BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004N20

Length=485
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004246260.1|  PREDICTED: probable phytol kinase 3, chlorop...    101   1e-22   Solanum lycopersicum
gb|ADZ24711.1|  phytol kinase                                           101   2e-22   Solanum pennellii
ref|XP_006354090.1|  PREDICTED: probable phytol kinase 3, chlorop...    100   2e-22   Solanum tuberosum [potatoes]
ref|XP_009790459.1|  PREDICTED: probable phytol kinase 3, chlorop...    100   3e-22   Nicotiana sylvestris
emb|CDP09225.1|  unnamed protein product                              99.8    3e-22   Coffea canephora [robusta coffee]
ref|XP_009591334.1|  PREDICTED: probable phytol kinase 3, chlorop...    100   4e-22   Nicotiana tomentosiformis
gb|EYU45412.1|  hypothetical protein MIMGU_mgv1a010789mg              96.7    6e-21   Erythranthe guttata [common monkey flower]
ref|XP_011098894.1|  PREDICTED: probable phytol kinase 3, chlorop...  92.8    1e-19   Sesamum indicum [beniseed]
ref|XP_002516647.1|  Phytol kinase 1, chloroplast precursor, puta...  92.4    2e-19   Ricinus communis
gb|KCW54679.1|  hypothetical protein EUGRSUZ_I00620                   87.4    1e-18   Eucalyptus grandis [rose gum]
gb|KJB83903.1|  hypothetical protein B456_013G270100                  89.4    1e-18   Gossypium raimondii
gb|KCW54678.1|  hypothetical protein EUGRSUZ_I00620                   88.6    2e-18   Eucalyptus grandis [rose gum]
gb|KCW54680.1|  hypothetical protein EUGRSUZ_I00620                   87.0    2e-18   Eucalyptus grandis [rose gum]
gb|KJB83901.1|  hypothetical protein B456_013G270100                  89.0    2e-18   Gossypium raimondii
ref|XP_010028018.1|  PREDICTED: probable phytol kinase 3, chlorop...  87.4    2e-18   
gb|KJB83902.1|  hypothetical protein B456_013G270100                  89.4    3e-18   Gossypium raimondii
gb|KHG05203.1|  putative phytol kinase 3, chloroplastic               89.0    3e-18   Gossypium arboreum [tree cotton]
ref|XP_006280848.1|  hypothetical protein CARUB_v10026834mg           88.6    4e-18   Capsella rubella
gb|KCW54682.1|  hypothetical protein EUGRSUZ_I00621                   87.4    5e-18   Eucalyptus grandis [rose gum]
gb|KDP45737.1|  hypothetical protein JCGZ_17344                       88.2    6e-18   Jatropha curcas
gb|KCW54677.1|  hypothetical protein EUGRSUZ_I00620                   87.4    7e-18   Eucalyptus grandis [rose gum]
ref|XP_010069238.1|  PREDICTED: probable phytol kinase 3, chlorop...  87.4    1e-17   Eucalyptus grandis [rose gum]
ref|XP_010028019.1|  PREDICTED: probable phytol kinase 3, chlorop...  87.0    1e-17   
ref|XP_010520194.1|  PREDICTED: probable phytol kinase 2, chlorop...  87.0    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_004294311.1|  PREDICTED: probable phytol kinase 2, chlorop...  85.9    4e-17   Fragaria vesca subsp. vesca
ref|XP_009369583.1|  PREDICTED: probable phytol kinase 2, chlorop...  85.9    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_004500293.1|  PREDICTED: probable phytol kinase 3, chlorop...  85.9    4e-17   Cicer arietinum [garbanzo]
ref|XP_007205802.1|  hypothetical protein PRUPE_ppa010668mg           85.5    4e-17   
ref|XP_010443595.1|  PREDICTED: probable phytol kinase 2, chlorop...  85.5    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010453909.1|  PREDICTED: probable phytol kinase 2, chlorop...  85.5    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002313238.2|  hypothetical protein POPTR_0009s07860g           85.5    6e-17   
ref|XP_002299996.2|  hypothetical protein POPTR_0001s28680g           84.3    9e-17   Populus trichocarpa [western balsam poplar]
gb|KEH34361.1|  phytol kinase                                         84.7    9e-17   Medicago truncatula
ref|XP_011025082.1|  PREDICTED: probable phytol kinase 3, chlorop...  84.3    1e-16   Populus euphratica
ref|XP_008349551.1|  PREDICTED: probable phytol kinase 2, chlorop...  83.6    1e-16   
ref|XP_007146804.1|  hypothetical protein PHAVU_006G071000g           84.3    1e-16   Phaseolus vulgaris [French bean]
ref|XP_004500292.1|  PREDICTED: probable phytol kinase 3, chlorop...  84.3    1e-16   Cicer arietinum [garbanzo]
ref|XP_008457339.1|  PREDICTED: probable phytol kinase 2, chlorop...  84.3    1e-16   Cucumis melo [Oriental melon]
ref|XP_006401067.1|  hypothetical protein EUTSA_v10014180mg           84.0    2e-16   Eutrema salsugineum [saltwater cress]
ref|XP_007016938.1|  Phosphatidate cytidylyltransferase family pr...  83.2    3e-16   
ref|NP_200664.1|  farnesol kinase                                     83.6    3e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43853.1|  unknown protein                                      83.6    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65097.1|  unknown                                               83.2    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016939.1|  Phosphatidate cytidylyltransferase family pr...  83.2    4e-16   
ref|XP_008384758.1|  PREDICTED: probable phytol kinase 2, chlorop...  83.2    4e-16   
ref|XP_010483456.1|  PREDICTED: probable phytol kinase 2, chlorop...  82.8    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008221407.1|  PREDICTED: probable phytol kinase 3, chlorop...  82.8    6e-16   Prunus mume [ume]
ref|XP_009132038.1|  PREDICTED: probable phytol kinase 2, chlorop...  82.0    8e-16   Brassica rapa
ref|XP_010089521.1|  putative phytol kinase 3                         83.6    9e-16   
emb|CDY70799.1|  BnaAnng35070D                                        82.0    1e-15   Brassica napus [oilseed rape]
dbj|BAA97326.1|  unnamed protein product                              83.2    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145246.1|  PREDICTED: probable phytol kinase 2, chlorop...  80.9    3e-15   
gb|AFK48670.1|  unknown                                               80.9    3e-15   Lotus japonicus
emb|CDY66208.1|  BnaCnng49970D                                        80.1    4e-15   Brassica napus [oilseed rape]
gb|ACU24460.1|  unknown                                               79.7    6e-15   Glycine max [soybeans]
gb|KHN02090.1|  Putative phytol kinase 3, chloroplastic               79.7    7e-15   Glycine soja [wild soybean]
gb|ADE76360.1|  unknown                                               79.7    1e-14   Picea sitchensis
ref|XP_010910062.1|  PREDICTED: probable phytol kinase 2, chlorop...  79.0    1e-14   Elaeis guineensis
ref|XP_009132278.1|  PREDICTED: LOW QUALITY PROTEIN: probable phy...  78.6    1e-14   
ref|XP_011003752.1|  PREDICTED: probable phytol kinase 2, chlorop...  79.0    1e-14   Populus euphratica
gb|EPS57827.1|  hypothetical protein M569_16990                       78.6    1e-14   Genlisea aurea
gb|KFK27385.1|  hypothetical protein AALP_AA8G375800                  78.6    1e-14   Arabis alpina [alpine rockcress]
ref|XP_010264775.1|  PREDICTED: probable phytol kinase 2, chlorop...  77.8    2e-14   Nelumbo nucifera [Indian lotus]
emb|CDY67806.1|  BnaA10g29300D                                        78.2    2e-14   Brassica napus [oilseed rape]
ref|XP_009120370.1|  PREDICTED: probable phytol kinase 2, chlorop...  78.2    2e-14   Brassica rapa
ref|XP_010520844.1|  PREDICTED: probable phytol kinase 2, chlorop...  77.0    4e-14   
ref|XP_008811675.1|  PREDICTED: probable phytol kinase 2, chlorop...  77.0    4e-14   Phoenix dactylifera
ref|NP_001130181.1|  uncharacterized protein LOC100191275             77.4    5e-14   Zea mays [maize]
ref|XP_007016937.1|  Phosphatidate cytidylyltransferase family pr...  76.3    2e-13   
ref|XP_003564535.1|  PREDICTED: probable phytol kinase 2, chlorop...  75.5    2e-13   Brachypodium distachyon [annual false brome]
ref|XP_006292344.1|  hypothetical protein CARUB_v10018556mg           74.7    2e-13   
ref|NP_001242263.1|  probable phytol kinase 3, chloroplastic          75.1    3e-13   
ref|XP_010426391.1|  PREDICTED: probable phytol kinase 2, chlorop...  74.3    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010689412.1|  PREDICTED: probable phytol kinase 2, chlorop...  74.7    4e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010028020.1|  PREDICTED: probable phytol kinase 3, chlorop...  73.9    4e-13   
ref|XP_006387375.1|  hypothetical protein POPTR_1135s00200g           72.8    6e-13   
emb|CDY65783.1|  BnaA03g56270D                                        73.2    2e-12   Brassica napus [oilseed rape]
ref|NP_001044703.2|  Os01g0832000                                     72.0    2e-12   
ref|XP_010503534.1|  PREDICTED: probable phytol kinase 2, chlorop...  71.6    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002278563.2|  PREDICTED: probable phytol kinase 2, chlorop...  71.6    3e-12   
gb|AFW64552.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  70.5    3e-12   
ref|XP_004970454.1|  PREDICTED: probable phytol kinase 2, chlorop...  72.4    3e-12   Setaria italica
sp|Q5N9J9.3|PHYK2_ORYSJ  RecName: Full=Probable phytol kinase 2, ...  72.0    3e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ACG40052.1|  phytol kinase 2                                       71.6    4e-12   Zea mays [maize]
ref|XP_008676758.1|  PREDICTED: uncharacterized protein LOC100272...  71.6    4e-12   Zea mays [maize]
emb|CBI15916.3|  unnamed protein product                              72.0    4e-12   Vitis vinifera
ref|XP_002458716.1|  hypothetical protein SORBIDRAFT_03g038850        72.0    5e-12   
ref|XP_006644954.1|  PREDICTED: probable phytol kinase 2, chlorop...  70.5    7e-12   
gb|KDO66964.1|  hypothetical protein CISIN_1g022935mg                 70.5    7e-12   Citrus sinensis [apfelsine]
gb|KDO66966.1|  hypothetical protein CISIN_1g022935mg                 70.5    8e-12   Citrus sinensis [apfelsine]
emb|CDM84848.1|  unnamed protein product                              71.2    8e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006425113.1|  hypothetical protein CICLE_v10028969mg           70.9    8e-12   
ref|XP_006425114.1|  hypothetical protein CICLE_v10028969mg           70.5    9e-12   Citrus clementina [clementine]
ref|XP_004978591.1|  PREDICTED: probable phytol kinase 2, chlorop...  70.1    1e-11   Setaria italica
ref|XP_006488562.1|  PREDICTED: probable phytol kinase 3, chlorop...  70.1    2e-11   Citrus sinensis [apfelsine]
gb|KDO66965.1|  hypothetical protein CISIN_1g022935mg                 70.1    2e-11   Citrus sinensis [apfelsine]
ref|XP_011003760.1|  PREDICTED: probable phytol kinase 2, chlorop...  69.3    2e-11   Populus euphratica
gb|KEH28892.1|  phytol kinase                                         68.9    2e-11   Medicago truncatula
ref|XP_002278580.2|  PREDICTED: probable phytol kinase 2, chlorop...  69.7    3e-11   Vitis vinifera
emb|CBI15917.3|  unnamed protein product                              68.9    3e-11   Vitis vinifera
ref|XP_004977648.1|  PREDICTED: probable phytol kinase 2, chlorop...  68.9    4e-11   Setaria italica
ref|XP_004977649.1|  PREDICTED: probable phytol kinase 2, chlorop...  68.9    4e-11   
ref|XP_010412644.1|  PREDICTED: probable phytol kinase 2, chlorop...  68.6    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_002313239.2|  hypothetical protein POPTR_0009s07860g           67.0    1e-10   
ref|XP_006847435.1|  hypothetical protein AMTR_s00153p00083300        67.0    1e-10   
gb|EAY81967.1|  hypothetical protein OsI_37144                        67.0    2e-10   Oryza sativa Indica Group [Indian rice]
gb|KJB20420.1|  hypothetical protein B456_003G147500                  65.9    2e-10   Gossypium raimondii
ref|NP_001065534.2|  Os11g0105800                                     65.9    4e-10   
ref|XP_002450098.1|  hypothetical protein SORBIDRAFT_05g000470        65.5    5e-10   Sorghum bicolor [broomcorn]
gb|KHG27084.1|  putative phytol kinase 3, chloroplastic               65.1    5e-10   Gossypium arboreum [tree cotton]
ref|XP_003579056.1|  PREDICTED: probable phytol kinase 2, chlorop...  65.5    6e-10   Brachypodium distachyon [annual false brome]
ref|XP_009420002.1|  PREDICTED: probable phytol kinase 2, chlorop...  65.5    6e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864581.1|  hypothetical protein ARALYDRAFT_332145           66.6    8e-10   
ref|XP_009774666.1|  PREDICTED: probable phytol kinase 3, chlorop...  62.4    1e-09   Nicotiana sylvestris
gb|ABA95607.1|  phosphatidate cytidylyltransferase family protein...  64.3    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|KEH28894.1|  phytol kinase                                         63.5    2e-09   Medicago truncatula
ref|NP_001065932.1|  Os12g0105500                                     63.9    2e-09   
ref|XP_002442649.1|  hypothetical protein SORBIDRAFT_08g000500        63.9    2e-09   Sorghum bicolor [broomcorn]
ref|XP_006662647.1|  PREDICTED: probable phytol kinase 2, chlorop...  62.4    6e-09   
ref|XP_002966017.1|  hypothetical protein SELMODRAFT_230719           59.7    5e-08   
ref|XP_001780576.1|  predicted protein                                55.8    1e-06   
ref|XP_010042655.1|  PREDICTED: probable phytol kinase 3, chlorop...  50.8    2e-05   
ref|XP_005643081.1|  hypothetical protein COCSUDRAFT_49246            52.8    2e-05   Coccomyxa subellipsoidea C-169
ref|XP_001764046.1|  predicted protein                                51.6    4e-05   
ref|WP_010480729.1|  phosphatidate cytidylyltransferase               50.8    7e-05   Acaryochloris sp. CCMEE 5410
ref|WP_012164598.1|  phosphatidate cytidylyltransferase               50.8    7e-05   Acaryochloris marina
ref|XP_010042654.1|  PREDICTED: uncharacterized protein LOC104431...  49.3    2e-04   Eucalyptus grandis [rose gum]
ref|XP_005781745.1|  hypothetical protein EMIHUDRAFT_99736            48.5    5e-04   Emiliania huxleyi CCMP1516
ref|XP_005777419.1|  hypothetical protein EMIHUDRAFT_469241           48.5    6e-04   Emiliania huxleyi CCMP1516



>ref|XP_004246260.1| PREDICTED: probable phytol kinase 3, chloroplastic [Solanum lycopersicum]
Length=293

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  286  VGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFML  465
            V   MFS N ++GDL+A+ LSGGIA S LRFWEE AKRG FD   N KLVH+S+G+VFML
Sbjct  49   VHFAMFSENLLIGDLIATTLSGGIALSILRFWEETAKRGVFDQKTNRKLVHISIGLVFML  108

Query  466  CWPMFS  483
            CWPMFS
Sbjct  109  CWPMFS  114



>gb|ADZ24711.1| phytol kinase [Solanum pennellii]
Length=293

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  286  VGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFML  465
            V   MFS N ++GDL+A+ LSGGIA S LRFWEE AKRG FD   N KLVH+S+G+VFML
Sbjct  49   VHFAMFSENLLIGDLIATALSGGIALSILRFWEETAKRGVFDQKTNRKLVHISIGLVFML  108

Query  466  CWPMFS  483
            CWPMFS
Sbjct  109  CWPMFS  114



>ref|XP_006354090.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Solanum 
tuberosum]
Length=293

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  286  VGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFML  465
            V   MFS NP++GDL+A+  SGGIA S LR WEE AKRG FD   N KLVH+S+G+VFML
Sbjct  49   VHFAMFSENPLIGDLIATAFSGGIALSMLRLWEETAKRGVFDQKTNRKLVHISIGLVFML  108

Query  466  CWPMFS  483
            CWPMFS
Sbjct  109  CWPMFS  114



>ref|XP_009790459.1| PREDICTED: probable phytol kinase 3, chloroplastic [Nicotiana 
sylvestris]
Length=298

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  268  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSM  447
            ++ S+     MF  NPV+GDL+A+ LSGGIA S LR WEE AKRG FD   N KLVH+S+
Sbjct  48   RLHSEVRPKAMFLENPVMGDLIATALSGGIALSMLRLWEETAKRGVFDQKTNRKLVHISI  107

Query  448  GMVFMLCWPMFS  483
            G+VFMLCWPMFS
Sbjct  108  GLVFMLCWPMFS  119



>emb|CDP09225.1| unnamed protein product [Coffea canephora]
Length=241

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MFS NPVVGD+VA+ L+GGIA S LRFW EIAK G  D  LN KLVHVS+G+VFMLCWPM
Sbjct  1    MFSENPVVGDVVAAALTGGIALSMLRFWGEIAKMGVLDQKLNRKLVHVSIGLVFMLCWPM  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_009591334.1| PREDICTED: probable phytol kinase 3, chloroplastic [Nicotiana 
tomentosiformis]
Length=294

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +1

Query  268  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSM  447
            ++ S+     MF  NPV GDL+A+ LSGGIA S LR WEE AKRG FD   N KLVH+S+
Sbjct  44   RLHSEVRPKAMFLENPVTGDLIATALSGGIALSMLRLWEETAKRGVFDQKTNRKLVHISI  103

Query  448  GMVFMLCWPMFS  483
            G+VFMLCWPMFS
Sbjct  104  GLVFMLCWPMFS  115



>gb|EYU45412.1| hypothetical protein MIMGU_mgv1a010789mg [Erythranthe guttata]
Length=301

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MFS N  VGDLVA+ LSGGIA S L+ WEE AKRG FD  LN K+VHV++G+ FMLCWPM
Sbjct  61   MFSNNTAVGDLVATGLSGGIALSLLKIWEETAKRGVFDQKLNRKIVHVTVGLAFMLCWPM  120

Query  478  FS  483
            FS
Sbjct  121  FS  122



>ref|XP_011098894.1| PREDICTED: probable phytol kinase 3, chloroplastic [Sesamum indicum]
Length=292

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MFSG  VV D +A+ LSGGIA S L+ WE+ AKRG FD  LN KLVHV++G+ FMLCWPM
Sbjct  52   MFSGTTVVSDAIATGLSGGIALSLLKIWEQTAKRGVFDQKLNRKLVHVTVGLAFMLCWPM  111

Query  478  FS  483
            FS
Sbjct  112  FS  113



>ref|XP_002516647.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
 gb|EEF45742.1| Phytol kinase 1, chloroplast precursor, putative [Ricinus communis]
Length=304

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 66/122 (54%), Gaps = 15/122 (12%)
 Frame = +1

Query  118  YAVIPTPFSLVNPKSDFLTYFSPPLLASSVCHCHASStlrnttitrrirrKVRSQAVGLT  297
            Y   P P  L +P+++ +  ++   L  +    H+               +    AV  T
Sbjct  19   YNYSPLPLPLHSPQTNLVLPYTSTRLDKAQRSNHS---------------RYLRSAVRAT  63

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NP+V DL A+ LSG IA S LR W+E A RG FD  LN KLVH+S+G+VFMLCWP+
Sbjct  64   MLHQNPIVSDLCATGLSGAIALSVLRLWKETAIRGIFDQKLNRKLVHISIGLVFMLCWPL  123

Query  478  FS  483
            FS
Sbjct  124  FS  125



>gb|KCW54679.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=118

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPVV D++A+ +SGG A + LR +EE AKRG FD  LN KLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>gb|KJB83903.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=212

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            +F  NPV  D  A+V+SG IA S LR W+E AKRG FD  LN KLVH+S+G+VFMLCWP+
Sbjct  66   LFPQNPVFSDTCAAVISGSIALSVLRLWQETAKRGLFDQKLNRKLVHISIGLVFMLCWPL  125

Query  478  FS  483
            +S
Sbjct  126  YS  127



>gb|KCW54678.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=185

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPVV D++A+ +SGG A + LR +EE AKRG FD  LN KLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>gb|KCW54680.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
 gb|KCW54681.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=141

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPVV D++A+ +SGG A + LR +EE AKRG FD  LN KLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>gb|KJB83901.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=248

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            +F  NPV  D  A+V+SG IA S LR W+E AKRG FD  LN KLVH+S+G+VFMLCWP+
Sbjct  66   LFPQNPVFSDTCAAVISGSIALSVLRLWQETAKRGLFDQKLNRKLVHISIGLVFMLCWPL  125

Query  478  FS  483
            +S
Sbjct  126  YS  127



>ref|XP_010028018.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
Length=148

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPVV D++A+ +SGG+A + LR +EE AKRG FD  LN KLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGVALTVLRSFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>gb|KJB83902.1| hypothetical protein B456_013G270100 [Gossypium raimondii]
Length=306

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            +F  NPV  D  A+V+SG IA S LR W+E AKRG FD  LN KLVH+S+G+VFMLCWP+
Sbjct  66   LFPQNPVFSDTCAAVISGSIALSVLRLWQETAKRGLFDQKLNRKLVHISIGLVFMLCWPL  125

Query  478  FS  483
            +S
Sbjct  126  YS  127



>gb|KHG05203.1| putative phytol kinase 3, chloroplastic [Gossypium arboreum]
Length=306

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            +F  NPV  D  A+++SG IA S LR W+E AKRG FD  LN KLVH+S+G+VFMLCWP+
Sbjct  66   LFPQNPVFSDTCAAIISGSIALSVLRLWQETAKRGLFDQKLNRKLVHISIGLVFMLCWPL  125

Query  478  FS  483
            +S
Sbjct  126  YS  127



>ref|XP_006280848.1| hypothetical protein CARUB_v10026834mg [Capsella rubella]
 gb|EOA13746.1| hypothetical protein CARUB_v10026834mg [Capsella rubella]
Length=307

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +1

Query  274  RSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGM  453
            RS ++   MF GN V+ DL A  ++G +AFSCL FW EI KRG FD  L  KLVH+++G+
Sbjct  59   RSSSLAAVMFPGNSVLSDLSACGITGIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINIGL  118

Query  454  VFMLCWPMFS  483
            VFMLCWP+FS
Sbjct  119  VFMLCWPLFS  128



>gb|KCW54682.1| hypothetical protein EUGRSUZ_I00621 [Eucalyptus grandis]
Length=191

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPVV D++A+ +SGG+A + LR +EE AKRG FD  LN KLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGVALTVLRSFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>gb|KDP45737.1| hypothetical protein JCGZ_17344 [Jatropha curcas]
Length=297

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  289  GLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLC  468
             ++M   NPVV DL A+ L+G IA S LR W+E AKR  FD  LN KLVH+S+G+VFMLC
Sbjct  54   AVSMLHQNPVVSDLCATGLAGAIALSLLRVWQETAKRRLFDQKLNRKLVHISIGLVFMLC  113

Query  469  WPMFS  483
            WP+FS
Sbjct  114  WPLFS  118



>gb|KCW54677.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=227

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPVV D++A+ +SGG A + LR +EE AKRG FD  LN KLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_010069238.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57520.1| hypothetical protein EUGRSUZ_H00292 [Eucalyptus grandis]
Length=241

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPV+ D +A+ ++GGIA S LR +EE AKRG FD  LN KLVHVS+G++FMLCWP+
Sbjct  1    MLHENPVLSDALAAAVTGGIALSSLRLFEETAKRGLFDQKLNRKLVHVSIGIIFMLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_010028019.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW54676.1| hypothetical protein EUGRSUZ_I00620 [Eucalyptus grandis]
Length=241

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPVV D++A+ +SGG A + LR +EE AKRG FD  LN KLVHVS G+VFMLCWP+
Sbjct  1    MLHQNPVVSDVLATAVSGGTALTVLRLFEETAKRGVFDQKLNRKLVHVSFGLVFMLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_010520194.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=309

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = +1

Query  100  KCRMAAYAVIPTPFSLVNPKSDFLTYFSPPLLASSVCHCHASStlrnttitrrirrKVRS  279
            K  + + +++P+PF  V+  S  L  F  P++ S   H     T R        R   RS
Sbjct  4    KLSVYSLSLLPSPF--VDSSSLSLPRFPSPIVPSLPLHFATRCTFRARFPLTTSRISRRS  61

Query  280  QAVGL-TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMV  456
                L  MF  NPV+ D+ AS ++  IAF+CLRFW E  KRG FD  L  KLVHVS+G V
Sbjct  62   LTPSLAVMFPDNPVLSDVCASGITTVIAFACLRFWGEFGKRGIFDQKLVRKLVHVSVGPV  121

Query  457  FMLCWPMFS  483
            FMLCWP+FS
Sbjct  122  FMLCWPLFS  130



>ref|XP_004294311.1| PREDICTED: probable phytol kinase 2, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=316

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 78/135 (58%), Gaps = 9/135 (7%)
 Frame = +1

Query  103  CRMAAYAVIPTPFSLVNPK---SDFLTYFSPPLL-----ASSVCHCHASStlrnttitrr  258
            CR    A +PTP SL+ P+   S  LTYF+  LL      +S+     ++TLR      R
Sbjct  4    CRALYPARLPTPCSLL-PQFGHSPPLTYFTSTLLCLRLTPASIPDSLPAATLRYPITDLR  62

Query  259  irrKVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVH  438
            + R+ R  +    M   N V  D+ A+ +SGG+A   L  WE+ AKRG FD  LN KLVH
Sbjct  63   VPRRRRVTSAPAAMLPENAVAADICATAISGGVATFFLLLWEQTAKRGVFDQKLNRKLVH  122

Query  439  VSMGMVFMLCWPMFS  483
            +S+G+VFMLCWP+FS
Sbjct  123  ISIGLVFMLCWPLFS  137



>ref|XP_009369583.1| PREDICTED: probable phytol kinase 2, chloroplastic [Pyrus x bretschneideri]
Length=326

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            TM   NPVV D  A+ ++GG+A   L  W+E AKRG FD  LN KLVHVS+G+VFMLCWP
Sbjct  85   TMLPENPVVADTCAAFIAGGVALFFLLLWQETAKRGIFDQKLNRKLVHVSIGLVFMLCWP  144

Query  475  MFS  483
            +FS
Sbjct  145  LFS  147



>ref|XP_004500293.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Cicer 
arietinum]
Length=303

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            TMF  +P V D++A+ +SG +AFS LR W+E AKR  FD  LN KLVH+++G++F+LCWP
Sbjct  62   TMFHHDPFVSDILATAVSGVVAFSALRLWQETAKRRLFDQKLNRKLVHITIGLLFILCWP  121

Query  475  MFS  483
            +FS
Sbjct  122  LFS  124



>ref|XP_007205802.1| hypothetical protein PRUPE_ppa010668mg [Prunus persica]
 gb|EMJ07001.1| hypothetical protein PRUPE_ppa010668mg [Prunus persica]
Length=241

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPVV D+ A+ ++GG+A   L  WEE AKRG+FD  LN K VHVS+G+VFMLCWP+
Sbjct  1    MLPQNPVVADICATFIAGGVALFFLLLWEETAKRGFFDQKLNRKFVHVSIGLVFMLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_010443595.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=303

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  277  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMV  456
            S A    MF  N V+ DL A  ++G +AFSCL FW EI KRG+FD  L  KLVH+++G+V
Sbjct  56   SLAAAAVMFPENSVLSDLSACGITGIVAFSCLTFWGEIGKRGFFDQKLIRKLVHINIGLV  115

Query  457  FMLCWPMFS  483
            FMLCWP+FS
Sbjct  116  FMLCWPLFS  124



>ref|XP_010453909.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=307

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  277  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMV  456
            S A    MF  N V+ DL A  ++G IAFSCL FW EI KRG+FD  L  KLVH+++G+V
Sbjct  60   SFAAAAVMFPENSVLSDLSACGITGIIAFSCLTFWGEIGKRGFFDQKLIRKLVHINIGLV  119

Query  457  FMLCWPMFS  483
            FMLCWP+FS
Sbjct  120  FMLCWPLFS  128



>ref|XP_002313238.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
 gb|EEE87193.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
Length=313

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  277  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMV  456
            ++   + M   NPVV DL+A+ LSG IA S LRF+ E  KR  FD  LN KLVH+S+G+V
Sbjct  66   TKIAAVAMLHQNPVVSDLIATGLSGTIALSILRFFAETTKRHVFDQKLNRKLVHISIGLV  125

Query  457  FMLCWPMFS  483
            FMLCWP+FS
Sbjct  126  FMLCWPIFS  134



>ref|XP_002299996.2| hypothetical protein POPTR_0001s28680g [Populus trichocarpa]
 gb|EEE84801.2| hypothetical protein POPTR_0001s28680g [Populus trichocarpa]
Length=241

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPVV DL+A+ LSG IA S LR +EE AKR  FD  LN KL+H+S+G+VFMLCWPM
Sbjct  1    MLHQNPVVSDLIATGLSGTIALSFLRSFEETAKRHIFDQKLNRKLMHISIGLVFMLCWPM  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>gb|KEH34361.1| phytol kinase [Medicago truncatula]
Length=301

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  295  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            TMF  +P V D VA+ +SG +AFSCL  ++E AKRG FD  LN KLVH+++G+VFMLCWP
Sbjct  60   TMFHHDPFVSDFVATGISGVVAFSCLGLFKETAKRGLFDQKLNRKLVHITIGLVFMLCWP  119

Query  475  MF  480
            +F
Sbjct  120  LF  121



>ref|XP_011025082.1| PREDICTED: probable phytol kinase 3, chloroplastic [Populus euphratica]
Length=294

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  LTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCW  471
            + M   NPVV DL+A+ LSG IA S LR +EE AKR  FD  LN KL+H+S+G+VFMLCW
Sbjct  52   VAMLHQNPVVSDLIATGLSGIIALSFLRSFEETAKRRIFDQKLNRKLLHISIGLVFMLCW  111

Query  472  PMFS  483
            PMFS
Sbjct  112  PMFS  115



>ref|XP_008349551.1| PREDICTED: probable phytol kinase 2, chloroplastic [Malus domestica]
Length=190

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +1

Query  268  KVRSQAVGLT-----MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKL  432
            K RS+   LT     M   NPVV D  A+ ++GG+A   L  W+E AKRG FD  LN K 
Sbjct  70   KPRSRRRQLTSTPAIMLPENPVVADTCAAFIAGGVALFFLLLWQETAKRGIFDQKLNRKF  129

Query  433  VHVSMGMVFMLCWPMFS  483
            VHVS+G+VFMLCWP+FS
Sbjct  130  VHVSIGLVFMLCWPLFS  146



>ref|XP_007146804.1| hypothetical protein PHAVU_006G071000g [Phaseolus vulgaris]
 gb|ESW18798.1| hypothetical protein PHAVU_006G071000g [Phaseolus vulgaris]
Length=311

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            TM   +P+V D+ A+ +S  +A S LR W+E AKRG FD  LN KLVH+S+G++FMLCWP
Sbjct  70   TMLHHDPLVSDIYATAISATVALSLLRLWQETAKRGIFDQKLNRKLVHLSIGLMFMLCWP  129

Query  475  MFS  483
            +FS
Sbjct  130  LFS  132



>ref|XP_004500292.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Cicer 
arietinum]
Length=303

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            TMF  +P V D++A+ +SG +AFS LR W+E AKR  FD  LN KLVH+++G++F+ CWP
Sbjct  62   TMFHHDPFVSDILATAVSGVVAFSALRLWQETAKRRLFDQKLNRKLVHITIGLLFIFCWP  121

Query  475  MFS  483
            +FS
Sbjct  122  LFS  124



>ref|XP_008457339.1| PREDICTED: probable phytol kinase 2, chloroplastic [Cucumis melo]
Length=322

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 63/112 (56%), Gaps = 8/112 (7%)
 Frame = +1

Query  169  LTYFSPPLLASSVCHCHASStlrnttitrrirrKVRSQ-------AVGLTMFSGNPVVGD  327
            L++ SPP L S   H H S        +R    + RS+          + +F  NPVV D
Sbjct  33   LSFPSPPQLFSLHSHPHFSFLSTPIFPSRTFSLRFRSKIRRKHCSVAAVMLFPENPVVSD  92

Query  328  LVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            + A+ LS G+A S L+ W E AKRG  D  LN KLVH+S+G+ FMLCWPMFS
Sbjct  93   ICATALSSGVALSLLQLWVETAKRG-LDQKLNRKLVHISIGLAFMLCWPMFS  143



>ref|XP_006401067.1| hypothetical protein EUTSA_v10014180mg [Eutrema salsugineum]
 gb|ESQ42520.1| hypothetical protein EUTSA_v10014180mg [Eutrema salsugineum]
Length=308

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M  GN V+ DL A+ +S  +AFSCL FW EI KRG FD  L  KLVH+++G+VFMLCWP+
Sbjct  67   MLPGNSVLSDLCATGISSVVAFSCLSFWGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPL  126

Query  478  FS  483
            FS
Sbjct  127  FS  128



>ref|XP_007016938.1| Phosphatidate cytidylyltransferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY34557.1| Phosphatidate cytidylyltransferase family protein isoform 2 [Theobroma 
cacao]
Length=250

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            +F  NPV+ D+ A+V+SG +A S LR W+E AKR   D  LN KLVH+S+G+VFMLCWP+
Sbjct  67   IFPQNPVLSDVCATVISGFVALSVLRVWQETAKRRLCDQKLNRKLVHISIGLVFMLCWPL  126

Query  478  FS  483
            FS
Sbjct  127  FS  128



>ref|NP_200664.1| farnesol kinase [Arabidopsis thaliana]
 sp|Q67ZM7.2|PHYK2_ARATH RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAD43980.1| unknown protein [Arabidopsis thaliana]
 gb|AED97069.1| farnesol kinase [Arabidopsis thaliana]
Length=307

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  268  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSM  447
            K+R  ++   MF  N V+ D+ A  ++  +AFSCL FW EI KRG FD  L  KLVH+++
Sbjct  57   KIRKSSLAAVMFPENSVLSDVCAFGVTSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINI  116

Query  448  GMVFMLCWPMFS  483
            G+VFMLCWP+FS
Sbjct  117  GLVFMLCWPLFS  128



>dbj|BAD43853.1| unknown protein [Arabidopsis thaliana]
Length=307

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  268  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSM  447
            K+R  ++   MF  N V+ D+ A  ++  +AFSCL FW EI KRG FD  L  KLVH+++
Sbjct  57   KIRKSSLAAVMFPENSVLSDVCAFGVTSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINI  116

Query  448  GMVFMLCWPMFS  483
            G+VFMLCWP+FS
Sbjct  117  GLVFMLCWPLFS  128



>gb|AAM65097.1| unknown [Arabidopsis thaliana]
Length=307

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  268  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSM  447
            K+R  ++   MF  N V+ D+ A  ++  +AFSCL FW EI KRG FD  L  KLVH+++
Sbjct  57   KIRKSSLAAVMFPENSVLSDVCAFGVTSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINI  116

Query  448  GMVFMLCWPMFS  483
            G+VFMLCWP+FS
Sbjct  117  GLVFMLCWPLFS  128



>ref|XP_007016939.1| Phosphatidate cytidylyltransferase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY34558.1| Phosphatidate cytidylyltransferase family protein isoform 3 [Theobroma 
cacao]
Length=307

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            +F  NPV+ D+ A+V+SG +A S LR W+E AKR   D  LN KLVH+S+G+VFMLCWP+
Sbjct  67   IFPQNPVLSDVCATVISGFVALSVLRVWQETAKRRLCDQKLNRKLVHISIGLVFMLCWPL  126

Query  478  FS  483
            FS
Sbjct  127  FS  128



>ref|XP_008384758.1| PREDICTED: probable phytol kinase 2, chloroplastic [Malus domestica]
Length=325

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +1

Query  268  KVRSQAVGLT-----MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKL  432
            K RS+   LT     M   NPVV D  A+ ++GG+A   L  W+E AKRG FD  LN K 
Sbjct  70   KPRSRRRQLTSTPAXMLPENPVVADTCAAFIAGGVALFFLLLWQETAKRGIFDQKLNRKF  129

Query  433  VHVSMGMVFMLCWPMFS  483
            VHVS+G+VFMLCWP+FS
Sbjct  130  VHVSIGLVFMLCWPLFS  146



>ref|XP_010483456.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=304

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MF  N V+ DL A  +SG IAFSCL FW EI KR +FD  L  KLVH+++G+VFMLCWP+
Sbjct  64   MFPENSVLSDLSACGISGIIAFSCLTFWGEIGKRRFFDQKLIRKLVHINIGLVFMLCWPL  123

Query  478  FS  483
            FS
Sbjct  124  FS  125



>ref|XP_008221407.1| PREDICTED: probable phytol kinase 3, chloroplastic [Prunus mume]
Length=325

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            NPVV D+ A+ ++GG+A   L  WEE AKRG FD  LN K VHVS+G+VFMLCWP+FS
Sbjct  89   NPVVADICATFIAGGVALFFLLLWEETAKRGVFDQKLNRKCVHVSIGLVFMLCWPLFS  146



>ref|XP_009132038.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brassica 
rapa]
Length=309

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  277  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMV  456
            + ++   MF  N V+ D+ A+ +SG +AFSCL FW EI KRG FD  L  KLVH+++G+V
Sbjct  61   TSSLAAVMFPENSVLSDVCATGISGVVAFSCLGFWGEIGKRGIFDQKLIRKLVHINIGLV  120

Query  457  FMLCWPMFS  483
            F+LCWP+FS
Sbjct  121  FILCWPLFS  129



>ref|XP_010089521.1| putative phytol kinase 3 [Morus notabilis]
 gb|EXB37960.1| putative phytol kinase 3 [Morus notabilis]
Length=454

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MFS N VV D+ A+  +  +A S LR W E AKRG FD  LN KLVH+S+G+VFMLCWP+
Sbjct  85   MFSQNAVVSDIFAAAFTACVALSLLRVWGETAKRGLFDQKLNRKLVHISVGLVFMLCWPL  144

Query  478  FS  483
            FS
Sbjct  145  FS  146



>emb|CDY70799.1| BnaAnng35070D [Brassica napus]
Length=309

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  277  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMV  456
            + ++   MF  N V+ D+ A+ +SG +AFSCL FW EI KRG FD  L  KLVH+++G+V
Sbjct  61   ASSLAAVMFPENSVLSDVCATGISGVVAFSCLGFWGEIGKRGIFDQKLIRKLVHINIGLV  120

Query  457  FMLCWPMFS  483
            F+LCWP+FS
Sbjct  121  FILCWPLFS  129



>dbj|BAA97326.1| unnamed protein product [Arabidopsis thaliana]
Length=517

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +1

Query  268  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSM  447
            K+R  ++   MF  N V+ D+ A  ++  +AFSCL FW EI KRG FD  L  KLVH+++
Sbjct  57   KIRKSSLAAVMFPENSVLSDVCAFGVTSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINI  116

Query  448  GMVFMLCWPMFS  483
            G+VFMLCWP+FS
Sbjct  117  GLVFMLCWPLFS  128



>ref|XP_004145246.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004153718.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172407.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65833.1| hypothetical protein Csa_1G533400 [Cucumis sativus]
Length=322

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  301  FSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMF  480
            F  NPVV D+ A+ LS G+A S L+ W E AKRG  D  LN KLVH+S+G+ FMLCWPMF
Sbjct  84   FPENPVVSDICATALSSGVALSLLQLWAETAKRG-LDQKLNRKLVHISIGLAFMLCWPMF  142

Query  481  S  483
            S
Sbjct  143  S  143



>gb|AFK48670.1| unknown [Lotus japonicus]
Length=315

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            TM   +P VG++ A+ +SG +A S LR WEE A RG FD  LN KLVHVS+G+ F+ CWP
Sbjct  74   TMLHHDPFVGNIYATAISGVVALSFLRLWEETATRGLFDQKLNRKLVHVSIGLAFIFCWP  133

Query  475  MFS  483
            ++S
Sbjct  134  LYS  136



>emb|CDY66208.1| BnaCnng49970D [Brassica napus]
Length=302

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MF  N V+ D+ AS ++  +A SCL FW EI KRG+FD  L  KLVH+++G+VFMLCWP+
Sbjct  61   MFPDNSVLSDVCASGITSVVAVSCLGFWGEIGKRGFFDQKLIRKLVHINIGLVFMLCWPL  120

Query  478  FS  483
            FS
Sbjct  121  FS  122



>gb|ACU24460.1| unknown [Glycine max]
Length=318

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            TM   +P+V D+ A+ +SG +A S LR ++E AKR  FD  LN KLVH+S+G++FMLCWP
Sbjct  77   TMLHHDPLVSDVYATAISGVVALSFLRLFQETAKRDLFDQKLNRKLVHISIGLIFMLCWP  136

Query  475  MFS  483
            +FS
Sbjct  137  LFS  139



>gb|KHN02090.1| Putative phytol kinase 3, chloroplastic [Glycine soja]
Length=322

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            TM   +P+V D+ A+ +SG +A S LR ++E AKR  FD  LN KLVH+S+G++FMLCWP
Sbjct  81   TMLHHDPLVSDVYATAISGVVALSFLRLFQETAKRDLFDQKLNRKLVHISIGLIFMLCWP  140

Query  475  MFS  483
            +FS
Sbjct  141  LFS  143



>gb|ADE76360.1| unknown [Picea sitchensis]
Length=375

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            N +V D++AS L+  +A +CLRFW+E+AKR  FD  LN K VH+S+G++FML WP+FS
Sbjct  139  NQIVHDIIASALTALVALACLRFWDEMAKRDVFDQKLNRKFVHISIGLIFMLFWPVFS  196



>ref|XP_010910062.1| PREDICTED: probable phytol kinase 2, chloroplastic [Elaeis guineensis]
Length=307

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            +P+V D+ AS ++ G+A   LRFWEE+AKRG F+  LN KLVH+S+G+ FML WP+FS
Sbjct  71   SPLVHDVCASAVTAGVALGLLRFWEELAKRGVFEQKLNRKLVHISIGLAFMLFWPLFS  128



>ref|XP_009132278.1| PREDICTED: LOW QUALITY PROTEIN: probable phytol kinase 2, chloroplastic 
[Brassica rapa]
Length=269

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 3/72 (4%)
 Frame = +1

Query  268  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSM  447
            ++  QAV   MF  N V+ D+ A+ +SG +AFS L FW EI KRG FD  L  KLVH+++
Sbjct  21   RLTQQAV---MFPENSVLSDVCATGISGVVAFSXLGFWGEIGKRGIFDQKLIRKLVHINI  77

Query  448  GMVFMLCWPMFS  483
            G+VF LCWP+FS
Sbjct  78   GLVFTLCWPLFS  89



>ref|XP_011003752.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X1 
[Populus euphratica]
Length=310

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +1

Query  280  QAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVF  459
            +   + M   NPVV DL+A+ LS  IA S LRF+ E  KR  FD  LN KLVH+S+G+VF
Sbjct  64   KIAAVAMLHQNPVVSDLIATGLSATIALSILRFFAETTKRHVFDQKLNRKLVHISIGLVF  123

Query  460  MLCWPMFS  483
            ML WP+FS
Sbjct  124  MLWWPIFS  131



>gb|EPS57827.1| hypothetical protein M569_16990, partial [Genlisea aurea]
Length=253

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MFS N +  DLVA+ LSG IA S L+FWE+ AK G  D  LN KLVH+++G  FMLCWPM
Sbjct  22   MFSDNTLTSDLVATGLSGVIALSLLKFWEKTAKMG-VDQKLNRKLVHITVGSTFMLCWPM  80

Query  478  FS  483
            FS
Sbjct  81   FS  82



>gb|KFK27385.1| hypothetical protein AALP_AA8G375800 [Arabis alpina]
Length=308

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   N V+ D+ A+ +S  +AFSCL FW EI KRG FD  L  KLVH+++G+VFMLCWP+
Sbjct  67   MLPENSVLSDVCATGISSIVAFSCLGFWGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPL  126

Query  478  FS  483
            FS
Sbjct  127  FS  128



>ref|XP_010264775.1| PREDICTED: probable phytol kinase 2, chloroplastic, partial [Nelumbo 
nucifera]
Length=271

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            NPV  D   + L+ G+AFS LRFW EIAKRG  +  +N KLVH+S+G+VF+L WP+FS
Sbjct  35   NPVFNDFFIAALAAGVAFSLLRFWGEIAKRGLLEKTMNRKLVHISIGLVFLLFWPLFS  92



>emb|CDY67806.1| BnaA10g29300D [Brassica napus]
Length=303

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MF  N V+ D+ AS ++  +A SCL FW EI KRG FD  L  KLVH+++G+VFMLCWP+
Sbjct  62   MFPDNSVLSDVCASGITSVVAVSCLGFWGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPL  121

Query  478  FS  483
            FS
Sbjct  122  FS  123



>ref|XP_009120370.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brassica 
rapa]
Length=302

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MF  N V+ D+ AS ++  +A SCL FW EI KRG FD  L  KLVH+++G+VFMLCWP+
Sbjct  61   MFPDNSVLSDVCASGITSVVAVSCLGFWGEIGKRGIFDQKLIRKLVHINIGLVFMLCWPL  120

Query  478  FS  483
            FS
Sbjct  121  FS  122



>ref|XP_010520844.1| PREDICTED: probable phytol kinase 2, chloroplastic [Tarenaya 
hassleriana]
Length=268

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MF  N V+ D+ A+  S  +AF+CL FW E+ KRG  D  L  KLVH+++G+VFMLCWP+
Sbjct  28   MFPENLVLSDVCATGFSTAVAFTCLSFWGEVGKRGILDQTLIRKLVHINIGLVFMLCWPL  87

Query  478  FS  483
            FS
Sbjct  88   FS  89



>ref|XP_008811675.1| PREDICTED: probable phytol kinase 2, chloroplastic [Phoenix dactylifera]
Length=299

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            +P+  D+ AS ++ G+A   LRFWEE+AKRG F+  LN KLVH+S+G+ FML WP+FS
Sbjct  63   SPLFRDVCASAVTAGVALGLLRFWEELAKRGVFEQKLNRKLVHISIGLAFMLFWPLFS  120



>ref|NP_001130181.1| uncharacterized protein LOC100191275 [Zea mays]
 ref|XP_008657098.1| PREDICTED: probable phytol kinase 2, chloroplastic [Zea mays]
 gb|ACF78326.1| unknown [Zea mays]
 gb|ACF84542.1| unknown [Zea mays]
Length=312

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  277  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMV  456
            + A  +++ +G  +  DL ++V++GG+A + L+F+EE+AKRG F+  L+ KLVH+S+G+V
Sbjct  65   TMAAAISLEAGGALAHDLGSAVVTGGVALALLKFFEELAKRGVFEQKLSRKLVHISVGLV  124

Query  457  FMLCWPMFS  483
            FML WP+FS
Sbjct  125  FMLFWPLFS  133



>ref|XP_007016937.1| Phosphatidate cytidylyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY34556.1| Phosphatidate cytidylyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=352

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            NPVV DL+A+ +  G+ F+ L  W+E AKRG  D  LN KLVH+S+G+VFMLCWP+FS
Sbjct  117  NPVVSDLLAAAVCCGVIFAFLLLWQETAKRG-LDQKLNRKLVHISIGLVFMLCWPLFS  173



>ref|XP_003564535.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brachypodium 
distachyon]
Length=310

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  DLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            DLV+S ++ G+A + LRF+EE+AKRG F+  LN KLVH+++GMVF+L WP+FS
Sbjct  79   DLVSSAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFS  131



>ref|XP_006292344.1| hypothetical protein CARUB_v10018556mg [Capsella rubella]
 gb|EOA25242.1| hypothetical protein CARUB_v10018556mg [Capsella rubella]
Length=207

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            MF  N VV D  A  + G I FSCL FW EI KRG  D  L  KLVH+++G+VF+LCWP+
Sbjct  1    MFPKNSVVTDSSACGIFGVITFSCLSFWGEIGKRGILDQKLIRKLVHINIGLVFLLCWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|NP_001242263.1| probable phytol kinase 3, chloroplastic [Glycine max]
 sp|Q2N2K0.1|PHYK3_SOYBN RecName: Full=Probable phytol kinase 3, chloroplastic; Flags: 
Precursor [Glycine max]
 gb|ABA42677.1| phytol kinase [Glycine max]
Length=319

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  295  TMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            TM   +P+V D+ A+ +SG +A S LR ++E AKR  FD  LN KLVH+S+G++FMLC P
Sbjct  78   TMLHHDPLVSDVYATAISGVVALSFLRLFQETAKRDLFDQKLNRKLVHISIGLIFMLCXP  137

Query  475  MFS  483
            +FS
Sbjct  138  LFS  140



>ref|XP_010426391.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=240

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRG-YFDXNLNXKLVHVSMGMVFMLCWP  474
            MF  N V+ D+ A  + G I FSCLRFW EI KRG  FD  L  K VH+++G+VF+LCWP
Sbjct  1    MFPKNTVLSDISACGIFGIITFSCLRFWGEIGKRGGIFDQKLIRKFVHINIGLVFLLCWP  60

Query  475  MFS  483
            +FS
Sbjct  61   LFS  63



>ref|XP_010689412.1| PREDICTED: probable phytol kinase 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   N V+ D+ A+++SG +A + L  WE  AK G FD  LN KLVH S+G+VFMLCWP+
Sbjct  68   MLPENAVMSDICATLISGAVAGATLALWEVTAKYGVFDSKLNRKLVHTSIGIVFMLCWPL  127

Query  478  FS  483
            FS
Sbjct  128  FS  129



>ref|XP_010028020.1| PREDICTED: probable phytol kinase 3, chloroplastic [Eucalyptus 
grandis]
Length=244

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   N V+ D +A+ ++GGI       +EE AKRG FD  LN KLVHVS+G+VFMLCWP+
Sbjct  4    MLHQNSVMSDALATAVTGGIILLVCLLFEETAKRGLFDQKLNRKLVHVSVGLVFMLCWPL  63

Query  478  FS  483
            FS
Sbjct  64   FS  65



>ref|XP_006387375.1| hypothetical protein POPTR_1135s00200g [Populus trichocarpa]
 gb|ERP46289.1| hypothetical protein POPTR_1135s00200g [Populus trichocarpa]
Length=174

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +1

Query  298  MFSG-NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            M++G NPVV DL ++V+S  + F+ L+ W+E AK G  D  LN KLVH+S+G+VFMLCWP
Sbjct  1    MWTGSNPVVSDLCSAVVSAVVIFAFLQLWKETAKHG-LDQKLNRKLVHISIGLVFMLCWP  59

Query  475  MFS  483
            +FS
Sbjct  60   IFS  62



>emb|CDY65783.1| BnaA03g56270D [Brassica napus]
Length=321

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 12/81 (15%)
 Frame = +1

Query  277  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDX------------NL  420
            + ++   MF  N V+ D+ A+ +SG +AFSCL FW EI KRG FD              L
Sbjct  61   ASSLAAVMFPENSVLSDVCATGISGVVAFSCLGFWGEIGKRGIFDQYVLSDLGLKQNIKL  120

Query  421  NXKLVHVSMGMVFMLCWPMFS  483
              KLVH+++G+VF+LCWP+FS
Sbjct  121  IRKLVHINIGLVFILCWPLFS  141



>ref|NP_001044703.2| Os01g0832000 [Oryza sativa Japonica Group]
 dbj|BAD81857.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC71742.1| hypothetical protein OsI_04308 [Oryza sativa Indica Group]
 gb|EEE55624.1| hypothetical protein OsJ_03964 [Oryza sativa Japonica Group]
 dbj|BAF06617.2| Os01g0832000 [Oryza sativa Japonica Group]
Length=246

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  DLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            DL ++ ++ G+A + LRF+EE+AKRG F+  LN KLVH+++GMVF+L WP+FS
Sbjct  15   DLGSAAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFS  67



>ref|XP_010503534.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=242

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRG-YFDXNLNXKLVHVSMGMVFMLCWP  474
            MF  N V+ D+ A  + G I FSCL FW EI KRG  FD  L  K VH+++G+VF+LCWP
Sbjct  1    MFPKNTVLSDISACGIFGIITFSCLSFWGEIGKRGGIFDQKLIRKFVHINIGLVFLLCWP  60

Query  475  MFS  483
            +FS
Sbjct  61   LFS  63



>ref|XP_002278563.2| PREDICTED: probable phytol kinase 2, chloroplastic isoform X1 
[Vitis vinifera]
Length=241

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPV GD+ A+ L+GG   S ++FW  IAKRG+    ++ K VH+S+G+VFML WP+
Sbjct  1    MLPQNPVAGDICAAALTGGTVLSLIQFWGGIAKRGFTGQTVSRKFVHISVGLVFMLFWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>gb|AFW64552.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_110888 [Zea 
mays]
Length=147

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++G+P++ D+ A+VL+G  A + LRFWEEIA R   D  L  KLVH+++G+VF L WP+
Sbjct  1    MWTGSPLLRDVGAAVLTGVGAAAVLRFWEEIANRALLDQKLCRKLVHITVGLVFFLMWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_004970454.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Setaria 
italica]
Length=314

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +1

Query  277  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMV  456
            + A  +++ +G+ +  DL ++ ++ G+A + L+F+EE+AKRG F+  L+ KLVH+S+G+V
Sbjct  67   TMAAAISLEAGSGLAHDLGSAAVTAGVALALLKFYEELAKRGVFEEKLSRKLVHISVGLV  126

Query  457  FMLCWPMFS  483
            F+L WP+FS
Sbjct  127  FLLFWPLFS  135



>sp|Q5N9J9.3|PHYK2_ORYSJ RecName: Full=Probable phytol kinase 2, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
Length=304

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  DLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            DL ++ ++ G+A + LRF+EE+AKRG F+  LN KLVH+++GMVF+L WP+FS
Sbjct  73   DLGSAAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGMVFLLFWPLFS  125



>gb|ACG40052.1| phytol kinase 2 [Zea mays]
Length=273

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++G+P++ D+ A+VL+G  A + LRFWEEIA R   D  L  KLVH+++G+VF L WP+
Sbjct  1    MWTGSPLLRDVGAAVLTGVGAAAVLRFWEEIANRALLDQKLCRKLVHITVGLVFFLMWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_008676758.1| PREDICTED: uncharacterized protein LOC100272684 isoform X1 [Zea 
mays]
 gb|AFW64551.1| phytol kinase 2 [Zea mays]
Length=273

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++G+P++ D+ A+VL+G  A + LRFWEEIA R   D  L  KLVH+++G+VF L WP+
Sbjct  1    MWTGSPLLRDVGAAVLTGVGAAAVLRFWEEIANRALLDQKLCRKLVHITVGLVFFLMWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>emb|CBI15916.3| unnamed protein product [Vitis vinifera]
Length=328

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPV GD+ A+ L+GG   S ++FW  IAKRG+    ++ K VH+S+G+VFML WP+
Sbjct  53   MLPQNPVAGDICAAALTGGTVLSLIQFWGGIAKRGFTGQTVSRKFVHISVGLVFMLFWPL  112

Query  478  FS  483
            FS
Sbjct  113  FS  114



>ref|XP_002458716.1| hypothetical protein SORBIDRAFT_03g038850 [Sorghum bicolor]
 gb|EES03836.1| hypothetical protein SORBIDRAFT_03g038850 [Sorghum bicolor]
Length=341

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +1

Query  277  SQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMV  456
            + A  +++ +G  +  DL ++ ++ G+A + L+F+EEIAKRG F+  L+ KLVH+S+G+V
Sbjct  94   TMAAAISLEAGGGLAHDLGSAAVTAGVALALLKFFEEIAKRGVFEQKLSRKLVHISVGLV  153

Query  457  FMLCWPMFS  483
            F+L WP+FS
Sbjct  154  FLLFWPLFS  162



>ref|XP_006644954.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Oryza 
brachyantha]
Length=248

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  DLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            DL ++ ++ G+A + LRF+EE+AKRG F+  LN KLVH+++G+VF+L WP+FS
Sbjct  17   DLGSAAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGLVFLLFWPLFS  69



>gb|KDO66964.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=254

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            NPV+ D+ AS +S  +A SCLR WEE A+R  FD  LN KLVH+S+G++FMLCWP+FS
Sbjct  54   NPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFS  111



>gb|KDO66966.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=244

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            +   NPV+ D+ AS +S  +A SCLR WEE A+R  FD  LN KLVH+S+G++FMLCWP+
Sbjct  50   LLPQNPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPL  109

Query  478  FS  483
            FS
Sbjct  110  FS  111



>emb|CDM84848.1| unnamed protein product [Triticum aestivum]
Length=312

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  316  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            +V DLV+S ++  IA   LRF+EE+AKRG  D  LN KLVH+++GMVF+L WP+FS
Sbjct  78   LVHDLVSSGVTAAIALGLLRFFEELAKRGVCDQKLNRKLVHITIGMVFLLFWPLFS  133



>ref|XP_006425113.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
 gb|ESR38353.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
Length=284

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            NPV+ D+ AS +S  +A S LR WEE A+R  FD  LN KLVH+S+G+VFMLCWP+FS
Sbjct  54   NPVLSDVCASAVSAAVAASSLRLWEETARRDLFDQKLNRKLVHISIGLVFMLCWPLFS  111



>ref|XP_006425114.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
 gb|ESR38354.1| hypothetical protein CICLE_v10028969mg [Citrus clementina]
Length=290

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            NPV+ D+ AS +S  +A S LR WEE A+R  FD  LN KLVH+S+G+VFMLCWP+FS
Sbjct  54   NPVLSDVCASAVSAAVAASSLRLWEETARRDLFDQKLNRKLVHISIGLVFMLCWPLFS  111



>ref|XP_004978591.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Setaria 
italica]
Length=276

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++ NPVV D  A+VL+G  A   LRFWEE+A R   D  L  KLVH+++G+V+ L WP+
Sbjct  1    MWTENPVVRDAGAAVLTGVAAAVVLRFWEEVANRALLDQTLCRKLVHITVGLVYFLMWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_006488562.1| PREDICTED: probable phytol kinase 3, chloroplastic-like [Citrus 
sinensis]
Length=293

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            NPV+ D+ AS +S  +A SCLR WEE A+R  FD  LN KLVH+S+G++FMLCWP+FS
Sbjct  57   NPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFS  114



>gb|KDO66965.1| hypothetical protein CISIN_1g022935mg [Citrus sinensis]
Length=290

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            NPV+ D+ AS +S  +A SCLR WEE A+R  FD  LN KLVH+S+G++FMLCWP+FS
Sbjct  54   NPVLSDVCASAVSAAVAASCLRLWEETARRDLFDQKLNRKLVHISIGLIFMLCWPLFS  111



>ref|XP_011003760.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Populus euphratica]
 ref|XP_011003768.1| PREDICTED: probable phytol kinase 2, chloroplastic isoform X2 
[Populus euphratica]
Length=241

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +1

Query  298  MFSG-NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            M++G NPVV DL ++V+S  + F+ L+ W+E AK G  D  LN KLVH+S+G+VFML WP
Sbjct  1    MWTGSNPVVSDLCSAVVSAVVIFAFLQLWKETAKHG-LDQKLNRKLVHISIGLVFMLWWP  59

Query  475  MFS  483
            +FS
Sbjct  60   IFS  62



>gb|KEH28892.1| phytol kinase [Medicago truncatula]
Length=239

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  316  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            +V DL A+ +S  + FSC R   E +KRG FD  L+ KLVH+S G++FMLCWP+FS
Sbjct  5    LVSDLGAAAISRAVTFSCDRVLRETSKRGLFDQKLHRKLVHISFGLLFMLCWPLFS  60



>ref|XP_002278580.2| PREDICTED: probable phytol kinase 2, chloroplastic [Vitis vinifera]
Length=309

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPV GD+ A+ L+G  A S LRFW EIAKRG+FD  +  KLVH+S+G+VFML WP+
Sbjct  69   MLPQNPVAGDICAAALTGAAALSLLRFWGEIAKRGFFDQTVGRKLVHISVGLVFMLFWPL  128

Query  478  FS  483
            FS
Sbjct  129  FS  130



>emb|CBI15917.3| unnamed protein product [Vitis vinifera]
Length=259

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   NPV GD+ A+ L+G  A S LRFW EIAKRG+FD  +  KLVH+S+G+VFML WP+
Sbjct  1    MLPQNPVAGDICAAALTGAAALSLLRFWGEIAKRGFFDQTVGRKLVHISVGLVFMLFWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_004977648.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X1 [Setaria italica]
Length=285

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++ NPVV D  A+VLSG      LRFWEE+A R   D  L  KLVH+++G+V+ L WP+
Sbjct  1    MWTENPVVRDAGAAVLSGVAVAVVLRFWEEVASRALLDQKLCRKLVHITVGLVYFLMWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_004977649.1| PREDICTED: probable phytol kinase 2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=285

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++ NPVV D  A+VLSG      LRFWEE+A R   D  L  KLVH+++G+V+ L WP+
Sbjct  1    MWTENPVVRDAGAAVLSGVAVAVVLRFWEEVASRALLDQKLCRKLVHITVGLVYFLMWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_010412644.1| PREDICTED: probable phytol kinase 2, chloroplastic [Camelina 
sativa]
Length=265

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKR-GYFDXNLNXKLVHVSMGMVFMLCW-  471
            MF  N V+ D+ A  + G I FSCL FW EI KR G FD  L  KLVH+++G+VF+LCW 
Sbjct  23   MFPKNTVLSDISACGIFGIITFSCLSFWGEIGKRGGIFDQKLIRKLVHINIGLVFLLCWR  82

Query  472  PMFS  483
            P+FS
Sbjct  83   PLFS  86



>ref|XP_002313239.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
 gb|EEE87194.2| hypothetical protein POPTR_0009s07860g [Populus trichocarpa]
Length=237

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 6/63 (10%)
 Frame = +1

Query  298  MFSGN-PVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWP  474
            M++GN PVV DL ++V    + F+ L+ W+E AK G  D  LN KLVH+S+G+VFMLCWP
Sbjct  1    MWTGNNPVVSDLCSAV----VIFAFLQLWKETAKHG-LDQKLNRKLVHISIGLVFMLCWP  55

Query  475  MFS  483
            +FS
Sbjct  56   IFS  58



>ref|XP_006847435.1| hypothetical protein AMTR_s00153p00083300 [Amborella trichopoda]
 gb|ERN09016.1| hypothetical protein AMTR_s00153p00083300 [Amborella trichopoda]
Length=241

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   N VV D+ A+ ++ G A   LRFW+E+AKRG FD  LN KLVH+S+G+VFML WP+
Sbjct  1    MLPENQVVRDVAAAAIAAGAALGLLRFWDEMAKRGVFDQKLNRKLVHISVGLVFMLFWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>gb|EAY81967.1| hypothetical protein OsI_37144 [Oryza sativa Indica Group]
Length=271

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            +PV+ D  A+VL+G  A + LRFWEE+  R   D  L  KLVH+++G+V+ L WP+FS
Sbjct  3    SPVLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFS  60



>gb|KJB20420.1| hypothetical protein B456_003G147500 [Gossypium raimondii]
Length=240

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   N +V DL ASV+  G+ F+ L  W+  AK G  D  LN KLVH+S+G+VFMLCWP+
Sbjct  1    MLYENSLVSDLFASVVCCGVIFAFLLLWQVTAKCG-VDQKLNRKLVHISIGLVFMLCWPL  59

Query  478  FS  483
            FS
Sbjct  60   FS  61



>ref|NP_001065534.2| Os11g0105800 [Oryza sativa Japonica Group]
 gb|ABA91069.1| phosphatidate cytidylyltransferase family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG99032.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68691.1| hypothetical protein OsI_37159 [Oryza sativa Indica Group]
 gb|EEE52600.1| hypothetical protein OsJ_34917 [Oryza sativa Japonica Group]
 dbj|BAF27379.2| Os11g0105800 [Oryza sativa Japonica Group]
Length=274

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            +P++ D  A+VL+G  A + LRFWEE+  R   D  L  KLVH+++G+V+ L WP+FS
Sbjct  6    SPLLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFS  63



>ref|XP_002450098.1| hypothetical protein SORBIDRAFT_05g000470 [Sorghum bicolor]
 gb|EES09086.1| hypothetical protein SORBIDRAFT_05g000470 [Sorghum bicolor]
Length=274

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++ +P++ D  A+VL+G  A   LRFWEE+A R   D  L  KLVH+++G+V+ L WP+
Sbjct  1    MWTDSPLLRDAGAAVLTGVTAGVVLRFWEEVANRALLDQKLCRKLVHITVGLVYFLMWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>gb|KHG27084.1| putative phytol kinase 3, chloroplastic [Gossypium arboreum]
Length=240

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M   N +V DL A+V+  G+ F+ L  W+  AK G  D  LN KLVH+S+G+VFMLCWP+
Sbjct  1    MLYENSLVSDLFAAVVCCGVIFAFLLLWQVTAKCG-VDQKLNRKLVHISIGLVFMLCWPL  59

Query  478  FS  483
            FS
Sbjct  60   FS  61



>ref|XP_003579056.1| PREDICTED: probable phytol kinase 2, chloroplastic [Brachypodium 
distachyon]
Length=276

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++ +P++ D  A+VL+G  A + LR WEE+  R   D  L  KLVH+S G+V+ L WP+
Sbjct  1    MWTESPLLRDAGAAVLTGAAALAVLRVWEEVGNRALLDQKLCRKLVHISAGLVYFLMWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_009420002.1| PREDICTED: probable phytol kinase 2, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=298

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  316  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            VV DL A+ L+   A   LRFWEE+AKRG F+  LN KLVH+S+G+VF+L WP+FS
Sbjct  64   VVHDLGAAALTSATALGLLRFWEELAKRGVFEQKLNRKLVHISIGLVFLLFWPLFS  119



>ref|XP_002864581.1| hypothetical protein ARALYDRAFT_332145 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40840.1| hypothetical protein ARALYDRAFT_332145 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  355  IAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            +AFSCL FW EI KR   D  L  KLVH+++G+VFMLCWP+FS
Sbjct  81   VAFSCLGFWGEIGKRDLLDQKLIRKLVHINIGLVFMLCWPLFS  123



>ref|XP_009774666.1| PREDICTED: probable phytol kinase 3, chloroplastic, partial [Nicotiana 
sylvestris]
Length=96

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  268  KVRSQAVGLTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFD  411
            ++ S+     MF  NPV+GDL+A+ LSGGIA S LR WEE AKRG FD
Sbjct  48   RLHSEVRPKAMFLENPVMGDLIATALSGGIALSMLRLWEETAKRGVFD  95



>gb|ABA95607.1| phosphatidate cytidylyltransferase family protein, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19373.1| hypothetical protein OsJ_34926 [Oryza sativa Japonica Group]
Length=271

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            + V+ D  A+VL+G  A + LRFWEE+  R   D  L  KLVH+++G+V+ L WP+FS
Sbjct  3    SQVLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFS  60



>gb|KEH28894.1| phytol kinase [Medicago truncatula]
Length=239

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  316  VVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            +V D  A  +S  +A SC R  +E AKRG  D  L  KLVH S G+ FMLCWP+FS
Sbjct  5    LVSDFGAIAISRAVALSCERVLQETAKRGLIDHKLQRKLVHTSFGLAFMLCWPLFS  60



>ref|NP_001065932.1| Os12g0105500 [Oryza sativa Japonica Group]
 dbj|BAF28951.1| Os12g0105500, partial [Oryza sativa Japonica Group]
Length=280

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  310  NPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            + V+ D  A+VL+G  A + LRFWEE+  R   D  L  KLVH+++G+V+ L WP+FS
Sbjct  12   SQVLRDAGAAVLTGATALAVLRFWEEVGNRALLDQKLCRKLVHITVGLVYFLMWPLFS  69



>ref|XP_002442649.1| hypothetical protein SORBIDRAFT_08g000500 [Sorghum bicolor]
 gb|EES16487.1| hypothetical protein SORBIDRAFT_08g000500 [Sorghum bicolor]
Length=274

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++ +P++ D  A+VL+G  A   LR WEE+A R   D  L  KLVH+++G+V+ L WP+
Sbjct  1    MWTDSPLLRDAGAAVLTGVAAAVVLRIWEEVANRALLDQKLCRKLVHITVGLVYFLMWPL  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_006662647.1| PREDICTED: probable phytol kinase 2, chloroplastic-like [Oryza 
brachyantha]
Length=273

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPM  477
            M++ +P++ D  A+VL+G  +F+ L FWE +A R   D  L  KLVH+++G+V+ L WP 
Sbjct  1    MWTESPLLRDAGAAVLTGAASFAVLSFWELVANRALLDQKLCRKLVHITVGLVYFLMWPF  60

Query  478  FS  483
            FS
Sbjct  61   FS  62



>ref|XP_002966017.1| hypothetical protein SELMODRAFT_230719 [Selaginella moellendorffii]
 ref|XP_002971473.1| hypothetical protein SELMODRAFT_95672 [Selaginella moellendorffii]
 gb|EFJ27222.1| hypothetical protein SELMODRAFT_95672 [Selaginella moellendorffii]
 gb|EFJ33437.1| hypothetical protein SELMODRAFT_230719 [Selaginella moellendorffii]
Length=247

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  DLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            DL+ S ++   A   LRF++E+AKR  FD  L+ KLVH+ +G++FML WP+FS
Sbjct  16   DLLMSAVTLSGALGSLRFFDELAKRDVFDKKLSRKLVHICVGLIFMLFWPLFS  68



>ref|XP_001780576.1| predicted protein [Physcomitrella patens]
 gb|EDQ54670.1| predicted protein, partial [Physcomitrella patens]
Length=240

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  DLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            D VA+V++   A   L+F++E+AKR   +  L+ KL H+  GMVFML WP+FS
Sbjct  3    DFVAAVITLAGALGVLQFFDELAKRDLLEKKLSRKLCHILSGMVFMLLWPLFS  55



>ref|XP_010042655.1| PREDICTED: probable phytol kinase 3, chloroplastic isoform X2 
[Eucalyptus grandis]
Length=135

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVS  444
            M   NPV+ D +A+ ++GGIA S LR +EE AKRG FD +   +L  VS
Sbjct  86   MLHENPVLSDALAAAVTGGIALSSLRLFEETAKRGLFDQSGVLQLKFVS  134



>ref|XP_005643081.1| hypothetical protein COCSUDRAFT_49246 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18537.1| hypothetical protein COCSUDRAFT_49246 [Coccomyxa subellipsoidea 
C-169]
Length=281

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +1

Query  292  LTMFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCW  471
            L +   NP++ D+ A+V++   A + ++ +  ++ RG  D  L+ KLVH+  G  F LCW
Sbjct  31   LLVLQQNPLLQDVCATVVAAAGAIALVKIFRALSSRGIVDQKLSRKLVHILAGPGFALCW  90

Query  472  PMFS  483
            P+FS
Sbjct  91   PLFS  94



>ref|XP_001764046.1| predicted protein [Physcomitrella patens]
 gb|EDQ71185.1| predicted protein [Physcomitrella patens]
Length=250

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  DLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            D V +V +   A   L+F++E+AKR + +  L+ KL H+  G+VFML WP+FS
Sbjct  19   DYVVAVFTLTGALGILQFFDELAKRDFLEKTLSRKLCHILSGLVFMLFWPLFS  71



>ref|WP_010480729.1| phosphatidate cytidylyltransferase [Acaryochloris sp. CCMEE 5410]
Length=244

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  301  FSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMF  480
             + NP++ D V  V++  +A S LR  + +A  G  +  L+ K++H+  G +F+LCWP F
Sbjct  6    LTANPLIQDSVVMVITLMLALSWLRIMDALAANGMLEQKLSRKIIHMGTGPLFVLCWPFF  65

Query  481  S  483
            S
Sbjct  66   S  66



>ref|WP_012164598.1| phosphatidate cytidylyltransferase [Acaryochloris marina]
 gb|ABW29270.1| phosphatidate cytidylyltransferase [Acaryochloris marina MBIC11017]
Length=244

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  301  FSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMF  480
             + NP++ D V  V++  +A S LR  + +A  G  +  L+ K++H+  G +F+LCWP F
Sbjct  6    LTANPLIQDSVVMVITLMLALSWLRIMDALAANGILEQKLSRKIIHMGTGPLFVLCWPFF  65

Query  481  S  483
            S
Sbjct  66   S  66



>ref|XP_010042654.1| PREDICTED: uncharacterized protein LOC104431798 isoform X1 [Eucalyptus 
grandis]
Length=244

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  298  MFSGNPVVGDLVASVLSGGIAFSCLRFWEEIAKRGYFD  411
            M   NPV+ D +A+ ++GGIA S LR +EE AKRG FD
Sbjct  86   MLHENPVLSDALAAAVTGGIALSSLRLFEETAKRGLFD  123



>ref|XP_005781745.1| hypothetical protein EMIHUDRAFT_99736 [Emiliania huxleyi CCMP1516]
 gb|EOD29316.1| hypothetical protein EMIHUDRAFT_99736 [Emiliania huxleyi CCMP1516]
Length=311

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  DLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            D  ++ +  G A+  + FW ++A  G    NL+ K++H     +FMLCWP+FS
Sbjct  70   DAASASVCAGAAWMWVAFWSKLAADGRIQPNLSRKIIHTGSAPLFMLCWPLFS  122



>ref|XP_005777419.1| hypothetical protein EMIHUDRAFT_469241 [Emiliania huxleyi CCMP1516]
 gb|EOD24990.1| hypothetical protein EMIHUDRAFT_469241 [Emiliania huxleyi CCMP1516]
Length=341

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  DLVASVLSGGIAFSCLRFWEEIAKRGYFDXNLNXKLVHVSMGMVFMLCWPMFS  483
            D  ++ +  G A+  + FW ++A  G    NL+ K++H     +FMLCWP+FS
Sbjct  66   DAASASVCAGAAWMWVAFWSKLAADGRIQPNLSRKIIHTGSAPLFMLCWPLFS  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550