

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 74/133 (56%), Gaps = 20/133 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHEYP  60

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G+T   +  V + +++L +E+ G++Y+L+SRN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDTCARDVRVYMEKLAEEYRGNKYNLISRNCNHFC  120

Query  425  QELLEKLGVPKLP  463
             E+  KL    +P
Sbjct  121  NEVCVKLTQKPIP  133



>ref|XP_008452873.1| PREDICTED: deSI-like protein At4g17486 [Cucumis melo]
Length=235

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G H    SGIF     + P +T+R+SI  GRT+    +V   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHATSGIFEVEPRQCPGFTFRKSICIGRTNLGPKEVRSFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G+ Y L++RN  HFC ++  +L    +P+
Sbjct  98   EKLAEEYSGNTYHLITRNCNHFCNDVCIRLAGKPIPS  134



>emb|CDJ26229.1| hypothetical protein [Brassica oleracea]
Length=229

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 20/134 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  244
            V L++YDLT        +N+           G  LG G++H  ++++G VE+ YG H   
Sbjct  21   VYLNVYDLT-------PMNFY----------GYWLGIGIYHSGLEVHG-VEYGYGAHEHS  62

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GIF     K P +T+R+SI  G T   + +V   ++EL DE+ G +Y L++RN  HFC
Sbjct  63   STGIFKVEPKKCPGFTFRKSILVGETEMKAKEVGSFMEELADEYQGSKYHLITRNCNHFC  122

Query  425  QELLEKLGVPKLPA  466
             ++  KL    +P+
Sbjct  123  NDVCLKLTQKSIPS  136



>ref|XP_009383188.1| PREDICTED: deSI-like protein At4g17486 [Musa acuminata subsp. 
malaccensis]
Length=236

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ +G VE+AYG H    +GIF     + P +T+R+SI  GRT     +V  ++
Sbjct  38   GVYHSGVQAHG-VEYAYGAHEHPTTGIFEGEPRQCPGFTFRKSILIGRTDLGPREVRALM  96

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            +E+  E+ GD Y+LVS+N  HFC E   +L    +P
Sbjct  97   EEMAAEYTGDTYNLVSKNCNHFCDEACLRLTGKPIP  132



>ref|XP_009126505.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
 emb|CDX75209.1| BnaA01g04930D [Brassica napus]
Length=230

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  ++++G VE+ YG H    +GIF     K P +T+R+SI  G T   + ++   +
Sbjct  42   GIYHSGLEVHG-VEYGYGAHEHSSTGIFKVEPKKCPGFTFRKSILVGETEMKAKEIGSFM  100

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            +EL DE+ G +Y L++RN  HFC ++  KL    +P+
Sbjct  101  EELSDEYQGSKYHLITRNCNHFCNDVCLKLTQKSIPS  137



>emb|CDX68806.1| BnaC01g06470D [Brassica napus]
Length=310

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  ++++G VE+ YG H    +GIF     K P +T+R+SI  G T   + +V   +
Sbjct  42   GIYHSGLEVHG-VEYGYGAHEHSSTGIFKVEPKKCPGFTFRKSILVGETEMKAKEVGSFM  100

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            +EL DE+ G +Y L++RN  HFC ++  KL    +P+
Sbjct  101  EELADEYQGSKYHLITRNCNHFCNDVCLKLTQKSIPS  137



>ref|XP_004145512.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 ref|XP_004167666.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 gb|KGN55449.1| hypothetical protein Csa_4G652130 [Cucumis sativus]
Length=234

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G H    SGIF     + P +T+R+SI  GRT+     V   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHATSGIFEVEPRQCPGFTFRKSICIGRTNLGPKDVRSFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G+ Y L++RN  HFC ++  +L    +P+
Sbjct  98   EKLAEEYSGNTYHLITRNCNHFCNDVCIRLAGKPIPS  134



>ref|XP_010665872.1| PREDICTED: deSI-like protein At4g17486 [Beta vulgaris subsp. 
vulgaris]
Length=226

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G H +  +G+F     + P +T+R+SI  GRT   + +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAFGAHDNATTGVFEVEPKQCPGFTFRKSILIGRTDLGAKEVRALM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L  E+ G+ Y L+S+N  HFC +L  +L    +P+
Sbjct  96   EKLSKEYFGNTYHLISKNCNHFCNDLCIRLSGKPIPS  132



>ref|XP_009039394.1| hypothetical protein AURANDRAFT_7483, partial [Aureococcus anophagefferens]
 gb|EGB05850.1| hypothetical protein AURANDRAFT_7483 [Aureococcus anophagefferens]
Length=105

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYGH-RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GVFH A+++YG+ E+++G  R   SGIF+C     P +TYRESI  G    +  +V  IL
Sbjct  1    GVFHGAIEVYGQ-EFSFGGCRQNKSGIFACKPKSCPMHTYRESIYLGDCKKTIKEVQSIL  59

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
              ++ EW G  Y+L+ +N   F     +KLGV ++P
Sbjct  60   DSMKPEWMGPTYNLLRKNCCSFSNAFAQKLGVGEIP  95



>ref|XP_010526233.1| PREDICTED: deSI-like protein At4g17486 [Tarenaya hassleriana]
Length=248

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  V ++G VE+A+G H    +GIF     K P +TYR+SI  G+T     +V   +
Sbjct  39   GIYHSGVAVHG-VEYAFGAHEHSSTGIFEVEPKKCPGFTYRKSILVGKTDMGPKEVRAFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G++Y+L+ RN  HFC ++  KL   ++P+
Sbjct  98   EKLAEEYRGNKYNLIRRNCNHFCNDVCLKLTQKQIPS  134



>emb|CBI21088.3| unnamed protein product [Vitis vinifera]
Length=174

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  VQ++G VE+A+G H    +GIF     + P +T+R+SI  GRT      V   +
Sbjct  37   GIYHSGVQVHG-VEYAFGAHEHPTTGIFEVEPKQCPGFTFRKSILIGRTDLGPKDVRSFM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y+L++RN  HFC ++  +L    +P
Sbjct  96   EKLAEEYSGNTYNLITRNCNHFCNDVCNRLTGKPIP  131



>ref|XP_008445255.1| PREDICTED: deSI-like protein At4g17486 [Cucumis melo]
Length=234

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G H    +GIF       P +TYR+SI  GRT+ S  ++   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHASTGIFEVEPKHCPGFTYRKSILIGRTNLSPREIRSFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCVRLTGKPIP  133



>ref|NP_001174638.1| Os06g0182100 [Oryza sativa Japonica Group]
 dbj|BAD72532.1| apoptosis-related protein PNAS-4 like [Oryza sativa Japonica 
Group]
 dbj|BAD72576.1| apoptosis-related protein PNAS-4 like [Oryza sativa Japonica 
Group]
 dbj|BAH93366.1| Os06g0182100 [Oryza sativa Japonica Group]
Length=271

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 7/102 (7%)
 Frame = +2

Query  179  GVFHVAVQ-IYG-----EVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSS  337
            GV+H  VQ +Y       + +AYG H   GSGIF     + P Y +RE+I  G T  + +
Sbjct  66   GVYHSGVQGMYALLSSPSILYAYGAHDGAGSGIFEVAPRRCPGYAFREAILVGTTELTRA  125

Query  338  KVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            +V  ++ +L  ++PGD Y+LVSRN  HFC     +L   ++P
Sbjct  126  EVRAVMADLAADFPGDAYNLVSRNCNHFCDAACRRLVRARIP  167



>ref|XP_011036649.1| PREDICTED: deSI-like protein At4g17486 [Populus euphratica]
Length=232

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  VQ++G VE+ +G H    +GIF     + P + +R+SI  GRT     +V + +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHDHPTTGIFEVEPKQCPGFMFRKSILIGRTDLGPKEVRVFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L  E+PG+ Y L+++N  HFC ++  KL   K+P
Sbjct  98   EKLAQEFPGNTYHLITKNCNHFCNDVCLKLTGKKIP  133



>ref|XP_004138707.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 ref|XP_004160769.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 gb|KGN62984.1| hypothetical protein Csa_2G382570 [Cucumis sativus]
Length=234

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G H    +GIF       P +TYR+SI  GRT+ S  ++   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHASTGIFEVEPKHCPGFTYRKSILIGRTNLSPREIRSFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCIRLTGKPIP  133



>gb|EXX77625.1| hypothetical protein RirG_022140 [Rhizophagus irregularis DAOM 
197198w]
Length=158

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 64/130 (49%), Gaps = 14/130 (11%)
 Frame = +2

Query  59   KMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR  238
            K   V L++YD+   GK  D    M V             GVFH +V+I G      GH 
Sbjct  22   KYISVYLNVYDMLPRGKITDMCYKMGV-------------GVFHSSVEILGREYNFGGHD  68

Query  239  DKGSGIF-SCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  415
               +G+F + P    PN T++ESI  G T     ++  ++ EL  EW G+ Y+L++RN  
Sbjct  69   SDYTGVFVTRPKQGPPNVTFKESIAMGYTTMDKEEIKNVIDELSREWHGNTYNLLTRNCN  128

Query  416  HFCQELLEKL  445
            HF  EL E+L
Sbjct  129  HFSSELCEQL  138



>ref|XP_009032180.1| hypothetical protein AURANDRAFT_19518 [Aureococcus anophagefferens]
 gb|EGB12505.1| hypothetical protein AURANDRAFT_19518 [Aureococcus anophagefferens]
Length=182

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 63/113 (56%), Gaps = 0/113 (0%)
 Frame = +2

Query  125  NYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRES  304
            N ++ ++N ++++ +  GGVFH A+++ G      G R    GIF+C   K P +T+RES
Sbjct  18   NKVLQELNYVVENFLGEGGVFHGAIEVCGHEHSFGGCRQNRCGIFTCEPKKCPMHTFRES  77

Query  305  IPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
               G    S  +++ +L+ ++ EW G  Y L+ +N  +F +    KLG  K+P
Sbjct  78   FYLGDCGKSERQIHDVLESMKPEWMGPTYDLLRKNCCYFSEAFSLKLGTGKIP  130



>gb|KFH04834.1| putative PPPDE peptidase domain protein, partial [Toxoplasma 
gondii MAS]
Length=255

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 15/122 (12%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYGHR-DK  244
            V LH+YDL      + T++     MNK+++    LG G FH  V++YG +E+ YG   DK
Sbjct  94   VFLHVYDL------DPTISKY---MNKVMRP---LGAGAFHAGVEVYG-IEYCYGQTYDK  140

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
              GI      ++P + YRE+I  G+T  +  +   +++ L+DEWPG++Y++++RN  +F 
Sbjct  141  TPGITVNRPRRHPAHIYRETIYMGQTTLAHEEFMALIEALKDEWPGEKYNILTRNCLNFA  200

Query  425  QE  430
             +
Sbjct  201  DQ  202



>ref|XP_002324900.1| hypothetical protein POPTR_0018s02300g [Populus trichocarpa]
 gb|EEF03465.1| hypothetical protein POPTR_0018s02300g [Populus trichocarpa]
Length=232

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  VQ++G VE+ +G H    +GIF     + P + +R+SI  GRT     +V + +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHDHPTTGIFEVEPKQCPGFMFRKSILIGRTDLGPKEVRVFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L  E+PG+ Y L+++N  HFC ++  KL   K+P
Sbjct  98   EKLAQEFPGNTYHLITKNCNHFCNDVCLKLTGKKIP  133



>gb|EXX77624.1| hypothetical protein RirG_022140 [Rhizophagus irregularis DAOM 
197198w]
Length=192

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 64/130 (49%), Gaps = 14/130 (11%)
 Frame = +2

Query  59   KMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR  238
            K   V L++YD+   GK  D    M V             GVFH +V+I G      GH 
Sbjct  22   KYISVYLNVYDMLPRGKITDMCYKMGV-------------GVFHSSVEILGREYNFGGHD  68

Query  239  DKGSGIF-SCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  415
               +G+F + P    PN T++ESI  G T     ++  ++ EL  EW G+ Y+L++RN  
Sbjct  69   SDYTGVFVTRPKQGPPNVTFKESIAMGYTTMDKEEIKNVIDELSREWHGNTYNLLTRNCN  128

Query  416  HFCQELLEKL  445
            HF  EL E+L
Sbjct  129  HFSSELCEQL  138



>emb|CDP18789.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G H    +G+F     + P +T+R+SI  GRT     +V   +
Sbjct  42   GVYHSGVQVHG-VEYAFGAHEHSTTGVFEVEPKQCPGFTFRKSILIGRTDLGPKEVRAFM  100

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G+ Y+L+++N  HFC ++  +L    +P+
Sbjct  101  EKLAEEYSGNTYNLITKNCNHFCNDVCLRLTRKPIPS  137



>ref|XP_010942141.1| PREDICTED: deSI-like protein At4g17486 [Elaeis guineensis]
Length=221

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+AYG H    +GIF     + P + +R+SI  GRT      V  ++
Sbjct  37   GVYHSGVQVHG-VEYAYGAHEHATTGIFEGEPRQCPGFVFRKSILIGRTDLGPRDVRALM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            +EL  E+ G+ Y+L+S+N  HFC E   +L    +P
Sbjct  96   EELATEYTGNTYNLISKNCNHFCNEACLRLTNKPIP  131



>ref|XP_010648702.1| PREDICTED: deSI-like protein At4g17486 [Vitis vinifera]
Length=226

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  VQ++G VE+A+G H    +GIF     + P +T+R+SI  GRT      V   +
Sbjct  37   GIYHSGVQVHG-VEYAFGAHEHPTTGIFEVEPKQCPGFTFRKSILIGRTDLGPKDVRSFM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y+L++RN  HFC ++  +L    +P
Sbjct  96   EKLAEEYSGNTYNLITRNCNHFCNDVCNRLTGKPIP  131



>ref|XP_008808226.1| PREDICTED: deSI-like protein At4g17486 [Phoenix dactylifera]
Length=221

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+AYG H    +GIF     + P + +R+SI  GRT     +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAYGAHEHATTGIFEGEPRQCPGFVFRKSILIGRTDLGQREVRALM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            +EL  E+ G+ Y+L+S+N  HFC +   +L    +P
Sbjct  96   EELAAEYTGNTYNLISKNCNHFCNKACLRLTNKPIP  131



>ref|XP_011039595.1| PREDICTED: deSI-like protein At4g17486 [Populus euphratica]
 ref|XP_011039596.1| PREDICTED: deSI-like protein At4g17486 [Populus euphratica]
Length=235

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 71/132 (54%), Gaps = 18/132 (14%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG-HRDKG  247
            V L++YDLT       TVN     +      G+   GV+H  VQ++G VE+ +G H  + 
Sbjct  19   VYLNVYDLT-------TVNGYAYWV------GL---GVYHSGVQVHG-VEYGFGAHDHET  61

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            +GIF     + P + +R+SI  GRT     +V   +++L  E+PG+ Y L+++N  HFC 
Sbjct  62   TGIFEVEPKQCPGFMFRKSILIGRTDLGPKEVRAFMEKLAQEYPGNAYHLITKNCNHFCN  121

Query  428  ELLEKLGVPKLP  463
            ++  KL    +P
Sbjct  122  DMCFKLTGKTIP  133



>ref|XP_006285485.1| hypothetical protein CARUB_v10006919mg [Capsella rubella]
 gb|EOA18383.1| hypothetical protein CARUB_v10006919mg [Capsella rubella]
Length=660

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEKSSSGIFEVEPKKCPGFTFRKSILVGETEMRAKEVRTFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G++Y+L++RN  HFC  +  KL    +P+
Sbjct  98   EKLAEEYQGNKYNLITRNCNHFCNHVCLKLTQKSIPS  134



>gb|KFG50460.1| putative PPPDE peptidase domain protein, partial [Toxoplasma 
gondii p89]
Length=312

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 15/122 (12%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYGHR-DK  244
            V LH+YDL      + T++     MNK+++    LG G FH  V++YG +E+ YG   DK
Sbjct  94   VFLHVYDL------DPTISKY---MNKVMRP---LGAGAFHAGVEVYG-IEYCYGQTYDK  140

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
              GI      ++P + YRE+I  G+T  +  +   +++ L+DEWPG++Y++++RN  +F 
Sbjct  141  TPGITVNRPRRHPAHIYRETIYMGQTTLAHEEFMALIEALKDEWPGEKYNILTRNCLNFA  200

Query  425  QE  430
             +
Sbjct  201  DQ  202



>ref|XP_009394943.1| PREDICTED: deSI-like protein At4g17486 [Musa acuminata subsp. 
malaccensis]
Length=231

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+AYG H    +GIF     + P + +R+SI  GRT     +V  ++
Sbjct  50   GVYHSGVQVHG-VEYAYGAHDHPTTGIFEGEPRQCPGFVFRKSILIGRTDLGPCEVRALM  108

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            +EL  ++ GD Y+L+S+N  HFC E   +L    +P
Sbjct  109  EELAAKYTGDTYNLISKNCNHFCNEASLRLTGKPIP  144



>ref|XP_006412534.1| hypothetical protein EUTSA_v10025954mg [Eutrema salsugineum]
 gb|ESQ53987.1| hypothetical protein EUTSA_v10025954mg [Eutrema salsugineum]
Length=275

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEQPSSGIFEVEPKKCPGFTFRKSILVGETEMRAKEVRSFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G++Y L++RN  HFC  +  KL    +P+
Sbjct  98   EKLSEEYQGNKYHLITRNCNHFCNHVCLKLTQNAIPS  134



>ref|XP_002309663.2| hypothetical protein POPTR_0006s27740g [Populus trichocarpa]
 gb|EEE93186.2| hypothetical protein POPTR_0006s27740g [Populus trichocarpa]
Length=235

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+++G H  + +GIF     + P + +R+SI  GRT     +V   +
Sbjct  39   GVYHSGVQVHG-VEYSFGAHDHETTGIFEVEPKQCPGFMFRKSILIGRTDLGPKEVRAFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L  E+PG+ Y L+++N  HFC ++  KL    +P
Sbjct  98   EKLAQEYPGNTYHLITKNCNHFCNDVCFKLTGKTIP  133



>ref|XP_008883291.1| hypothetical protein HHA_256780 [Hammondia hammondi]
 gb|KEP66583.1| hypothetical protein HHA_256780 [Hammondia hammondi]
Length=447

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 15/122 (12%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYGHR-DK  244
            V LH+YDL      + T++     MNK+++    LG G FH  V++YG +E+ YG   DK
Sbjct  94   VFLHVYDL------DPTISKY---MNKVMRP---LGAGAFHAGVEVYG-IEYCYGQTYDK  140

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
              GI      ++P + YRE+I  G+T  +  +   +++ L+DEWPG++Y++++RN  +F 
Sbjct  141  SPGITVNRPRRHPAHIYRETIYMGQTTLAHEEFMALIEALKDEWPGEKYNILTRNCLNFA  200

Query  425  QE  430
             +
Sbjct  201  DQ  202



>ref|XP_004291942.1| PREDICTED: deSI-like protein At4g17486 [Fragaria vesca subsp. 
vesca]
Length=216

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYGHRDKGS-GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G  D  S GIF     K P + +R+SI  GRT     +V   +
Sbjct  38   GVYHSGVQVHG-VEYAFGAHDHASTGIFEVEPKKCPGFVFRKSILIGRTDLGPKEVRAFM  96

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +++ G+ Y L+++N  HFC ++  KL    +P
Sbjct  97   EKLAEDYSGNTYHLITKNCNHFCNDVCLKLTERTIP  132



>gb|EYU32380.1| hypothetical protein MIMGU_mgv1a013824mg [Erythranthe guttata]
Length=209

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  VQ++G +E+A+G H    +GIF       P +T+R+SI  GR+    ++V+  +
Sbjct  37   GIYHSGVQVHG-IEYAFGAHEHSATGIFEVEPKHCPGFTFRKSILIGRSDLGLNEVSEFM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y+L++RN  HFC ++  +L    +P
Sbjct  96   EKLAEEYSGNTYNLITRNCNHFCNDVCLRLTGKPIP  131



>ref|XP_010929119.1| PREDICTED: deSI-like protein At4g17486 [Elaeis guineensis]
Length=228

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+AYG H     GIF     + P + +R+SI  GRT     +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAYGAHEHATPGIFEGEPRQCPGFVFRKSILIGRTDMGPREVRALM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            +EL  ++ G+ Y+L+S+N  HFC E   +L    +P
Sbjct  96   EELATDYTGNTYNLISKNCNHFCNETCLRLTNKPIP  131



>ref|XP_008605728.1| hypothetical protein SDRG_01949 [Saprolegnia diclina VS20]
 gb|EQC40884.1| hypothetical protein SDRG_01949 [Saprolegnia diclina VS20]
Length=207

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 70/135 (52%), Gaps = 22/135 (16%)
 Frame = +2

Query  65   TEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDK  244
            T VIL++YDL       D   Y           G+ LG  FH  V I G+ E+++     
Sbjct  7    TAVILNVYDLM------DANAY---------THGLGLG-AFHSGVDIAGD-EYSFA---G  46

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
            G+GIF+C   +     +RESIP G    SS+    +L ELR E+ G +Y+L+++N   F 
Sbjct  47   GAGIFTCRPKQADGAVFRESIPMGYFEGSSNDARQVLDELRSEFQGHQYNLLTKNCNTFS  106

Query  425  QEL-LEKLGVPKLPA  466
             EL L  LGVP +PA
Sbjct  107  NELCLRLLGVP-IPA  120



>ref|XP_821729.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN99878.1| hypothetical protein, conserved [Trypanosoma cruzi]
Length=240

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 70/135 (52%), Gaps = 20/135 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  250
            V L++YDLT   + ND           L   GI   G+ H  V++YG +E+A+G  D+GS
Sbjct  57   VFLNLYDLT---EANDV----------LYHAGI---GLHHTGVEVYG-MEFAFGRCDEGS  99

Query  251  GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRD---EWPGDEYSLVSRNSKHF  421
            G+F      +P + +RE +  G T  S  +V  I+KE ++   +W G  Y LV  N  HF
Sbjct  100  GVFEVAPRYSPPHIFREQLVLGETQLSQQEVLNIVKEFKENDRQWSGRAYHLVQNNCNHF  159

Query  422  CQELLEKLGVPKLPA  466
             +   ++L  P++ A
Sbjct  160  SEAFAKRLLPPEVRA  174



>gb|KFK29811.1| hypothetical protein AALP_AA7G181900 [Arabis alpina]
Length=222

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T  ++ +V   +
Sbjct  40   GIYHSGLEVHG-VEYGYGAHEAPSSGIFEVEPKKCPGFTFRKSILVGETEMNAKEVRTFM  98

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
             +L +E+ G+ Y +++RN  HFC ++  KL    +P+
Sbjct  99   LKLAEEYKGNNYHIITRNCNHFCNQVCLKLTQKSIPS  135



>gb|EPR63050.1| hypothetical protein TGGT1_256780 [Toxoplasma gondii GT1]
Length=447

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 15/122 (12%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYGHR-DK  244
            V LH+YDL      + T++     MNK+++    LG G FH  V++YG +E+ YG   DK
Sbjct  94   VFLHVYDL------DPTISKY---MNKVMRP---LGAGAFHAGVEVYG-IEYCYGQTYDK  140

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
              GI      ++P + YRE+I  G+T  +  +   +++ L+DEWPG++Y++++RN  +F 
Sbjct  141  TPGITVNRPRRHPAHIYRETIYMGQTTLAHEEFMALIEALKDEWPGEKYNILTRNCLNFA  200

Query  425  QE  430
             +
Sbjct  201  DQ  202



>gb|AAL38722.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14255.1| unknown protein [Arabidopsis thaliana]
Length=249

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEKSSSGIFEVEPKKCPGFTFRKSILVGETEMKAKEVRSFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G++Y L++RN  HFC  +  KL    +P+
Sbjct  98   EKLSEEYQGNKYHLITRNCNHFCNHVSLKLTHKSIPS  134



>ref|XP_005704609.1| hypothetical protein Gasu_44260 [Galdieria sulphuraria]
 gb|EME28089.1| hypothetical protein Gasu_44260 [Galdieria sulphuraria]
Length=180

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 70/134 (52%), Gaps = 9/134 (7%)
 Frame = +2

Query  65   TEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDK  244
            T V+LH+YDL       D V  +    N L+  G+   G FH  V+I+G+ E+++G  + 
Sbjct  13   TPVVLHVYDLIHP----DEVERLRKVNNYLILFGL---GFFHSGVEIFGK-EYSFGANNS  64

Query  245  -GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  421
              +G+FS P  +     YR+SI  G T  S  +V  +++ +  E+PG  YSL   N  HF
Sbjct  65   METGVFSVPPKQTVGAIYRQSILIGETLYSEHEVEHLIRIVAAEYPGSSYSLFYNNCNHF  124

Query  422  CQELLEKLGVPKLP  463
              +L E+L    +P
Sbjct  125  SNDLCERLCGKSIP  138



>gb|EPT29210.1| hypothetical protein TGME49_256780 [Toxoplasma gondii ME49]
 gb|ESS28647.1| putative PPPDE peptidase domain protein [Toxoplasma gondii VEG]
 gb|KFG31254.1| putative PPPDE peptidase domain protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG32804.1| putative PPPDE peptidase domain protein [Toxoplasma gondii FOU]
 gb|KFH00752.1| putative PPPDE peptidase domain protein [Toxoplasma gondii VAND]
Length=447

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 15/122 (12%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYGHR-DK  244
            V LH+YDL      + T++     MNK+++    LG G FH  V++YG +E+ YG   DK
Sbjct  94   VFLHVYDL------DPTISKY---MNKVMRP---LGAGAFHAGVEVYG-IEYCYGQTYDK  140

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
              GI      ++P + YRE+I  G+T  +  +   +++ L+DEWPG++Y++++RN  +F 
Sbjct  141  TPGITVNRPRRHPAHIYRETIYMGQTTLAHEEFMALIEALKDEWPGEKYNILTRNCLNFA  200

Query  425  QE  430
             +
Sbjct  201  DQ  202



>gb|KFG64955.1| putative PPPDE peptidase domain protein [Toxoplasma gondii RUB]
Length=447

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 15/122 (12%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYGHR-DK  244
            V LH+YDL      + T++     MNK+++    LG G FH  V++YG +E+ YG   DK
Sbjct  94   VFLHVYDL------DPTISKY---MNKVMRP---LGAGAFHAGVEVYG-IEYCYGQTYDK  140

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
              GI      ++P + YRE+I  G+T  +  +   +++ L+DEWPG++Y++++RN  +F 
Sbjct  141  TPGITVNRPRRHPAHIYRETIYMGQTTLAHEEFMALIEALKDEWPGEKYNILTRNCLNFA  200

Query  425  QE  430
             +
Sbjct  201  DQ  202



>ref|XP_001347354.2| PPPDE peptidase, putative [Plasmodium falciparum 3D7]
 gb|AAN35267.2| PPPDE peptidase, putative [Plasmodium falciparum 3D7]
 gb|ETW18232.1| hypothetical protein PFFVO_02748 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW42630.1| hypothetical protein PFNF135_02902 [Plasmodium falciparum NF135/5.C10]
 gb|ETW61303.1| hypothetical protein PFMC_02723 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUT85703.1| hypothetical protein PFAG_02736 [Plasmodium falciparum Santa 
Lucia]
 emb|CDO64500.1| PPPDE peptidase, putative [Plasmodium reichenowi]
Length=219

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 81/156 (52%), Gaps = 21/156 (13%)
 Frame = +2

Query  5    QHRLPQHTELLASTIFISKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGV  184
             H      +++    F S M  V L+IYDL    K  +TV   V              G 
Sbjct  26   DHDENAEVDVIPEPDFNSNM--VYLNIYDLDSVSKVVNTVARSVG------------AGA  71

Query  185  FHVAVQIYGEVEWAYGH-RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKE  361
            FH  V++YG  E+++G+  D  +G+    A  +P + YRE+IP G+T  +  +V+L+++ 
Sbjct  72   FHAGVEVYG-YEYSFGYIMDGETGVTKTNARYHPYHVYRETIPMGKTPLTKEEVDLLVEV  130

Query  362  LRDEWPGDEYSLVSRN----SKHFCQELLEKLGVPK  457
            ++ +W GD Y ++SRN    + +FC  LL+  G+P+
Sbjct  131  MKLQWIGDTYDILSRNCLNYADYFCN-LLDVGGIPE  165



>ref|XP_009794916.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana sylvestris]
Length=161

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G H    +GIF     + P +T+R+SI  GRT     +V   +
Sbjct  37   GVYHSGVQVHG-VEYAFGAHEHPTTGIFEVEPKQCPGFTFRKSILIGRTDLGPKEVRAFM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G  Y+L+++N  HFC ++  +L    +P
Sbjct  96   EKLAEEYTGHSYNLITKNCNHFCSDVCVRLTGKPIP  131



>gb|KFK27777.1| hypothetical protein AALP_AA8G427400 [Arabis alpina]
Length=214

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  36   GIYHSGVEVHG-VEYGFGAHEHSSTGIFEVEPKQCPGFTFRKSILVGRTDLDPEKVRAFM  94

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+
Sbjct  95   EKLAEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPS  131



>gb|KDO30954.1| hypothetical protein SPRG_04142 [Saprolegnia parasitica CBS 223.65]
Length=207

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 71/135 (53%), Gaps = 22/135 (16%)
 Frame = +2

Query  65   TEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDK  244
            T VIL++YDL              ++ N     G+ LG  FH  V I G+ E+++     
Sbjct  7    TAVILNVYDL--------------MEANAYTH-GLGLG-AFHSGVDIAGD-EYSFA---G  46

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
            G+GIF+C   +     +RESIP G    SS+    +L ELR E+ G +Y+L+++N   F 
Sbjct  47   GAGIFTCRPKQADGAVFRESIPMGYFEGSSNDARQVLDELRSEFQGHQYNLLTKNCNTFS  106

Query  425  QEL-LEKLGVPKLPA  466
             EL L  LGVP +PA
Sbjct  107  NELCLRLLGVP-IPA  120



>gb|KDO17263.1| hypothetical protein SPRG_17305 [Saprolegnia parasitica CBS 223.65]
Length=207

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 71/135 (53%), Gaps = 22/135 (16%)
 Frame = +2

Query  65   TEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDK  244
            T VIL++YDL              V+ N     G+ LG  FH  V I G+ E+++     
Sbjct  7    TAVILNVYDL--------------VEANAYTH-GLGLG-AFHSGVDIAGD-EYSFA---G  46

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
            G+GIF+C   +     +RESIP G    SS+    +L ELR E+ G +Y+L+++N   F 
Sbjct  47   GAGIFTCRPKQADGAVFRESIPMGYFEGSSNDARQVLDELRSEFQGHQYNLLTKNCNTFS  106

Query  425  QELLEKL-GVPKLPA  466
             EL  +L GVP +PA
Sbjct  107  NELCLRLVGVP-IPA  120



>ref|XP_002869301.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45560.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=677

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEHSSSGIFEVEPKKCPGFTFRKSILVGETEMRAKEVRTFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G++Y L++RN  HFC  +  KL    +P+
Sbjct  98   EKLSEEYQGNKYHLITRNCNHFCNHVCLKLTQNSIPS  134



>ref|XP_001681304.1| hypothetical protein LMJF_09_1310 [Leishmania major strain Friedlin]
 emb|CAJ03005.1| hypothetical protein LMJF_09_1310 [Leishmania major strain Friedlin]
Length=254

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 69/133 (52%), Gaps = 23/133 (17%)
 Frame = +2

Query  56   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  235
            S+   V L++YD+    +G+ T+ Y V              GV HV VQ+YG+ E+ YGH
Sbjct  34   SQPNAVFLNVYDV----RGSSTLLYSVGW------------GVHHVGVQVYGK-EYQYGH  76

Query  236  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRD--EWPGDEYSLVSRN  409
            R  G GI S    ++P +TYRE    G+T  S+S+V  ++    D  EW G  Y LV  N
Sbjct  77   RPIGKGIGSVKPHQSPPHTYREQFFLGQTQLSASEVEKLVVAFSDKVEWLGSNYHLVKHN  136

Query  410  ----SKHFCQELL  436
                ++ FC+ LL
Sbjct  137  CIDFARAFCEALL  149



>ref|XP_008378831.1| PREDICTED: deSI-like protein At4g17486 [Malus domestica]
Length=229

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYGHRDKG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G  D   +GIF     + P + +R+SI  GRT     +V   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHDHATTGIFEVEPKQCPGFVFRKSILIGRTDLDPKEVRAFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCTRLTGKPIP  133



>ref|XP_002364925.1| hypothetical protein, conserved [Toxoplasma gondii ME49]
Length=363

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 72/122 (59%), Gaps = 15/122 (12%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYGHR-DK  244
            V LH+YDL      + T++     MNK+++    LG G FH  V++YG +E+ YG   DK
Sbjct  94   VFLHVYDL------DPTISKY---MNKVMRP---LGAGAFHAGVEVYG-IEYCYGQTYDK  140

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
              GI      ++P + YRE+I  G+T  +  +   +++ L+DEWPG++Y++++RN  +F 
Sbjct  141  TPGITVNRPRRHPAHIYRETIYMGQTTLAHEEFMALIEALKDEWPGEKYNILTRNCLNFA  200

Query  425  QE  430
             +
Sbjct  201  DQ  202



>ref|XP_002951862.1| hypothetical protein VOLCADRAFT_92471 [Volvox carteri f. nagariensis]
 gb|EFJ46967.1| hypothetical protein VOLCADRAFT_92471 [Volvox carteri f. nagariensis]
Length=403

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 58/131 (44%), Gaps = 35/131 (27%)
 Frame = +2

Query  176  GGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNL--  349
            G  FH AVQ+  ++EW++G+ + G+G++ C A  N  YT+RE I  G T  +  +V L  
Sbjct  16   GTTFHGAVQLE-DLEWSFGYCESGTGVYCCRARSNSLYTFREHIELGATRKTKQEVRLGT  74

Query  350  --------------------------------ILKELRDEWPGDEYSLVSRNSKHFCQEL  433
                                            IL   +  WPG  Y L+ RN  HFC++L
Sbjct  75   GDGVASVVAAVVVVVVVVAAVVAGGGGGSIREILSRFKRAWPGSSYDLLQRNCCHFCEDL  134

Query  434  LEKLGVPKLPA  466
               L VP  PA
Sbjct  135  CLALEVPSPPA  145



>gb|ADE75652.1| unknown [Picea sitchensis]
Length=267

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 72/137 (53%), Gaps = 18/137 (13%)
 Frame = +2

Query  59   KMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG-H  235
            + T V L++YDLT     N  V +  +             GVFH  V+++G VE+A+G H
Sbjct  58   EATHVYLNVYDLT---PMNGYVYWAGL-------------GVFHSGVEVHG-VEYAFGVH  100

Query  236  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  415
                SG+F     + P +T+R+SI  G T+ S S++   L++L   + GD Y L+++N  
Sbjct  101  DFPTSGVFEVEPRQCPGFTFRKSIYIGTTNLSPSQLREFLEQLAGNYNGDTYHLIAKNCN  160

Query  416  HFCQELLEKLGVPKLPA  466
            HFC ++  KL    +P 
Sbjct  161  HFCNDICLKLTGNSIPG  177



>emb|CDY65538.1| BnaCnng47550D [Brassica napus]
 emb|CDY65539.1| BnaCnng47560D [Brassica napus]
 emb|CDX88162.1| BnaA06g27530D [Brassica napus]
Length=220

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GVYHSGVEVHG-VEYGFGAHEHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+
Sbjct  99   EKLSEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPS  135



>ref|XP_002515452.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46901.1| conserved hypothetical protein [Ricinus communis]
Length=230

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYGHRDKGS-GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  VQ++G VE+ +G  D  S GIF     + P +T+R+SI  GRT     +V   +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHDHSSTGIFEVEPKQCPGFTFRKSILIGRTDLGPKEVRAFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L  E+ G+ Y L+++N  HFC ++  KL    +P
Sbjct  98   EKLAHEYSGNSYHLITKNCNHFCNDVCIKLTGKTIP  133



>ref|XP_953566.1| hypothetical protein [Theileria annulata]
 emb|CAI72888.1| hypothetical protein, conserved [Theileria annulata]
Length=365

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 75/133 (56%), Gaps = 14/133 (11%)
 Frame = +2

Query  68   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  247
            EV L+IYDL       + +NY V  M   +  GI   G +H  ++IYG  E+ YG+  KG
Sbjct  186  EVYLNIYDL-------EKINYYVNSMANSM--GI---GAYHAGIEIYG-TEYNYGYNPKG  232

Query  248  -SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
             +GI S     +P + YR++I  G+T  +  +V  I++ ++  W   +Y+++ RN  +F 
Sbjct  233  GTGITSTIPKFHPYHKYRKTINLGKTKFTPLQVQNIIQNMKSYWIAYDYNILHRNCLNFA  292

Query  425  QELLEKLGVPKLP  463
            +EL E+L V ++P
Sbjct  293  KELSERLEVDEIP  305



>ref|XP_009151042.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=220

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GVYHSGVEVHG-VEYGFGAHEHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+
Sbjct  99   EKLAEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPS  135



>gb|KDP33538.1| hypothetical protein JCGZ_07109 [Jatropha curcas]
Length=230

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYGHRDKGS-GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  VQ++  +E+ +G  D  S GIF     + P +T+R+SI  GRT     +V   +
Sbjct  39   GIYHSGVQVH-NIEYGFGAHDHPSTGIFEVEPKQCPGFTFRKSILIGRTDLGPKEVRTFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L  ++PG+ Y L+++N  HFC ++  KL    +P
Sbjct  98   EKLAQDYPGNSYHLITKNCNHFCNDVCHKLTGKTIP  133



>emb|CDY07077.1| BnaA04g22380D [Brassica napus]
Length=220

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GVYHSGVEVHG-VEYGFGAHEHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+
Sbjct  99   EKLAEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPS  135



>ref|XP_008377676.1| PREDICTED: deSI-like protein At4g17486 [Malus domestica]
Length=229

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G H    +GIF     + P + +R+SI  GRT      +   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHATTGIFEVEPKQCPGFVFRKSILIGRTDLGPKDIRAFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCTRLTRKPIP  133



>ref|XP_007223906.1| hypothetical protein PRUPE_ppa010937mg [Prunus persica]
 gb|EMJ25105.1| hypothetical protein PRUPE_ppa010937mg [Prunus persica]
Length=229

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYGHRDKG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G  D   +GIF     + P + +R+SI  GRT     +V   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHDHATTGIFEVEPKQCPGFVFRKSILIGRTDLGPKEVRAFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCTRLTGKPIP  133



>ref|XP_667786.1| hypothetical protein [Cryptosporidium hominis TU502]
Length=269

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 70/132 (53%), Gaps = 14/132 (11%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  250
            VIL++YDL       D ++  + +  ++ +      G FH  ++IYG VE+ +G    GS
Sbjct  78   VILNVYDL-------DAISGSINRFTRVFE-----LGAFHAGIEIYG-VEYCFGSTSDGS  124

Query  251  -GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
             GI      ++P + YRES+  GRT+ S  ++  I+ E++  W G +Y++  RN   F  
Sbjct  125  SGITVNLPRRHPIHIYRESVKMGRTNYSRGEIKRIINEMKPLWLGSDYNIFRRNCLTFAD  184

Query  428  ELLEKLGVPKLP  463
            EL   L V ++P
Sbjct  185  ELCMVLNVGQIP  196



>ref|XP_626306.1| protease  [Cryptosporidium parvum Iowa II]
 gb|EAK88874.1| predicted protease [Cryptosporidium parvum Iowa II]
Length=269

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 70/132 (53%), Gaps = 14/132 (11%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  250
            VIL++YDL       D ++  + +  ++ +      G FH  ++IYG VE+ +G    GS
Sbjct  78   VILNVYDL-------DAISGSINRFTRVFE-----LGAFHAGIEIYG-VEYCFGSTSDGS  124

Query  251  -GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
             GI      ++P + YRES+  GRT+ S  ++  I+ E++  W G +Y++  RN   F  
Sbjct  125  SGITVNLPRRHPIHIYRESVKMGRTNYSRGEIKRIINEMKPLWLGSDYNIFRRNCLTFAD  184

Query  428  ELLEKLGVPKLP  463
            EL   L V ++P
Sbjct  185  ELCMVLNVGQIP  196



>ref|XP_006450315.1| hypothetical protein CICLE_v10009362mg [Citrus clementina]
 ref|XP_006483449.1| PREDICTED: deSI-like protein At4g17486-like [Citrus sinensis]
 gb|ESR63555.1| hypothetical protein CICLE_v10009362mg [Citrus clementina]
 gb|KDO67511.1| hypothetical protein CISIN_1g026795mg [Citrus sinensis]
Length=233

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYGHRDKG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  VQ++G VE+ +G  D   +GIF     + P +T+R+SI  GRT     +V   +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHDHSTTGIFEVEPKQCPGFTFRKSILIGRTDLGPREVRAFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y L+++N  HFC ++  KL    +P
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCLKLTRKPIP  133



>ref|XP_818745.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gb|EAN96894.1| hypothetical protein, conserved [Trypanosoma cruzi]
Length=245

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 69/135 (51%), Gaps = 20/135 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  250
            V L++YDLT   + ND           L   GI   G+ H  V++YG +E+A+G  D+GS
Sbjct  57   VFLNLYDLT---EANDV----------LYHAGI---GLHHTGVEVYG-MEFAFGRCDEGS  99

Query  251  GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRD---EWPGDEYSLVSRNSKHF  421
            G+F      +P + +RE +  G T  S  +V  ++KE ++   +W G  Y LV  N  HF
Sbjct  100  GVFEVAPRYSPPHIFREQLVLGETQLSQQEVLNLVKEFKENDRQWSGRAYHLVQNNCNHF  159

Query  422  CQELLEKLGVPKLPA  466
             +    +L  P++ A
Sbjct  160  SEAFAMRLLPPEVRA  174



>ref|XP_006288624.1| hypothetical protein CARUB_v10001926mg [Capsella rubella]
 gb|EOA21522.1| hypothetical protein CARUB_v10001926mg [Capsella rubella]
Length=219

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT   S KV   +
Sbjct  40   GIYHSGVEVHG-VEYGFGAHEHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDSDKVRSFM  98

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +++ G+ Y L+++N  HFC ++  +L    +P
Sbjct  99   EKLAEDYSGNTYHLITKNCNHFCNDVCVQLTRRSIP  134



>ref|XP_004833685.1| hypothetical protein BEWA_042710 [Babesia equi]
 gb|EKX74233.1| hypothetical protein BEWA_042710 [Babesia equi strain WA]
Length=319

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 83/155 (54%), Gaps = 17/155 (11%)
 Frame = +2

Query  14   LPQHTELLASTIFISKMTE---VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGV  184
            + Q ++     + IS+ TE   V L+IYDL       ++VN +V      +  G    G 
Sbjct  128  IRQTSKPAGKPVKISQPTEYGHVYLNIYDL-------ESVNKVVN-----VVAGTFGAGA  175

Query  185  FHVAVQIYGEVEWAYGHRD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKE  361
            +H  V+IYG  E+ YG+    G+G+       +P++ YR++I  G+T  S  +VN I++ 
Sbjct  176  YHAGVEIYG-YEYNYGYTSLGGTGVMQSFPRFHPSHVYRKTIDLGKTRFSPREVNEIVER  234

Query  362  LRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            L+ +WPG++Y L+ RN  +F      +L V ++P+
Sbjct  235  LKLQWPGNKYDLLKRNCLNFANAFCVELEVGEIPS  269



>gb|EKG02185.1| hypothetical protein TCSYLVIO_006794 [Trypanosoma cruzi]
Length=321

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 69/135 (51%), Gaps = 20/135 (15%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  250
            V L++YDLT   + ND           L   GI   G+ H  V++YG +E+A+G  D+GS
Sbjct  138  VFLNLYDLT---EANDV----------LYHAGI---GLHHTGVEVYG-MEFAFGRCDEGS  180

Query  251  GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRD---EWPGDEYSLVSRNSKHF  421
            G+F      +P + +RE +  G T  S  +V  I+KE ++   +W G  Y LV  N  HF
Sbjct  181  GVFEVAPRYSPPHIFREQLVLGETQLSQQEVLNIVKEFKENDRQWSGRAYHLVQNNCNHF  240

Query  422  CQELLEKLGVPKLPA  466
             +    +L  P++ A
Sbjct  241  SEAFAMRLLPPEVRA  255



>ref|XP_003603314.1| hypothetical protein MTR_3g106240 [Medicago truncatula]
 gb|AES73565.1| PPPDE thiol peptidase family protein, putative [Medicago truncatula]
Length=213

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++ +VE+ +G H +  +GIF       P +T+R+SI  G T   ++ + + +
Sbjct  39   GVYHSGVQVH-DVEYGFGAHENDTTGIFEVQPKNCPGFTFRKSIFIGTTDLGTNDIRVFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L  E+ G+ Y L+S+N  HFC ++  KL    +P
Sbjct  98   EKLAQEYSGNSYHLISKNCNHFCHDVCYKLTGKSIP  133



>ref|XP_010313710.1| PREDICTED: deSI-like protein At4g17486 isoform X2 [Solanum lycopersicum]
Length=223

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 71/137 (52%), Gaps = 21/137 (15%)
 Frame = +2

Query  56   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  235
            S  T VIL++YDLT + + +  + +                G+FH  ++++G +E+ YG 
Sbjct  23   SYETPVILNVYDLTPANQYSVWLGF----------------GIFHSGIEVHG-MEYGYGA  65

Query  236  RD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  412
             D   SG+F       P + YR S+P GR     S+ +  L+++  E+ GD Y L+S+N 
Sbjct  66   HDFPISGVFEVEPKSCPGFIYRCSVPLGRIKMPPSEFHAFLEDVASEYHGDTYHLISKNC  125

Query  413  KHFCQELLEKL---GVP  454
             HF  ++ ++L   G+P
Sbjct  126  NHFTDDIAQRLTGKGIP  142



>ref|XP_006394766.1| hypothetical protein EUTSA_v10004898mg [Eutrema salsugineum]
 gb|ESQ32052.1| hypothetical protein EUTSA_v10004898mg [Eutrema salsugineum]
Length=218

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  V+++G +E+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GIYHSGVEVHG-IEYGFGAHEQSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+
Sbjct  99   EKLAEEYSGNTYHLITKNCNHFCNDVCIQLTRRSIPS  135



>ref|XP_006366865.1| PREDICTED: deSI-like protein At4g17486-like [Solanum tuberosum]
Length=224

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 70/138 (51%), Gaps = 18/138 (13%)
 Frame = +2

Query  56   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  235
            S  T VIL++YDLT + + +  + +                G+FH  ++++G +E+ YG 
Sbjct  23   SYETPVILNVYDLTPANQYSVWLGF----------------GIFHSGIEVHG-MEYGYGA  65

Query  236  RD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  412
             D   SG+F       P + YR S+P GR     S+ +  L+++  E+ GD Y L+S+N 
Sbjct  66   HDFPISGVFEVEPKSCPGFIYRCSVPLGRIKMPPSEFHAFLEDVASEYHGDTYHLISKNC  125

Query  413  KHFCQELLEKLGVPKLPA  466
             HF  ++ ++L    +P 
Sbjct  126  NHFTDDIAQRLTGKGIPG  143



>gb|AFK46726.1| unknown [Lotus japonicus]
Length=217

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+ +G H    +GIF       P +T+R+S+  G T   +  V  ++
Sbjct  39   GVYHSGVQVHG-VEYGFGAHERSTTGIFEVEPGHCPGFTFRKSVYIGSTDLGAKDVRALM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L  E+PG+ Y L+ +N  HFC ++  KL    +P
Sbjct  98   EKLAAEYPGNTYHLIQKNCNHFCNDVCNKLTGKSIP  133



>ref|XP_004251588.1| PREDICTED: deSI-like protein At4g17486 isoform X1 [Solanum lycopersicum]
Length=224

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 70/138 (51%), Gaps = 18/138 (13%)
 Frame = +2

Query  56   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  235
            S  T VIL++YDLT + + +  + +                G+FH  ++++G +E+ YG 
Sbjct  23   SYETPVILNVYDLTPANQYSVWLGF----------------GIFHSGIEVHG-MEYGYGA  65

Query  236  RD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  412
             D   SG+F       P + YR S+P GR     S+ +  L+++  E+ GD Y L+S+N 
Sbjct  66   HDFPISGVFEVEPKSCPGFIYRCSVPLGRIKMPPSEFHAFLEDVASEYHGDTYHLISKNC  125

Query  413  KHFCQELLEKLGVPKLPA  466
             HF  ++ ++L    +P 
Sbjct  126  NHFTDDIAQRLTGKGIPG  143



>ref|XP_006596080.1| PREDICTED: deSI-like protein At4g17486-like isoform X2 [Glycine 
max]
Length=189

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+ +G H    +GIF       P +T+R+SI  G T      V + +
Sbjct  37   GVYHSGVQVHG-VEYGFGAHERDTTGIFEVEPGHCPGFTFRKSIFIGSTDMGPKDVRVFM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            + L DE+ G+ Y L+ +N  HFC++L  +L    +P
Sbjct  96   ERLADEYSGNTYHLIQKNCNHFCEDLCFRLTGKSIP  131



>ref|XP_010245553.1| PREDICTED: deSI-like protein At4g17486 [Nelumbo nucifera]
Length=224

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYGHRD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+A+G  D   +GIF     + P +T+R+SI  GRT     +V   +
Sbjct  37   GVYHSGVQVHG-VEYAFGAHDFPTTGIFEGEPKQCPGFTFRKSILIGRTDLGPREVRAFM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G+ Y+L+++N  HFC +   +L    +P
Sbjct  96   EKLAEEYTGNTYNLITKNCNHFCNDACLRLTGKPIP  131



>ref|NP_194926.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAA16591.1| putative protein [Arabidopsis thaliana]
 emb|CAB79916.1| putative protein [Arabidopsis thaliana]
 gb|AEE85985.1| uncharacterized protein AT4G31980 [Arabidopsis thaliana]
Length=680

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEKSSSGIFEVEPKKCPGFTFRKSILVGETEMKAKEVRSFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G++Y L++RN  HFC  +  KL    +P+
Sbjct  98   EKLSEEYQGNKYHLITRNCNHFCNHVSLKLTHKSIPS  134



>gb|KHG11379.1| hypothetical protein F383_11015 [Gossypium arboreum]
Length=271

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  VQ++G VE+ +G H    +GIF    T+ P +T+R+SI  GRT      V   +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHEHSATGIFEVEPTQCPGFTFRKSILIGRTDLGPKDVRSFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L  ++ G+ Y L+++N  HFC ++  +L    +P+
Sbjct  98   EKLATDYSGNTYHLITKNCNHFCNDVCIQLAGKPIPS  134



>gb|AFK47902.1| unknown [Lotus japonicus]
Length=226

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+ +G H  + +GIF       P +T+R+SI  G T    S+V   +
Sbjct  39   GVYHSGVQVHG-VEYGFGAHEHETTGIFEVQPKNCPGFTFRKSILIGTTDLGPSEVREFM  97

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L  E+ G+ Y L+S+N  HFC ++  KL    +P
Sbjct  98   EKLAQEYSGNTYHLISKNCNHFCADVCLKLTGKSIP  133



>ref|XP_009035395.1| hypothetical protein AURANDRAFT_7465, partial [Aureococcus anophagefferens]
 gb|EGB09396.1| hypothetical protein AURANDRAFT_7465, partial [Aureococcus anophagefferens]
Length=132

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 12/133 (9%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH-RDKG  247
            V  H+YD+  S          + ++N++ +  +  GGVFH A+++ G  E+++G  R + 
Sbjct  2    VFFHVYDVGKSKH--------IRRLNRVTE--VVGGGVFHGAIEVCG-AEFSFGGCRAQR  50

Query  248  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  427
            SG+F C  TK P + YRES   G       +V  IL  L   W G  Y L+ +N   F +
Sbjct  51   SGVFKCEPTKCPMHGYRESAYLGDCGLKPPQVQAILAALSPNWYGPTYDLIRKNCCSFSK  110

Query  428  ELLEKLGVPKLPA  466
                +LGV  +PA
Sbjct  111  AFAVELGVGPVPA  123



>ref|XP_010421363.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=218

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYGHRDKGS-GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            G++H  V+++G VE+ +G  D  + GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GIYHSGVEVHG-VEYGFGAHDHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  466
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+
Sbjct  99   EKLAEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPS  135



>ref|XP_009593660.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana tomentosiformis]
Length=223

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  V ++G VE+A+G H    +GIF     + P +T+R+SI  GRT     +V   +
Sbjct  37   GVYHSGVHVHG-VEYAFGAHEHPTTGIFEVEPKQCPGFTFRKSILIGRTDLGPKEVRAFM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            ++L +E+ G  Y+L+++N  HFC ++  +L    +P
Sbjct  96   EKLAEEYTGHSYNLITKNCNHFCSDVCVRLTGKPIP  131



>ref|XP_009390569.1| PREDICTED: deSI-like protein At4g17486 [Musa acuminata subsp. 
malaccensis]
Length=231

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+AYG H    +GIF     + P + +R+SI  G T     +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAYGAHEHPTTGIFEGEPRQCPGFAFRKSIHIGLTDLGPREVRALV  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            +E+  E+ GD Y+L+S+N  HFC +   +L    +P
Sbjct  96   EEMSAEYTGDTYNLISKNCNHFCDDACLRLTGKHIP  131



>ref|XP_003881761.1| hypothetical protein NCLIV_015220 [Neospora caninum Liverpool]
 emb|CBZ51728.1| hypothetical protein NCLIV_015220 [Neospora caninum Liverpool]
Length=421

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 71/122 (58%), Gaps = 15/122 (12%)
 Frame = +2

Query  71   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYGH-RDK  244
            V LH+YDL      + T++     MNK+++    LG G FH  V++YG +E+ YG   DK
Sbjct  77   VHLHVYDL------DPTISKY---MNKVMR---PLGAGAFHAGVEVYG-IEYCYGQTHDK  123

Query  245  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  424
              GI      ++P + YRE+I  G T  +  +   +++ L+DEWPG++Y++++RN  +F 
Sbjct  124  SPGITVNRPRRHPAHIYRETIYMGETALAHEEFVALIEALKDEWPGEKYNILTRNCLNFA  183

Query  425  QE  430
             +
Sbjct  184  DQ  185



>ref|XP_003544599.1| PREDICTED: deSI-like protein At4g17486-like isoform X1 [Glycine 
max]
 gb|KHN04156.1| UPF0326 protein [Glycine soja]
Length=215

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +2

Query  179  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  355
            GV+H  VQ++G VE+ +G H    +GIF       P +T+R+SI  G T      V + +
Sbjct  37   GVYHSGVQVHG-VEYGFGAHERDTTGIFEVEPGHCPGFTFRKSIFIGSTDMGPKDVRVFM  95

Query  356  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLP  463
            + L DE+ G+ Y L+ +N  HFC++L  +L    +P
Sbjct  96   ERLADEYSGNTYHLIQKNCNHFCEDLCFRLTGKSIP  131



>emb|CDU19249.1| PPPDE peptidase, putative [Plasmodium yoelii]
 emb|CDZ13552.1| PPPDE peptidase, putative [Plasmodium yoelii]
Length=218

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 81/147 (55%), Gaps = 23/147 (16%)
 Frame = +2

Query  38   ASTIFISKMTE--VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIY  208
            ++TI+I  +    V L+IYDL    K           +N ++K    +G G FH  V++Y
Sbjct  28   STTIYIPDVNSSMVYLNIYDLDPVSK----------VLNSVVKP---IGTGAFHAGVEVY  74

Query  209  GEVEWAYGH-RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGD  385
            G  E+++G+  D  +G+       +P + YRESI  G+T  + ++VNL++  ++ +W GD
Sbjct  75   G-YEYSFGYVADGKTGVMKSDPRYHPYHVYRESISMGKTPLTKTEVNLLVDVMKLQWIGD  133

Query  386  EYSLVSRN----SKHFCQELLEKLGVP  454
             Y ++SRN    + +FC  LL+  GVP
Sbjct  134  TYDILSRNCLNYADYFCN-LLDVGGVP  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556930065965