BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004N13

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P55004.1|PHYE_IPONI  RecName: Full=Phytochrome E                     292   5e-89   Ipomoea nil [qian niu]
emb|CDG41612.1|  Phytochrome E                                          202   3e-57   Rhazya stricta
ref|XP_007025188.1|  Phytochrome E isoform 2                            187   4e-52   
ref|XP_007025187.1|  Phytochrome E isoform 1                            186   3e-51   
ref|XP_011085288.1|  PREDICTED: phytochrome E                           180   6e-49   Sesamum indicum [beniseed]
ref|XP_006355589.1|  PREDICTED: phytochrome E-like isoform X1           180   8e-49   Solanum tuberosum [potatoes]
ref|XP_006355590.1|  PREDICTED: phytochrome E-like isoform X2           180   8e-49   Solanum tuberosum [potatoes]
ref|XP_006586694.1|  PREDICTED: phytochrome E-like isoform X1           177   9e-49   
ref|NP_001273774.1|  phytochrome E-like                                 177   5e-48   Glycine max [soybeans]
ref|XP_009631925.1|  PREDICTED: phytochrome E isoform X2                177   6e-48   Nicotiana tomentosiformis
ref|XP_007214556.1|  hypothetical protein PRUPE_ppa000491mg             177   6e-48   
ref|XP_009631916.1|  PREDICTED: phytochrome E isoform X1                177   6e-48   Nicotiana tomentosiformis
ref|XP_009631929.1|  PREDICTED: phytochrome E isoform X3                177   6e-48   Nicotiana tomentosiformis
dbj|BAJ15834.1|  putative phytochrome E                                 168   7e-48   Pieris nana
ref|XP_007214557.1|  hypothetical protein PRUPE_ppa000491mg             177   7e-48   
ref|XP_004232975.1|  PREDICTED: phytochrome E isoform X2                177   8e-48   
gb|AAF25812.1|AF178571_1  phytochrome E                                 177   8e-48   Solanum lycopersicum
ref|XP_010316899.1|  PREDICTED: phytochrome E isoform X1                177   8e-48   Solanum lycopersicum
ref|XP_007138489.1|  hypothetical protein PHAVU_009G213400g             175   9e-48   Phaseolus vulgaris [French bean]
gb|KJB69756.1|  hypothetical protein B456_011G040900                    175   4e-47   Gossypium raimondii
ref|XP_007138490.1|  hypothetical protein PHAVU_009G213400g             175   4e-47   Phaseolus vulgaris [French bean]
ref|XP_008225375.1|  PREDICTED: phytochrome E isoform X2                174   7e-47   Prunus mume [ume]
ref|XP_008225374.1|  PREDICTED: phytochrome E isoform X1                174   8e-47   Prunus mume [ume]
gb|KDP21198.1|  hypothetical protein JCGZ_21669                         174   1e-46   Jatropha curcas
gb|KHG11315.1|  Phytochrome E                                           173   1e-46   Gossypium arboreum [tree cotton]
ref|XP_010052114.1|  PREDICTED: phytochrome E isoform X2                173   2e-46   Eucalyptus grandis [rose gum]
ref|XP_010052113.1|  PREDICTED: phytochrome E isoform X1                173   2e-46   Eucalyptus grandis [rose gum]
gb|ACC60972.1|  phytochrome E                                           172   2e-46   Vitis riparia [frost grape]
ref|XP_006467545.1|  PREDICTED: phytochrome E-like isoform X5           172   3e-46   Citrus sinensis [apfelsine]
ref|XP_006449616.1|  hypothetical protein CICLE_v10014092mg             172   3e-46   
gb|KDO78036.1|  hypothetical protein CISIN_1g001210mg                   172   4e-46   Citrus sinensis [apfelsine]
gb|KDO78035.1|  hypothetical protein CISIN_1g001210mg                   171   4e-46   Citrus sinensis [apfelsine]
ref|XP_006467544.1|  PREDICTED: phytochrome E-like isoform X4           171   4e-46   Citrus sinensis [apfelsine]
ref|XP_006467543.1|  PREDICTED: phytochrome E-like isoform X3           172   4e-46   Citrus sinensis [apfelsine]
gb|KDO78033.1|  hypothetical protein CISIN_1g001210mg                   172   5e-46   Citrus sinensis [apfelsine]
ref|XP_006467542.1|  PREDICTED: phytochrome E-like isoform X2           172   5e-46   Citrus sinensis [apfelsine]
ref|XP_002271671.1|  PREDICTED: phytochrome E                           172   5e-46   Vitis vinifera
gb|KDO78034.1|  hypothetical protein CISIN_1g001210mg                   172   6e-46   Citrus sinensis [apfelsine]
ref|XP_006467541.1|  PREDICTED: phytochrome E-like isoform X1           172   6e-46   Citrus sinensis [apfelsine]
ref|XP_009766581.1|  PREDICTED: phytochrome E isoform X1                171   6e-46   Nicotiana sylvestris
ref|XP_009766582.1|  PREDICTED: phytochrome E isoform X2                171   6e-46   Nicotiana sylvestris
dbj|BAI63255.1|  phytochrome E                                          169   6e-46   Pieris nana
ref|XP_002519749.1|  phytochrome B, putative                            171   7e-46   Ricinus communis
dbj|BAJ15835.1|  putative phytochrome E                                 162   1e-45   Pieris japonica [Japanese andromeda]
dbj|BAJ15831.1|  putative phytochrome E                                 162   1e-45   Pieris nana
dbj|BAJ15820.1|  putative phytochrome E                                 162   1e-45   Pieris nana
dbj|BAJ15809.1|  putative phytochrome E                                 162   1e-45   Pieris nana
dbj|BAJ15811.1|  putative phytochrome E                                 162   1e-45   Pieris nana
dbj|BAJ15836.1|  putative phytochrome E                                 162   2e-45   Pieris nana
ref|XP_003546574.1|  PREDICTED: phytochrome E-like                      170   2e-45   
emb|CAN62723.1|  hypothetical protein VITISV_030984                     170   2e-45   Vitis vinifera
ref|NP_001276186.1|  phytochrome E-like                                 170   2e-45   Glycine max [soybeans]
gb|EYU43280.1|  hypothetical protein MIMGU_mgv1a000521mg                170   2e-45   Erythranthe guttata [common monkey flower]
gb|KHN41345.1|  Phytochrome E                                           169   3e-45   Glycine soja [wild soybean]
ref|XP_010247418.1|  PREDICTED: phytochrome E-like                      169   5e-45   
dbj|BAJ15817.1|  putative phytochrome E                                 160   6e-45   Pieris nana
dbj|BAJ15815.1|  putative phytochrome E                                 159   2e-44   Pieris nana
dbj|BAJ15818.1|  putative phytochrome E                                 159   2e-44   Pieris nana
dbj|BAJ15830.1|  putative phytochrome E                                 159   2e-44   Pieris nana
dbj|BAJ15822.1|  putative phytochrome E                                 159   2e-44   Pieris nana
dbj|BAJ15814.1|  putative phytochrome E                                 159   2e-44   Pieris nana
dbj|BAJ15823.1|  putative phytochrome E                                 159   2e-44   Pieris nana
dbj|BAJ15829.1|  putative phytochrome E                                 159   2e-44   Pieris nana
dbj|BAJ15810.1|  putative phytochrome E                                 159   2e-44   Pieris nana
dbj|BAJ15826.1|  putative phytochrome E                                 158   5e-44   Pieris nana
dbj|BAJ15828.1|  putative phytochrome E                                 158   6e-44   Pieris nana
dbj|BAJ15821.1|  putative phytochrome E                                 158   7e-44   Pieris nana
dbj|BAJ15827.1|  putative phytochrome E                                 158   7e-44   Pieris nana
dbj|BAI63235.1|  phytochrome E                                          163   8e-44   Pieris nana
dbj|BAI63237.1|  phytochrome E                                          163   8e-44   Pieris nana
dbj|BAI63234.1|  phytochrome E                                          163   8e-44   Pieris nana
dbj|BAI63233.1|  phytochrome E                                          163   8e-44   Pieris nana
dbj|BAI63245.1|  phytochrome E                                          163   8e-44   Pieris nana
ref|XP_004488315.1|  PREDICTED: phytochrome E-like isoform X3           162   8e-43   
dbj|BAI63244.1|  phytochrome E                                          160   8e-43   Pieris nana
dbj|BAI63258.1|  phytochrome E                                          160   8e-43   Pieris nana
dbj|BAI63236.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAI63241.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAI63239.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAI63249.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAI63240.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAI63253.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAN14712.1|  phytochrome E                                          162   9e-43   Lotus japonicus
dbj|BAN14708.1|  phytochrome E                                          162   9e-43   Lotus japonicus
dbj|BAI63257.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAI63256.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAI63247.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAI63252.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAN14706.1|  phytochrome E                                          162   9e-43   Lotus japonicus
dbj|BAI63250.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAN14709.1|  phytochrome E                                          162   9e-43   Lotus japonicus
dbj|BAI63259.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAI63243.1|  phytochrome E                                          160   9e-43   Pieris nana
dbj|BAN14729.1|  phytochrome E                                          162   1e-42   Lotus japonicus
ref|XP_004488314.1|  PREDICTED: phytochrome E-like isoform X2           162   1e-42   Cicer arietinum [garbanzo]
ref|XP_004488313.1|  PREDICTED: phytochrome E-like isoform X1           162   1e-42   Cicer arietinum [garbanzo]
ref|XP_010100997.1|  Phytochrome E                                      162   1e-42   Morus notabilis
ref|XP_003595571.1|  Phytochrome E                                      162   2e-42   Medicago truncatula
dbj|BAI63242.1|  phytochrome E                                          159   3e-42   Pieris nana
dbj|BAI63248.1|  phytochrome E                                          158   3e-42   Pieris nana
dbj|BAI63251.1|  phytochrome E                                          158   3e-42   Pieris nana
dbj|BAI63246.1|  phytochrome E                                          158   3e-42   Pieris nana
ref|XP_008371559.1|  PREDICTED: phytochrome E-like                      157   8e-41   
gb|KGN65574.1|  hypothetical protein Csa_1G461000                       154   5e-40   Cucumis sativus [cucumbers]
ref|XP_004147430.1|  PREDICTED: phytochrome E-like                      154   5e-40   Cucumis sativus [cucumbers]
ref|XP_009352111.1|  PREDICTED: phytochrome E-like                      154   1e-39   
emb|CDY61670.1|  BnaC01g40810D                                          149   5e-38   Brassica napus [oilseed rape]
dbj|BAD94419.1|  phytochrome E                                          142   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008443902.1|  PREDICTED: LOW QUALITY PROTEIN: phytochrome E      147   3e-37   Cucumis melo [Oriental melon]
ref|XP_011459628.1|  PREDICTED: phytochrome E-like isoform X3           145   7e-37   Fragaria vesca subsp. vesca
ref|XP_009131404.1|  PREDICTED: phytochrome E                           145   8e-37   Brassica rapa
ref|XP_004288913.2|  PREDICTED: phytochrome E-like isoform X1           145   8e-37   Fragaria vesca subsp. vesca
ref|XP_011459626.1|  PREDICTED: phytochrome E-like isoform X2           145   8e-37   Fragaria vesca subsp. vesca
ref|XP_010529136.1|  PREDICTED: phytochrome E                           145   8e-37   Tarenaya hassleriana [spider flower]
ref|XP_004295419.1|  PREDICTED: phytochrome E-like isoform X1           145   1e-36   Fragaria vesca subsp. vesca
ref|XP_011460392.1|  PREDICTED: phytochrome E-like isoform X2           145   1e-36   Fragaria vesca subsp. vesca
emb|CAK26504.1|  putative phytochrome P                                 138   1e-36   Picea abies
emb|CAK26507.1|  putative phytochrome P                                 137   2e-36   Picea abies
dbj|BAH47476.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47481.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47478.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47477.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47480.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47475.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47473.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47474.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47471.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47472.1|  phytochrome E                                          142   1e-35   Cardamine nipponica
dbj|BAH47482.1|  phytochrome E                                          142   2e-35   Cardamine resedifolia
ref|NP_193547.4|  phytochrome E                                         142   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CAA54075.1|  phytochrome E                                          142   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28490.1|  phytochrome e                                           141   2e-35   Arabis alpina [alpine rockcress]
gb|KJB72840.1|  hypothetical protein B456_011G200200                    141   2e-35   Gossypium raimondii
gb|KJB72839.1|  hypothetical protein B456_011G200200                    141   2e-35   Gossypium raimondii
ref|XP_009353857.1|  PREDICTED: phytochrome E-like                      141   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_002868009.1|  hypothetical protein ARALYDRAFT_914880             140   4e-35   Arabidopsis lyrata subsp. lyrata
gb|ACC60966.1|  phytochrome B                                           140   4e-35   Vitis vinifera
ref|XP_002278263.1|  PREDICTED: phytochrome B                           140   4e-35   Vitis vinifera
gb|ACC60970.1|  phytochrome B                                           140   5e-35   Vitis riparia [frost grape]
gb|KHG20019.1|  Phytochrome B                                           140   5e-35   Gossypium arboreum [tree cotton]
gb|KDP27911.1|  hypothetical protein JCGZ_18991                         139   1e-34   Jatropha curcas
ref|XP_008358619.1|  PREDICTED: phytochrome E-like                      139   1e-34   
ref|XP_010449502.1|  PREDICTED: phytochrome E isoform X2                139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008383527.1|  PREDICTED: phytochrome E-like                      139   2e-34   
ref|XP_010449501.1|  PREDICTED: phytochrome E isoform X1                139   2e-34   
ref|XP_002519230.1|  phytochrome B, putative                            139   2e-34   Ricinus communis
ref|XP_010445296.1|  PREDICTED: phytochrome E                           138   3e-34   
ref|XP_004134246.1|  PREDICTED: phytochrome B-like                      138   3e-34   
ref|XP_004165483.1|  PREDICTED: phytochrome B-like                      138   3e-34   
ref|XP_006841448.1|  hypothetical protein AMTR_s00003p00079190          138   4e-34   Amborella trichopoda
ref|XP_008438960.1|  PREDICTED: phytochrome B                           138   4e-34   Cucumis melo [Oriental melon]
gb|AHZ63958.1|  phytochrome                                             136   1e-33   Pinus parviflora [goyo-matsu]
gb|AHZ89696.1|  phytochrome B                                           136   1e-33   Dimocarpus longan [longan]
ref|XP_010318997.1|  PREDICTED: phytochrome B1                          136   2e-33   
ref|NP_001274786.1|  phytochrome B                                      136   2e-33   Solanum tuberosum [potatoes]
ref|XP_007035809.1|  Phytochrome B isoform 3                            135   2e-33   
ref|XP_007035808.1|  Phytochrome B isoform 2                            135   3e-33   
ref|XP_007035807.1|  Phytochrome B isoform 1                            135   4e-33   
ref|XP_010065155.1|  PREDICTED: phytochrome B                           135   5e-33   Eucalyptus grandis [rose gum]
gb|AJE63445.1|  phytochrome P                                           134   5e-33   Picea abies
sp|P29130.2|PHYB_TOBAC  RecName: Full=Phytochrome B                     134   5e-33   Nicotiana tabacum [American tobacco]
ref|XP_009789287.1|  PREDICTED: phytochrome B                           134   5e-33   Nicotiana sylvestris
emb|CBJ94872.1|  phytochrome B2                                         127   5e-33   Populus tremula [European aspen]
gb|ACN40636.1|  unknown                                                 134   6e-33   Picea sitchensis
ref|XP_009606016.1|  PREDICTED: phytochrome B                           134   9e-33   Nicotiana tomentosiformis
emb|CBJ94888.1|  phytochrome B2                                         125   1e-32   Populus trichocarpa [western balsam poplar]
emb|CBJ94879.1|  phytochrome B2                                         125   1e-32   Populus balsamifera [balsam poplar]
gb|ABP96522.1|  phytochrome B                                           127   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96519.1|  phytochrome B                                           127   2e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAZ64530.1|  photochrome B2                                         125   2e-32   Populus trichocarpa [western balsam poplar]
gb|AHZ63961.1|  phytochrome                                             132   2e-32   Encephalartos barteri
ref|XP_006285990.1|  hypothetical protein CARUB_v10007527mg             132   3e-32   Capsella rubella
ref|XP_009372122.1|  PREDICTED: phytochrome B-like                      132   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_009336299.1|  PREDICTED: phytochrome B-like                      132   3e-32   Pyrus x bretschneideri [bai li]
gb|ABP96531.1|  phytochrome B                                           126   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006419379.1|  hypothetical protein CICLE_v10004218mg             132   4e-32   
ref|XP_010109967.1|  Phytochrome B                                      132   5e-32   
emb|CAA74992.1|  phytochrome B                                          132   5e-32   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ABP96523.1|  phytochrome B                                           126   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006488839.1|  PREDICTED: phytochrome B-like isoform X1           132   5e-32   Citrus sinensis [apfelsine]
ref|XP_008368328.1|  PREDICTED: phytochrome B                           132   5e-32   
gb|KDO71942.1|  hypothetical protein CISIN_1g037299mg                   132   6e-32   Citrus sinensis [apfelsine]
ref|XP_007227356.1|  hypothetical protein PRUPE_ppa000510mg             132   6e-32   Prunus persica
gb|AGF69863.1|  phytochrome B1                                          131   7e-32   Populus angustifolia [willow cottonwood]
gb|AGF69752.1|  phytochrome B1                                          131   7e-32   Populus angustifolia [willow cottonwood]
gb|AGF69739.1|  phytochrome B1                                          131   7e-32   Populus angustifolia [willow cottonwood]
gb|ADO62136.1|  phytochrome B                                           125   7e-32   Helianthus annuus
gb|AGF69737.1|  phytochrome B1                                          131   7e-32   Populus angustifolia [willow cottonwood]
gb|AGF69730.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69866.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69744.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69729.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69733.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69795.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69746.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69745.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69728.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69720.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69719.1|  phytochrome B1                                          131   8e-32   Populus angustifolia [willow cottonwood]
gb|AGF69764.1|  phytochrome B1                                          131   9e-32   Populus angustifolia [willow cottonwood]
gb|AAM91631.1|  putative phytochrome D                                  128   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019946.1|  PREDICTED: phytochrome B isoform X3                130   1e-31   Populus euphratica
ref|XP_011019953.1|  PREDICTED: phytochrome B isoform X4                130   1e-31   Populus euphratica
ref|XP_008223364.1|  PREDICTED: phytochrome B                           131   1e-31   Prunus mume [ume]
gb|AEA50884.1|  phyB1                                                   129   1e-31   Populus tremula [European aspen]
ref|XP_002312330.2|  Phytochrome B family protein                       130   1e-31   
gb|ADO62149.1|  phytochrome B                                           124   1e-31   Helianthus annuus
gb|ADO62060.1|  phytochrome B                                           124   1e-31   Helianthus argophyllus
sp|P34094.2|PHYB_SOLTU  RecName: Full=Phytochrome B                     130   2e-31   Solanum tuberosum [potatoes]
ref|XP_006358209.1|  PREDICTED: phytochrome B                           130   2e-31   Solanum tuberosum [potatoes]
gb|AAG25725.1|AF309806_1  phytochrome B1                                130   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011019938.1|  PREDICTED: phytochrome B isoform X2                130   2e-31   Populus euphratica
ref|XP_011019931.1|  PREDICTED: phytochrome B isoform X1                130   2e-31   Populus euphratica
ref|XP_008360244.1|  PREDICTED: phytochrome B-like isoform X2           130   2e-31   
ref|XP_008360243.1|  PREDICTED: phytochrome B-like isoform X1           130   3e-31   
gb|AEK06044.1|  phytochrome B1                                          129   3e-31   Populus balsamifera [balsam poplar]
ref|XP_011100755.1|  PREDICTED: phytochrome B-like                      129   3e-31   Sesamum indicum [beniseed]
gb|AEK06055.1|  phytochrome B1                                          129   4e-31   Populus balsamifera [balsam poplar]
ref|XP_007147366.1|  hypothetical protein PHAVU_006G118200g             129   4e-31   Phaseolus vulgaris [French bean]
gb|AEK06039.1|  phytochrome B1                                          129   5e-31   Populus balsamifera [balsam poplar]
gb|AEK06040.1|  phytochrome B1                                          129   5e-31   Populus balsamifera [balsam poplar]
gb|AEK06052.1|  phytochrome B1                                          129   5e-31   Populus balsamifera [balsam poplar]
emb|CAJ21328.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21299.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
ref|XP_011071377.1|  PREDICTED: phytochrome B                           129   5e-31   Sesamum indicum [beniseed]
emb|CAJ21331.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21295.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21312.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21304.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21308.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
gb|AEK26584.1|  phytochrome B1                                          129   5e-31   Populus tremula [European aspen]
emb|CAJ21298.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21297.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21300.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21318.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21324.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21317.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21292.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21334.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21296.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21319.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21309.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21314.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21316.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21321.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21311.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21310.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21332.1|  phytochrome B2                                         129   5e-31   Populus tremula [European aspen]
emb|CAJ21305.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21322.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21302.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21313.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21315.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21323.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21329.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21303.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21294.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21336.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21301.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21306.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21320.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21326.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
ref|XP_011010469.1|  PREDICTED: phytochrome B isoform X2                129   6e-31   Populus euphratica
emb|CAJ21327.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
emb|CAJ21330.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
gb|AHZ63941.1|  phytochrome                                             129   6e-31   Anemia tomentosa
emb|CAJ21325.1|  phytochrome B2                                         129   6e-31   Populus tremula [European aspen]
gb|AGF69740.1|  phytochrome B1                                          128   8e-31   Populus angustifolia [willow cottonwood]
emb|CAJ21291.1|  phytochrome B2                                         128   8e-31   Populus tremula [European aspen]
ref|XP_011010461.1|  PREDICTED: phytochrome B isoform X1                128   8e-31   Populus euphratica
gb|ADO62106.1|  phytochrome B                                           122   9e-31   Helianthus annuus
ref|XP_010434576.1|  PREDICTED: phytochrome E-like isoform X1           128   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010434577.1|  PREDICTED: phytochrome E-like isoform X2           128   1e-30   Camelina sativa [gold-of-pleasure]
emb|CAJ21293.1|  phytochrome B2                                         128   1e-30   Populus tremula [European aspen]
gb|AAW56603.1|  phytochrome D                                           128   1e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CAJ21333.1|  phytochrome B2                                         128   1e-30   Populus tremula [European aspen]
ref|XP_006406775.1|  hypothetical protein EUTSA_v100199780mg            127   1e-30   
gb|ADO60995.1|  phytochrome b                                           127   1e-30   Helianthus annuus
gb|EYU45495.1|  hypothetical protein MIMGU_mgv1a000516mg                128   1e-30   Erythranthe guttata [common monkey flower]
ref|XP_008781148.1|  PREDICTED: phytochrome B                           128   1e-30   
gb|ADO60994.1|  phytochrome b                                           126   1e-30   
gb|AAW56598.1|  phytochrome D                                           127   2e-30   
gb|AAW56599.1|  phytochrome D                                           127   2e-30   
gb|AAW56605.1|  phytochrome D                                           127   2e-30   
gb|AAW56593.1|  phytochrome D                                           127   2e-30   
gb|AAW56602.1|  phytochrome D                                           127   2e-30   
gb|AAW56601.1|  phytochrome D                                           127   2e-30   
gb|AAW56592.1|  phytochrome D                                           127   2e-30   
gb|AAW56600.1|  phytochrome D                                           127   2e-30   
gb|AAW56596.1|  phytochrome D                                           127   2e-30   
ref|NP_193360.1|  phytochrome D                                         127   2e-30   
emb|CAA54072.1|  phytochrome D                                          127   2e-30   
sp|Q41046.1|PHY_PINSY  RecName: Full=Phytochrome                        127   2e-30   
ref|XP_006378543.1|  hypothetical protein POPTR_0010s15600g             127   2e-30   
gb|EPS68696.1|  hypothetical protein M569_06071                         127   2e-30   
gb|AGF69659.1|  phytochrome B2                                          127   2e-30   
gb|AGF69656.1|  phytochrome B2                                          127   2e-30   
gb|AGF69582.1|  phytochrome B2                                          127   2e-30   
gb|AGF69569.1|  phytochrome B2                                          127   2e-30   
gb|AAG25726.1|AF309807_1  phytochrome B2                                127   2e-30   
gb|AGF69571.1|  phytochrome B2                                          127   2e-30   
gb|AGF69587.1|  phytochrome B2                                          127   2e-30   
gb|AGF69553.1|  phytochrome B2                                          127   2e-30   
gb|AGF69665.1|  phytochrome B2                                          127   2e-30   
gb|AGF69550.1|  phytochrome B2                                          127   2e-30   
gb|AGF69603.1|  phytochrome B2                                          127   3e-30   
gb|AGF69581.1|  phytochrome B2                                          127   3e-30   
gb|AGF69557.1|  phytochrome B2                                          127   3e-30   
gb|AGF69618.1|  phytochrome B2                                          127   3e-30   
gb|AGF69609.1|  phytochrome B2                                          127   3e-30   
gb|AGF69670.1|  phytochrome B2                                          127   3e-30   
gb|AGF69549.1|  phytochrome B2                                          127   3e-30   
gb|AGF69605.1|  phytochrome B2                                          127   3e-30   
gb|AGF69606.1|  phytochrome B2                                          127   3e-30   
ref|XP_002314949.2|  hypothetical protein POPTR_0010s15600g             127   3e-30   
ref|XP_010548998.1|  PREDICTED: phytochrome B                           127   3e-30   
dbj|BAJ34089.1|  unnamed protein product                                127   3e-30   
ref|XP_010671735.1|  PREDICTED: phytochrome B isoform X2                126   4e-30   
gb|AAW56606.1|  phytochrome D                                           126   4e-30   
ref|XP_002886263.1|  phytochrome B                                      126   5e-30   
gb|AAW56591.1|  phytochrome B                                           126   5e-30   
gb|AAW56587.1|  phytochrome B                                           126   5e-30   
gb|AHZ63956.1|  phytochrome                                             126   5e-30   
gb|AAR32737.1|  phytochrome B                                           126   5e-30   
gb|AAW56589.1|  phytochrome B                                           126   5e-30   
gb|AAW56590.1|  phytochrome B                                           126   5e-30   
gb|ABY61300.1|  phytochrome B                                           126   5e-30   
gb|AAW56588.1|  phytochrome B                                           126   5e-30   
ref|XP_010671734.1|  PREDICTED: phytochrome B isoform X1                126   5e-30   
ref|XP_006597697.1|  PREDICTED: phytochrome B-like isoform X3           125   6e-30   
gb|ABY61301.1|  phytochrome B                                           126   6e-30   
gb|AAW56580.1|  phytochrome B                                           126   6e-30   
gb|ABY61307.1|  phytochrome B                                           126   6e-30   
gb|AAW56586.1|  phytochrome B                                           126   6e-30   
gb|AAW56594.1|  phytochrome D                                           126   6e-30   
gb|ABY61314.1|  phytochrome B                                           126   6e-30   
emb|CDX95888.1|  BnaC05g36390D                                          125   7e-30   
emb|CAJ21307.1|  phytochrome B2                                         125   8e-30   
ref|XP_003546314.1|  PREDICTED: phytochrome B-like isoformX1            125   9e-30   
gb|ACE79199.2|  phytochrome B-2                                         125   9e-30   
ref|XP_002868148.1|  phytochrome D                                      125   9e-30   
gb|KFK40923.1|  phytochrome b                                           125   1e-29   
gb|AAW56576.1|  phytochrome B                                           125   1e-29   
gb|AAW56577.1|  phytochrome B                                           125   1e-29   
gb|AHZ63972.1|  phytochrome                                             125   1e-29   
gb|AAW56575.1|  phytochrome B                                           125   1e-29   
gb|AAW56578.1|  phytochrome B                                           125   1e-29   
ref|NP_179469.1|  phytochrome B                                         125   1e-29   
gb|AEK06073.1|  phytochrome B2                                          124   2e-29   
gb|AEK06067.1|  phytochrome B2                                          124   2e-29   
ref|XP_004295077.1|  PREDICTED: phytochrome B-like                      124   2e-29   
gb|AEK06060.1|  phytochrome B2                                          124   2e-29   
gb|AEK06057.1|  phytochrome B2                                          124   2e-29   
gb|AHZ63960.1|  phytochrome                                             124   2e-29   
ref|XP_006296857.1|  hypothetical protein CARUB_v10012844mg             124   2e-29   
gb|AEK06070.1|  phytochrome B2                                          124   2e-29   
ref|XP_010267948.1|  PREDICTED: phytochrome B                           124   2e-29   
gb|ACV87354.1|  phytochrome B                                           124   4e-29   
gb|AHZ63939.1|  phytochrome                                             124   4e-29   
gb|KHN04123.1|  Phytochrome E                                           123   4e-29   
gb|AIK23234.1|  phytochrome B                                           123   4e-29   
ref|NP_001288833.1|  phytochrome B                                      123   4e-29   
gb|AIK23233.1|  phytochrome B                                           123   4e-29   
ref|XP_009146045.1|  PREDICTED: phytochrome B                           123   5e-29   
gb|AHZ63957.1|  phytochrome                                             123   5e-29   
ref|XP_010321413.1|  PREDICTED: phytochrome B isoform X2                122   5e-29   
emb|CDX92112.1|  BnaA05g22950D                                          123   5e-29   
gb|ACE79200.1|  phytochrome B-3                                         123   5e-29   
gb|ACJ61499.1|  phytochrome B                                           123   6e-29   
ref|NP_001240097.1|  phytochrome B-like                                 123   6e-29   
ref|XP_010440189.1|  PREDICTED: LOW QUALITY PROTEIN: phytochrome D      123   6e-29   
gb|ADO62109.1|  phytochrome B                                           117   1e-28   
ref|XP_010467719.1|  PREDICTED: phytochrome B-like isoform X2           122   2e-28   
ref|XP_010489600.1|  PREDICTED: phytochrome B isoform X2                122   2e-28   
gb|KFK36127.1|  phytochrome d                                           122   2e-28   
ref|XP_010467718.1|  PREDICTED: phytochrome B-like isoform X1           121   2e-28   
ref|XP_010489599.1|  PREDICTED: phytochrome B isoform X1                121   2e-28   
gb|AHZ63959.1|  phytochrome                                             121   2e-28   
dbj|BAH79251.1|  phytochrome B                                          121   2e-28   
dbj|BAH79244.1|  phytochrome B                                          121   2e-28   
dbj|BAH79245.1|  phytochrome B                                          121   2e-28   
gb|AHZ63948.1|  phytochrome                                             121   2e-28   
dbj|BAH79250.1|  phytochrome B                                          121   2e-28   
dbj|BAH79249.1|  phytochrome B                                          121   2e-28   
dbj|BAH79248.1|  phytochrome B                                          121   3e-28   
gb|AGU91425.1|  phytochrome B                                           121   3e-28   
ref|XP_010414768.1|  PREDICTED: phytochrome B-like isoform X5           121   3e-28   
ref|XP_010321412.1|  PREDICTED: phytochrome B isoform X1                121   3e-28   
ref|XP_010414759.1|  PREDICTED: phytochrome B-like isoform X4           121   3e-28   
dbj|BAM67033.1|  phytochrome b                                          121   3e-28   
ref|XP_010414738.1|  PREDICTED: phytochrome B-like isoform X1           121   3e-28   
ref|XP_010414753.1|  PREDICTED: phytochrome B-like isoform X3           121   3e-28   
ref|XP_010414746.1|  PREDICTED: phytochrome B-like isoform X2           121   4e-28   
ref|XP_010921452.1|  PREDICTED: LOW QUALITY PROTEIN: phytochrome B      120   5e-28   
gb|AHZ63947.1|  phytochrome                                             120   6e-28   
ref|XP_006283034.1|  hypothetical protein CARUB_v10004026mg             119   1e-27   
gb|AAQ11872.1|  phytochrome B                                           119   1e-27   
emb|CAJ21335.1|  phytochrome B2                                         119   1e-27   
ref|XP_009791671.1|  PREDICTED: phytochrome B-like                      118   2e-27   
ref|XP_009391516.1|  PREDICTED: phytochrome B                           119   2e-27   
gb|AGX28207.1|  phytochrome b2                                          114   2e-27   
gb|AGX28212.1|  phytochrome b2                                          114   2e-27   
gb|AGX28224.1|  phytochrome b2                                          114   2e-27   
gb|AGX28215.1|  phytochrome b2                                          114   2e-27   
gb|AGX28208.1|  phytochrome b2                                          114   3e-27   
gb|AHZ63973.1|  phytochrome                                             118   3e-27   
ref|XP_009591321.1|  PREDICTED: phytochrome B-like                      118   3e-27   
gb|AEA41043.1|  phytochrome B                                           118   3e-27   
gb|AHZ63940.1|  phytochrome                                             117   5e-27   
emb|CAJ21338.1|  phytochrome B2                                         117   5e-27   
emb|CAJ21337.1|  phytochrome B2                                         117   5e-27   
gb|AHZ63998.1|  phytochrome                                             117   9e-27   
gb|AHZ63938.1|  phytochrome                                             116   1e-26   
gb|AAB19058.1|  phytochrome photoreceptor                               116   1e-26   
sp|Q39557.1|PHY2_CERPU  RecName: Full=Phytochrome 2                     116   1e-26   
dbj|BAN14728.1|  phytochrome B                                          116   1e-26   
ref|XP_008808701.1|  PREDICTED: phytochrome B-like                      116   2e-26   
dbj|BAN14700.1|  phytochrome B                                          115   2e-26   
dbj|BAF44083.1|  phytochrome b                                          115   2e-26   
gb|ABC40701.1|  phytochrome B2                                          108   2e-26   
gb|ABC40696.1|  phytochrome B2                                          108   2e-26   
ref|XP_006414374.1|  hypothetical protein EUTSA_v10024253mg             115   2e-26   
gb|AFK31027.1|  phytochrome b                                           115   2e-26   
gb|ABC40700.1|  phytochrome B2                                          108   3e-26   
gb|ABC40695.1|  phytochrome B2                                          108   3e-26   
gb|AFK31033.1|  phytochrome b                                           115   3e-26   
emb|CDX75900.1|  BnaC03g39830D                                          115   4e-26   
gb|AAM94954.1|  phytochrome                                             115   4e-26   
dbj|BAM36555.1|  phytochrome B                                          115   4e-26   
gb|ABC40681.1|  phytochrome B1                                          107   4e-26   
ref|XP_001782339.1|  phytochrome 2                                      115   4e-26   
gb|AHX73747.1|  phytochrome                                             114   6e-26   
gb|AAR30915.1|  phytochrome B                                           114   6e-26   
ref|XP_002467973.1|  hypothetical protein SORBIDRAFT_01g037340          114   6e-26   
gb|AAR30914.1|  phytochrome B                                           114   6e-26   
sp|P93527.2|PHYB_SORBI  RecName: Full=Phytochrome B                     114   6e-26   
gb|AAR30905.1|  phytochrome B                                           114   6e-26   
gb|AAR30903.1|  phytochrome B                                           114   6e-26   
gb|ABC40711.1|  phytochrome B2                                          107   7e-26   
ref|XP_004984602.1|  PREDICTED: phytochrome B-like                      114   7e-26   
gb|AFK31046.1|  phytochrome b                                           114   8e-26   
gb|ABC40685.1|  phytochrome B1                                          113   8e-26   
ref|XP_002991641.1|  hypothetical protein SELMODRAFT_161807             114   9e-26   
gb|EEC75099.1|  hypothetical protein OsI_11260                          114   9e-26   
gb|AFK31047.1|  phytochrome b                                           114   9e-26   
gb|AFK30997.1|  phytochrome b                                           114   9e-26   
ref|XP_010938231.1|  PREDICTED: LOW QUALITY PROTEIN: phytochrome ...    114   9e-26   
ref|XP_002991119.1|  hypothetical protein SELMODRAFT_161430             114   9e-26   
gb|AAX76779.1|  putative phytochrome B                                  114   9e-26   
dbj|BAJ96486.1|  predicted protein                                      114   9e-26   
dbj|BAP91202.1|  phytochrome B CDS                                      114   9e-26   
gb|ACU21557.1|  phytochrome B                                           114   1e-25   
gb|AHZ63954.1|  phytochrome                                             114   1e-25   
gb|AFK30983.1|  phytochrome b                                           114   1e-25   
gb|AFK31018.1|  phytochrome b                                           114   1e-25   
gb|AFK30981.1|  phytochrome b                                           114   1e-25   
gb|AFK31034.1|  phytochrome b                                           114   1e-25   
gb|AFK30971.1|  phytochrome b                                           114   1e-25   
gb|AFK31045.1|  phytochrome b                                           114   1e-25   
gb|AFK31026.1|  phytochrome b                                           114   1e-25   
gb|AFK31025.1|  phytochrome b                                           114   1e-25   
gb|AFK31024.1|  phytochrome b                                           114   1e-25   
gb|AFK31032.1|  phytochrome b                                           114   1e-25   
gb|AFK31031.1|  phytochrome b                                           114   1e-25   
gb|AFK30995.1|  phytochrome b                                           114   1e-25   
gb|AFK30978.1|  phytochrome b                                           114   1e-25   
gb|AFK30974.1|  phytochrome b                                           114   1e-25   
gb|AFK30972.1|  phytochrome b                                           114   1e-25   
gb|AFK31042.1|  phytochrome b                                           113   1e-25   
gb|AFK31039.1|  phytochrome b                                           113   1e-25   
gb|AFK31023.1|  phytochrome b                                           113   1e-25   
gb|AFK31044.1|  phytochrome b                                           113   1e-25   
gb|AFK31040.1|  phytochrome b                                           113   1e-25   
gb|AFK31028.1|  phytochrome b                                           113   1e-25   
gb|AFK31002.1|  phytochrome b                                           113   1e-25   
gb|AFK30984.1|  phytochrome b                                           113   1e-25   
gb|AFK30985.1|  phytochrome b                                           113   1e-25   
sp|Q10MG9.1|PHYB_ORYSJ  RecName: Full=Phytochrome B                     113   1e-25   
gb|AFK31049.1|  phytochrome b                                           113   1e-25   
gb|AFK31011.1|  phytochrome b                                           113   1e-25   
gb|AFK31004.1|  phytochrome b                                           113   1e-25   
gb|AFK30993.1|  phytochrome b                                           113   1e-25   
gb|AFK30992.1|  phytochrome b                                           113   1e-25   
gb|AFK30990.1|  phytochrome b                                           113   1e-25   
gb|AFK30988.1|  phytochrome b                                           113   1e-25   
gb|AFK31036.1|  phytochrome b                                           113   1e-25   
gb|AFK30970.1|  phytochrome b                                           113   1e-25   
gb|AFK31053.1|  phytochrome b                                           113   1e-25   
gb|AFK31041.1|  phytochrome b                                           113   1e-25   
gb|AFK31038.1|  phytochrome b                                           113   1e-25   
gb|AFK31035.1|  phytochrome b                                           113   1e-25   
gb|AFK30994.1|  phytochrome b                                           113   1e-25   
gb|AFK30986.1|  phytochrome b                                           113   1e-25   
gb|AFK30979.1|  phytochrome b                                           113   1e-25   
gb|AFK30973.1|  phytochrome b                                           113   1e-25   
emb|CAA40795.2|  phytochrome B                                          113   1e-25   
gb|AFK31017.1|  phytochrome b                                           113   1e-25   
gb|AFK31029.1|  phytochrome b                                           113   1e-25   
sp|A2XFW2.2|PHYB_ORYSI  RecName: Full=Phytochrome B                     113   1e-25   
gb|AFK31007.1|  phytochrome b                                           113   1e-25   



>sp|P55004.1|PHYE_IPONI RecName: Full=Phytochrome E [Ipomoea nil]
 gb|AAA84970.1| phytochrome E [Ipomoea nil]
Length=1115

 Score =   292 bits (747),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/142 (100%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  52   MENYGKAVTFSSSATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNV  231
            MENYGKAVTFSSSATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNV
Sbjct  1    MENYGKAVTFSSSATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNV  60

Query  232  TEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLI  411
            TEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLI
Sbjct  61   TEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLI  120

Query  412  GIDARTLFTLSSRASLAKAVAS  477
            GIDARTLFTLSSRASLAKAVAS
Sbjct  121  GIDARTLFTLSSRASLAKAVAS  142



>emb|CDG41612.1| Phytochrome E [Rhazya stricta]
Length=927

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 128/159 (81%), Gaps = 2/159 (1%)
 Frame = +1

Query  4    MDLQskekkkpptskkMENYGKAVTFSSSATSNLNTGKA-IAQYNADAKLMAEFEQSRES  180
            M+LQS+E++      K  NY  + TFSSS  SN+NT +A  AQY+ADA+LMAEFEQS  +
Sbjct  1    MELQSQERENTGERNKASNY-NSTTFSSSGASNVNTSEAERAQYSADARLMAEFEQSSGT  59

Query  181  GKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFD  360
            GKSF Y+RSVI APQ VTE++M AYL RIQRGGLIQ FGCMLAIEEP+FKI+G+SENCFD
Sbjct  60   GKSFKYTRSVISAPQTVTEDQMNAYLGRIQRGGLIQSFGCMLAIEEPTFKIIGYSENCFD  119

Query  361  LLGLKSGVEPPERMSLIGIDARTLFTLSSRASLAKAVAS  477
            LLGLKS VE  + + L+GIDARTLFT SSRASLAKA AS
Sbjct  120  LLGLKSFVESKQLVRLLGIDARTLFTPSSRASLAKAAAS  158



>ref|XP_007025188.1| Phytochrome E isoform 2 [Theobroma cacao]
 ref|XP_007025189.1| Phytochrome E isoform 2 [Theobroma cacao]
 gb|EOY27810.1| Phytochrome E isoform 2 [Theobroma cacao]
 gb|EOY27811.1| Phytochrome E isoform 2 [Theobroma cacao]
Length=813

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 5/138 (4%)
 Frame = +1

Query  79   FSSSATSNL---NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMT  249
             SSSA SN+   N GKAIAQYNADA LMAEFEQS  SGKSF+YSRSVI+AP++V EE++T
Sbjct  22   LSSSAASNMKPINKGKAIAQYNADAGLMAEFEQSGVSGKSFNYSRSVIYAPRSVPEEQIT  81

Query  250  AYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERM--SLIGIDA  423
            AYLSRIQRGGLIQPFGCM+AIEEP+F+I+ +SENCF+LLGL+   E   +    LIGIDA
Sbjct  82   AYLSRIQRGGLIQPFGCMIAIEEPTFRIISYSENCFELLGLRLDTEDESKALKGLIGIDA  141

Query  424  RTLFTLSSRASLAKAVAS  477
            R+LFT +S  SLAKA AS
Sbjct  142  RSLFTPASGPSLAKAAAS  159



>ref|XP_007025187.1| Phytochrome E isoform 1 [Theobroma cacao]
 gb|EOY27809.1| Phytochrome E isoform 1 [Theobroma cacao]
Length=1127

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 5/138 (4%)
 Frame = +1

Query  79   FSSSATSNL---NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMT  249
             SSSA SN+   N GKAIAQYNADA LMAEFEQS  SGKSF+YSRSVI+AP++V EE++T
Sbjct  22   LSSSAASNMKPINKGKAIAQYNADAGLMAEFEQSGVSGKSFNYSRSVIYAPRSVPEEQIT  81

Query  250  AYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERM--SLIGIDA  423
            AYLSRIQRGGLIQPFGCM+AIEEP+F+I+ +SENCF+LLGL+   E   +    LIGIDA
Sbjct  82   AYLSRIQRGGLIQPFGCMIAIEEPTFRIISYSENCFELLGLRLDTEDESKALKGLIGIDA  141

Query  424  RTLFTLSSRASLAKAVAS  477
            R+LFT +S  SLAKA AS
Sbjct  142  RSLFTPASGPSLAKAAAS  159



>ref|XP_011085288.1| PREDICTED: phytochrome E [Sesamum indicum]
Length=1120

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +1

Query  55   ENYGKAVTFSSSATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT  234
            EN       SSSA SN N  + +AQYNADA+LMAEFEQS  SGK FDYS+SV  +    T
Sbjct  20   ENRNNVSALSSSAASNHNANRTLAQYNADARLMAEFEQSGMSGKVFDYSKSVPESQIPST  79

Query  235  EEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIG  414
            EE+M AYLS+IQRGGL+QPFGC+LAIEEP+F I  +SENCFD+LGLKS  E  E MSLIG
Sbjct  80   EEQMIAYLSKIQRGGLVQPFGCLLAIEEPNFSITAYSENCFDMLGLKSLFESKESMSLIG  139

Query  415  IDARTLFTLSSRASLAKAVAS  477
            +DARTLFT SSR SL KAVAS
Sbjct  140  MDARTLFTPSSRTSLMKAVAS  160



>ref|XP_006355589.1| PREDICTED: phytochrome E-like isoform X1 [Solanum tuberosum]
Length=1136

 Score =   180 bits (456),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 109/137 (80%), Gaps = 10/137 (7%)
 Frame = +1

Query  82   SSSATSNL--NTGKA-IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            +SSA SN+  N  KA +AQYNADAKLMAEFEQS  SGKSFDYS+SV + PQ   EEE+T+
Sbjct  31   TSSAASNMKNNASKAALAQYNADAKLMAEFEQSSVSGKSFDYSKSVPYPPQETNEEEITS  90

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMS--LIGIDAR  426
            YLSRIQRGGL+QPFGCM+AIEEP+FKI+G+SENCFD+LG       P +M   LIG+DAR
Sbjct  91   YLSRIQRGGLVQPFGCMVAIEEPTFKIIGYSENCFDMLGFN-----PTKMKLGLIGVDAR  145

Query  427  TLFTLSSRASLAKAVAS  477
            TLFT SS  SLAK +AS
Sbjct  146  TLFTPSSGDSLAKVMAS  162



>ref|XP_006355590.1| PREDICTED: phytochrome E-like isoform X2 [Solanum tuberosum]
Length=1135

 Score =   180 bits (456),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 109/137 (80%), Gaps = 10/137 (7%)
 Frame = +1

Query  82   SSSATSNL--NTGKA-IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            +SSA SN+  N  KA +AQYNADAKLMAEFEQS  SGKSFDYS+SV + PQ   EEE+T+
Sbjct  31   TSSAASNMKNNASKAALAQYNADAKLMAEFEQSSVSGKSFDYSKSVPYPPQETNEEEITS  90

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMS--LIGIDAR  426
            YLSRIQRGGL+QPFGCM+AIEEP+FKI+G+SENCFD+LG       P +M   LIG+DAR
Sbjct  91   YLSRIQRGGLVQPFGCMVAIEEPTFKIIGYSENCFDMLGFN-----PTKMKLGLIGVDAR  145

Query  427  TLFTLSSRASLAKAVAS  477
            TLFT SS  SLAK +AS
Sbjct  146  TLFTPSSGDSLAKVMAS  162



>ref|XP_006586694.1| PREDICTED: phytochrome E-like isoform X1 [Glycine max]
Length=802

 Score =   177 bits (450),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +1

Query  67   KAVTFSSSATSNLNT--GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            K  + S+SA SN+N+   K +AQY+ADA+++AEFEQS  SGKSFDYSR V+  P+ V+E+
Sbjct  10   KDTSLSTSAESNMNSKRDKILAQYSADAEILAEFEQSGVSGKSFDYSRMVLDPPRLVSEQ  69

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGID  420
            +MTAYLS+IQRGGLIQPFGCMLAIEE +F+I+GFS+NCF LLGL+  ++  + M LIG+D
Sbjct  70   KMTAYLSKIQRGGLIQPFGCMLAIEESTFRIIGFSDNCFQLLGLERQIDSKQFMGLIGVD  129

Query  421  ARTLFTLSSRASLAKAVAS  477
            A TLFT  S ASLAKA AS
Sbjct  130  ATTLFTPPSGASLAKAAAS  148



>ref|NP_001273774.1| phytochrome E-like [Glycine max]
 gb|AEX08378.1| phytochrome E1 [Glycine max]
Length=1120

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +1

Query  67   KAVTFSSSATSNLNT--GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            K  + S+SA SN+N+   K +AQY+ADA+++AEFEQS  SGKSFDYSR V+  P+ V+E+
Sbjct  10   KDTSLSTSAESNMNSKRDKILAQYSADAEILAEFEQSGVSGKSFDYSRMVLDPPRLVSEQ  69

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGID  420
            +MTAYLS+IQRGGLIQPFGCMLAIEE +F+I+GFS+NCF LLGL+  ++  + M LIG+D
Sbjct  70   KMTAYLSKIQRGGLIQPFGCMLAIEESTFRIIGFSDNCFQLLGLERQIDSKQFMGLIGVD  129

Query  421  ARTLFTLSSRASLAKAVAS  477
            A TLFT  S ASLAKA AS
Sbjct  130  ATTLFTPPSGASLAKAAAS  148



>ref|XP_009631925.1| PREDICTED: phytochrome E isoform X2 [Nicotiana tomentosiformis]
Length=1145

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  109  TGKA-IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQ-NVTEEEMTAYLSRIQRGGL  282
            T KA +AQYNADAKLMAEFEQS  SGKSF+YSRSV++APQ N  EEE+T+YLSRIQRGGL
Sbjct  48   TSKATMAQYNADAKLMAEFEQSGVSGKSFNYSRSVLYAPQDNANEEEITSYLSRIQRGGL  107

Query  283  IQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTLSSRASLA  462
            +QPFGCMLAIEE +FKI+G+SENCFD+LG K   E  + ++LIG+DARTLFT SS ASLA
Sbjct  108  VQPFGCMLAIEEHTFKIIGYSENCFDMLGFKIA-ESSKLITLIGVDARTLFTPSSGASLA  166

Query  463  KAVAS  477
            KA+ S
Sbjct  167  KAMTS  171



>ref|XP_007214556.1| hypothetical protein PRUPE_ppa000491mg [Prunus persica]
 gb|EMJ15755.1| hypothetical protein PRUPE_ppa000491mg [Prunus persica]
Length=1129

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 113/147 (77%), Gaps = 13/147 (9%)
 Frame = +1

Query  76   TFSSSATSNL-----NT--------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIH  216
            TFSSSATSN+     NT         K+IAQYNADA ++AE+EQS  SGKSF+YSRSV++
Sbjct  12   TFSSSATSNMRPNKNNTTTSGTAKRDKSIAQYNADAGILAEYEQSTASGKSFNYSRSVLY  71

Query  217  APQNVTEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPE  396
             P++V EE+++ Y SRIQRG L+Q FGCMLAIEEP+F+I+G+SENCF+LLGL S  E  +
Sbjct  72   PPESVPEEQISVYFSRIQRGALVQSFGCMLAIEEPTFRIIGYSENCFELLGLDSLFESKQ  131

Query  397  RMSLIGIDARTLFTLSSRASLAKAVAS  477
               LIGID+RTLFT SS ASLAKA AS
Sbjct  132  LKGLIGIDSRTLFTPSSGASLAKAAAS  158



>ref|XP_009631916.1| PREDICTED: phytochrome E isoform X1 [Nicotiana tomentosiformis]
Length=1152

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  109  TGKA-IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQ-NVTEEEMTAYLSRIQRGGL  282
            T KA +AQYNADAKLMAEFEQS  SGKSF+YSRSV++APQ N  EEE+T+YLSRIQRGGL
Sbjct  48   TSKATMAQYNADAKLMAEFEQSGVSGKSFNYSRSVLYAPQDNANEEEITSYLSRIQRGGL  107

Query  283  IQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTLSSRASLA  462
            +QPFGCMLAIEE +FKI+G+SENCFD+LG K   E  + ++LIG+DARTLFT SS ASLA
Sbjct  108  VQPFGCMLAIEEHTFKIIGYSENCFDMLGFKIA-ESSKLITLIGVDARTLFTPSSGASLA  166

Query  463  KAVAS  477
            KA+ S
Sbjct  167  KAMTS  171



>ref|XP_009631929.1| PREDICTED: phytochrome E isoform X3 [Nicotiana tomentosiformis]
Length=1144

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  109  TGKA-IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQ-NVTEEEMTAYLSRIQRGGL  282
            T KA +AQYNADAKLMAEFEQS  SGKSF+YSRSV++APQ N  EEE+T+YLSRIQRGGL
Sbjct  48   TSKATMAQYNADAKLMAEFEQSGVSGKSFNYSRSVLYAPQDNANEEEITSYLSRIQRGGL  107

Query  283  IQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTLSSRASLA  462
            +QPFGCMLAIEE +FKI+G+SENCFD+LG K   E  + ++LIG+DARTLFT SS ASLA
Sbjct  108  VQPFGCMLAIEEHTFKIIGYSENCFDMLGFKIA-ESSKLITLIGVDARTLFTPSSGASLA  166

Query  463  KAVAS  477
            KA+ S
Sbjct  167  KAMTS  171



>dbj|BAJ15834.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLG--LKSGVEPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF LLG  L +  E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFILLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>ref|XP_007214557.1| hypothetical protein PRUPE_ppa000491mg [Prunus persica]
 gb|EMJ15756.1| hypothetical protein PRUPE_ppa000491mg [Prunus persica]
Length=1130

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 113/147 (77%), Gaps = 13/147 (9%)
 Frame = +1

Query  76   TFSSSATSNL-----NT--------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIH  216
            TFSSSATSN+     NT         K+IAQYNADA ++AE+EQS  SGKSF+YSRSV++
Sbjct  12   TFSSSATSNMRPNKNNTTTSGTAKRDKSIAQYNADAGILAEYEQSTASGKSFNYSRSVLY  71

Query  217  APQNVTEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPE  396
             P++V EE+++ Y SRIQRG L+Q FGCMLAIEEP+F+I+G+SENCF+LLGL S  E  +
Sbjct  72   PPESVPEEQISVYFSRIQRGALVQSFGCMLAIEEPTFRIIGYSENCFELLGLDSLFESKQ  131

Query  397  RMSLIGIDARTLFTLSSRASLAKAVAS  477
               LIGID+RTLFT SS ASLAKA AS
Sbjct  132  LKGLIGIDSRTLFTPSSGASLAKAAAS  158



>ref|XP_004232975.1| PREDICTED: phytochrome E isoform X2 [Solanum lycopersicum]
Length=1137

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 10/137 (7%)
 Frame = +1

Query  82   SSSATSNL--NTGKA-IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            +SSA SN+  N  KA +AQYNADAKLMAEFEQS  SGKSFDYS+SV+  P    EEE+T+
Sbjct  33   TSSAASNMKNNASKAALAQYNADAKLMAEFEQSSVSGKSFDYSKSVLFPPHEANEEEITS  92

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMS--LIGIDAR  426
            YLSRIQRGGL+QPFGCM+AIEEP+FKI+G+SENC+D+LG K     P +M   LIG+DAR
Sbjct  93   YLSRIQRGGLVQPFGCMVAIEEPTFKIIGYSENCYDMLGFK-----PTKMKLGLIGVDAR  147

Query  427  TLFTLSSRASLAKAVAS  477
             LFT SS  SLAK +AS
Sbjct  148  NLFTPSSGDSLAKVMAS  164



>gb|AAF25812.1|AF178571_1 phytochrome E [Solanum lycopersicum]
Length=1137

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 10/137 (7%)
 Frame = +1

Query  82   SSSATSNL--NTGKA-IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            +SSA SN+  N  KA +AQYNADAKLMAEFEQS  SGKSFDYS+SV+  P    EEE+T+
Sbjct  33   TSSAASNMKNNASKAALAQYNADAKLMAEFEQSSVSGKSFDYSKSVLFPPHEANEEEITS  92

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMS--LIGIDAR  426
            YLSRIQRGGL+QPFGCM+AIEEP+FKI+G+SENC+D+LG K     P +M   LIG+DAR
Sbjct  93   YLSRIQRGGLVQPFGCMVAIEEPTFKIIGYSENCYDMLGFK-----PTKMKLGLIGVDAR  147

Query  427  TLFTLSSRASLAKAVAS  477
             LFT SS  SLAK +AS
Sbjct  148  NLFTPSSGDSLAKVMAS  164



>ref|XP_010316899.1| PREDICTED: phytochrome E isoform X1 [Solanum lycopersicum]
Length=1138

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 10/137 (7%)
 Frame = +1

Query  82   SSSATSNL--NTGKA-IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            +SSA SN+  N  KA +AQYNADAKLMAEFEQS  SGKSFDYS+SV+  P    EEE+T+
Sbjct  33   TSSAASNMKNNASKAALAQYNADAKLMAEFEQSSVSGKSFDYSKSVLFPPHEANEEEITS  92

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMS--LIGIDAR  426
            YLSRIQRGGL+QPFGCM+AIEEP+FKI+G+SENC+D+LG K     P +M   LIG+DAR
Sbjct  93   YLSRIQRGGLVQPFGCMVAIEEPTFKIIGYSENCYDMLGFK-----PTKMKLGLIGVDAR  147

Query  427  TLFTLSSRASLAKAVAS  477
             LFT SS  SLAK +AS
Sbjct  148  NLFTPSSGDSLAKVMAS  164



>ref|XP_007138489.1| hypothetical protein PHAVU_009G213400g [Phaseolus vulgaris]
 gb|ESW10483.1| hypothetical protein PHAVU_009G213400g [Phaseolus vulgaris]
Length=806

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +1

Query  67   KAVTFSSSATSNLNT--GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            K  + S+SA SN+N+   K +AQY+ADA+++AEFEQS  SGKSFDYSR V+  P+ V+ E
Sbjct  10   KDTSLSTSAESNMNSKRDKTLAQYSADAEILAEFEQSGVSGKSFDYSRMVLDPPRLVSGE  69

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGID  420
            +MTAYLS+IQRGGLIQPFGCMLAIEE +F+I+G+SENCF LLGL+  ++  + + LIG++
Sbjct  70   KMTAYLSKIQRGGLIQPFGCMLAIEEATFRIIGYSENCFQLLGLERQIDSKQFIDLIGVN  129

Query  421  ARTLFTLSSRASLAKAVAS  477
            A TLFT  S ASLAKAVAS
Sbjct  130  ATTLFTPPSGASLAKAVAS  148



>gb|KJB69756.1| hypothetical protein B456_011G040900 [Gossypium raimondii]
 gb|KJB69757.1| hypothetical protein B456_011G040900 [Gossypium raimondii]
 gb|KJB69758.1| hypothetical protein B456_011G040900 [Gossypium raimondii]
Length=1127

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 106/128 (83%), Gaps = 2/128 (2%)
 Frame = +1

Query  100  NLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGG  279
            +++ GK IAQYNADA LMAEFEQS  SGKSF+YS+SV++AP +V EE++TAYLSRIQRGG
Sbjct  31   SMDKGKLIAQYNADAGLMAEFEQSGVSGKSFNYSKSVLYAPHSVPEEQITAYLSRIQRGG  90

Query  280  LIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPER--MSLIGIDARTLFTLSSRA  453
            L+QPFGCM+A+EEPSF+I+G+SENCF LLGL    E   +   SLIGID ++LFT +S A
Sbjct  91   LVQPFGCMIAVEEPSFRIIGYSENCFGLLGLDLDSEDEIKGVKSLIGIDVKSLFTPASGA  150

Query  454  SLAKAVAS  477
            SLAKA AS
Sbjct  151  SLAKAAAS  158



>ref|XP_007138490.1| hypothetical protein PHAVU_009G213400g [Phaseolus vulgaris]
 gb|ESW10484.1| hypothetical protein PHAVU_009G213400g [Phaseolus vulgaris]
Length=1121

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +1

Query  67   KAVTFSSSATSNLNT--GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            K  + S+SA SN+N+   K +AQY+ADA+++AEFEQS  SGKSFDYSR V+  P+ V+ E
Sbjct  10   KDTSLSTSAESNMNSKRDKTLAQYSADAEILAEFEQSGVSGKSFDYSRMVLDPPRLVSGE  69

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGID  420
            +MTAYLS+IQRGGLIQPFGCMLAIEE +F+I+G+SENCF LLGL+  ++  + + LIG++
Sbjct  70   KMTAYLSKIQRGGLIQPFGCMLAIEEATFRIIGYSENCFQLLGLERQIDSKQFIDLIGVN  129

Query  421  ARTLFTLSSRASLAKAVAS  477
            A TLFT  S ASLAKAVAS
Sbjct  130  ATTLFTPPSGASLAKAVAS  148



>ref|XP_008225375.1| PREDICTED: phytochrome E isoform X2 [Prunus mume]
Length=1135

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 112/147 (76%), Gaps = 13/147 (9%)
 Frame = +1

Query  76   TFSSSATSNL-----NT--------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIH  216
            TFSSSATSN+     NT         K+IA+YNADA ++AE+EQS  SGKSF+YSRSV++
Sbjct  12   TFSSSATSNMRPNKNNTTTSGTAKRDKSIARYNADAGILAEYEQSTASGKSFNYSRSVLY  71

Query  217  APQNVTEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPE  396
             P++V EE+++ Y  RIQRG L+Q FGCMLAIEEP+F+I+G+SENCF+LLGL S  E  +
Sbjct  72   PPESVPEEQISVYFKRIQRGALVQSFGCMLAIEEPTFRIIGYSENCFELLGLDSLFESKQ  131

Query  397  RMSLIGIDARTLFTLSSRASLAKAVAS  477
               LIGID+RTLFT SS ASLAKA AS
Sbjct  132  LKGLIGIDSRTLFTPSSGASLAKAAAS  158



>ref|XP_008225374.1| PREDICTED: phytochrome E isoform X1 [Prunus mume]
Length=1136

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 112/147 (76%), Gaps = 13/147 (9%)
 Frame = +1

Query  76   TFSSSATSNL-----NT--------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIH  216
            TFSSSATSN+     NT         K+IA+YNADA ++AE+EQS  SGKSF+YSRSV++
Sbjct  12   TFSSSATSNMRPNKNNTTTSGTAKRDKSIARYNADAGILAEYEQSTASGKSFNYSRSVLY  71

Query  217  APQNVTEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPE  396
             P++V EE+++ Y  RIQRG L+Q FGCMLAIEEP+F+I+G+SENCF+LLGL S  E  +
Sbjct  72   PPESVPEEQISVYFKRIQRGALVQSFGCMLAIEEPTFRIIGYSENCFELLGLDSLFESKQ  131

Query  397  RMSLIGIDARTLFTLSSRASLAKAVAS  477
               LIGID+RTLFT SS ASLAKA AS
Sbjct  132  LKGLIGIDSRTLFTPSSGASLAKAAAS  158



>gb|KDP21198.1| hypothetical protein JCGZ_21669 [Jatropha curcas]
Length=1126

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 105/143 (73%), Gaps = 9/143 (6%)
 Frame = +1

Query  76   TFSSSATSN-------LNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT  234
            T SSSA SN         +   IAQY+ADA L+AEFEQS  SGKSF+YSRSVI AP  V 
Sbjct  13   TLSSSAASNKRPFAATTKSKTTIAQYSADAGLLAEFEQSGVSGKSFNYSRSVISAPHTVP  72

Query  235  EEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGL--KSGVEPPERMSL  408
            EE++TAYLSRIQRGGLIQPFGCM+AIEEP+FKI+ FSENCF LLGL   S +E  +   L
Sbjct  73   EEQITAYLSRIQRGGLIQPFGCMVAIEEPTFKIISFSENCFQLLGLCSNSDLESKQVKDL  132

Query  409  IGIDARTLFTLSSRASLAKAVAS  477
            IG DARTLFT  S ASL KA AS
Sbjct  133  IGTDARTLFTPQSGASLTKAAAS  155



>gb|KHG11315.1| Phytochrome E [Gossypium arboreum]
Length=1127

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 2/128 (2%)
 Frame = +1

Query  100  NLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGG  279
            +++ GK IAQYNADA LMAEFEQS  SGKSF+YS+SV++AP +V EE++TAYLSRIQRGG
Sbjct  31   SMDKGKLIAQYNADAGLMAEFEQSGVSGKSFNYSKSVLYAPHSVPEEQITAYLSRIQRGG  90

Query  280  LIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPER--MSLIGIDARTLFTLSSRA  453
            L+QPFGCM+A+EEPSF+I+G+SENCF LLGL    E   +    LIGID ++LFT +S A
Sbjct  91   LVQPFGCMIAVEEPSFRIIGYSENCFGLLGLDLDSEDEIKGVKGLIGIDVKSLFTPASGA  150

Query  454  SLAKAVAS  477
            SLAKA AS
Sbjct  151  SLAKAAAS  158



>ref|XP_010052114.1| PREDICTED: phytochrome E isoform X2 [Eucalyptus grandis]
Length=1105

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            N  K IA YNADA LMAEFEQS  SGKSFDY++SV+  PQ V EE++TAYLSRIQRGGL 
Sbjct  6    NRDKTIAHYNADAMLMAEFEQSSVSGKSFDYTKSVMGVPQVVPEEKITAYLSRIQRGGLT  65

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMS---LIGIDARTLFTLSSRAS  456
            QPFGCMLA+EEP F+I+G+SENCF+LLG++   E  E  S   LIG+DARTLFT SS AS
Sbjct  66   QPFGCMLAVEEPGFRIIGYSENCFELLGIRLESEFLESRSEKGLIGVDARTLFTPSSGAS  125

Query  457  LAKAVAS  477
            LAKA AS
Sbjct  126  LAKAAAS  132



>ref|XP_010052113.1| PREDICTED: phytochrome E isoform X1 [Eucalyptus grandis]
 gb|KCW75976.1| hypothetical protein EUGRSUZ_D00342 [Eucalyptus grandis]
Length=1106

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            N  K IA YNADA LMAEFEQS  SGKSFDY++SV+  PQ V EE++TAYLSRIQRGGL 
Sbjct  6    NRDKTIAHYNADAMLMAEFEQSSVSGKSFDYTKSVMGVPQVVPEEKITAYLSRIQRGGLT  65

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMS---LIGIDARTLFTLSSRAS  456
            QPFGCMLA+EEP F+I+G+SENCF+LLG++   E  E  S   LIG+DARTLFT SS AS
Sbjct  66   QPFGCMLAVEEPGFRIIGYSENCFELLGIRLESEFLESRSEKGLIGVDARTLFTPSSGAS  125

Query  457  LAKAVAS  477
            LAKA AS
Sbjct  126  LAKAAAS  132



>gb|ACC60972.1| phytochrome E [Vitis riparia]
Length=1124

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 109/138 (79%), Gaps = 4/138 (3%)
 Frame = +1

Query  76   TFSSSATSNLNTGK----AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            TFSSSA SN+N        IAQYNADA+L+AEFEQS ESGKSF+YSRSV++AP++V E++
Sbjct  18   TFSSSAASNMNNPNSRNNTIAQYNADARLLAEFEQSGESGKSFNYSRSVMNAPESVPEDQ  77

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDA  423
            + AYLSRIQRGGL+QPFGCMLAIEEP+F+I+ +SEN  D LGL +  E  +  SLIG+D 
Sbjct  78   IIAYLSRIQRGGLVQPFGCMLAIEEPTFRIISYSENSMDFLGLNTLSETTQLKSLIGVDV  137

Query  424  RTLFTLSSRASLAKAVAS  477
            RTLFT  S ASLAKA  S
Sbjct  138  RTLFTPPSSASLAKAAMS  155



>ref|XP_006467545.1| PREDICTED: phytochrome E-like isoform X5 [Citrus sinensis]
Length=914

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+I+G+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIIGYSENCLEMLDLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>ref|XP_006449616.1| hypothetical protein CICLE_v10014092mg [Citrus clementina]
 gb|ESR62856.1| hypothetical protein CICLE_v10014092mg [Citrus clementina]
Length=1130

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+IVG+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIVGYSENCLEMLNLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>gb|KDO78036.1| hypothetical protein CISIN_1g001210mg [Citrus sinensis]
Length=955

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+I+G+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIIGYSENCLEMLDLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>gb|KDO78035.1| hypothetical protein CISIN_1g001210mg [Citrus sinensis]
Length=959

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+I+G+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIIGYSENCLEMLDLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>ref|XP_006467544.1| PREDICTED: phytochrome E-like isoform X4 [Citrus sinensis]
Length=959

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+I+G+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIIGYSENCLEMLDLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>ref|XP_006467543.1| PREDICTED: phytochrome E-like isoform X3 [Citrus sinensis]
Length=1078

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+I+G+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIIGYSENCLEMLDLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>gb|KDO78033.1| hypothetical protein CISIN_1g001210mg [Citrus sinensis]
Length=1093

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+I+G+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIIGYSENCLEMLDLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>ref|XP_006467542.1| PREDICTED: phytochrome E-like isoform X2 [Citrus sinensis]
Length=1093

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+I+G+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIIGYSENCLEMLDLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>ref|XP_002271671.1| PREDICTED: phytochrome E [Vitis vinifera]
 gb|ACC60968.1| phytochrome E [Vitis vinifera]
Length=1124

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 109/138 (79%), Gaps = 4/138 (3%)
 Frame = +1

Query  76   TFSSSATSNLNTGK----AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            TFSSSA SN+N        IAQYNADA+L+AEFEQS ESGKSF+YSRSV++AP++V E++
Sbjct  18   TFSSSAASNMNNPNSRNNTIAQYNADARLLAEFEQSGESGKSFNYSRSVMNAPESVPEDQ  77

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDA  423
            + AYLSR+QRGGL+QPFGCMLAIEEP+F+I+ +SEN  D LGL +  E  +  SLIG+D 
Sbjct  78   IIAYLSRVQRGGLVQPFGCMLAIEEPTFRIISYSENSMDFLGLNTLSETTQLKSLIGVDV  137

Query  424  RTLFTLSSRASLAKAVAS  477
            RTLFT  S ASLAKA  S
Sbjct  138  RTLFTPPSSASLAKAAMS  155



>gb|KDO78034.1| hypothetical protein CISIN_1g001210mg [Citrus sinensis]
Length=1123

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+I+G+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIIGYSENCLEMLDLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>ref|XP_006467541.1| PREDICTED: phytochrome E-like isoform X1 [Citrus sinensis]
Length=1123

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  82   SSSATSNLNTGKAIA-QYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
            S +    +N GK I   YNADA L+AEFEQS  SGKSF+YSRSVI  P+ V EE++TAYL
Sbjct  25   SDAKMKPVNKGKTIIDHYNADAGLLAEFEQSVASGKSFNYSRSVISPPEGVPEEQITAYL  84

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFT  438
            S+IQRGGLIQPFGCMLA+EEP+F+I+G+SENC ++L L+S  E  E   LIGIDARTLFT
Sbjct  85   SKIQRGGLIQPFGCMLAVEEPTFRIIGYSENCLEMLDLRSRSEDFELNGLIGIDARTLFT  144

Query  439  LSSRASLAKAVAS  477
              S ASLAKA AS
Sbjct  145  PPSGASLAKAAAS  157



>ref|XP_009766581.1| PREDICTED: phytochrome E isoform X1 [Nicotiana sylvestris]
Length=1142

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 102/119 (86%), Gaps = 2/119 (2%)
 Frame = +1

Query  124  AQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQ-NVTEEEMTAYLSRIQRGGLIQPFGC  300
            AQYNADAKLMAEFE S  SGKSF+YSRSV++APQ N  EEE+T+YLSRIQRGGL+QPFGC
Sbjct  51   AQYNADAKLMAEFELSGVSGKSFNYSRSVLYAPQDNANEEEITSYLSRIQRGGLVQPFGC  110

Query  301  MLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTLSSRASLAKAVAS  477
            +LAIEE +FKI+G+SENCFD+LG K   E  + ++LIG+DARTLFT SS ASLAKA+ S
Sbjct  111  VLAIEEHTFKIIGYSENCFDMLGFKIA-ESSKLITLIGVDARTLFTPSSGASLAKAMTS  168



>ref|XP_009766582.1| PREDICTED: phytochrome E isoform X2 [Nicotiana sylvestris]
Length=1141

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 102/119 (86%), Gaps = 2/119 (2%)
 Frame = +1

Query  124  AQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQ-NVTEEEMTAYLSRIQRGGLIQPFGC  300
            AQYNADAKLMAEFE S  SGKSF+YSRSV++APQ N  EEE+T+YLSRIQRGGL+QPFGC
Sbjct  51   AQYNADAKLMAEFELSGVSGKSFNYSRSVLYAPQDNANEEEITSYLSRIQRGGLVQPFGC  110

Query  301  MLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTLSSRASLAKAVAS  477
            +LAIEE +FKI+G+SENCFD+LG K   E  + ++LIG+DARTLFT SS ASLAKA+ S
Sbjct  111  VLAIEEHTFKIIGYSENCFDMLGFKIA-ESSKLITLIGVDARTLFTPSSGASLAKAMTS  168



>dbj|BAI63255.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLG--LKSGVEPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF LLG  L +  E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFILLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>ref|XP_002519749.1| phytochrome B, putative [Ricinus communis]
 gb|EEF42722.1| phytochrome B, putative [Ricinus communis]
Length=1131

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  91   ATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQ  270
            AT++ NT   IAQYNADA L+AEFEQS  SGKSF+YSRSV+ AP NV EE++TAYLSRIQ
Sbjct  26   ATNSENTA-TIAQYNADAGLLAEFEQSGVSGKSFNYSRSVLSAPHNVPEEQITAYLSRIQ  84

Query  271  RGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGL--KSGVEPPERMSLIGIDARTLFTLS  444
            RGGLIQPFGCM+AIEEP+F+I+ +SENCF LLGL   S +E  +   LIGID R LFT  
Sbjct  85   RGGLIQPFGCMVAIEEPTFRIISYSENCFHLLGLSASSVLESNQVKGLIGIDVRALFTPQ  144

Query  445  SRASLAKAVAS  477
            S ASL+KA AS
Sbjct  145  SGASLSKAAAS  155



>dbj|BAJ15835.1| putative phytochrome E, partial [Pieris japonica]
Length=311

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 104/132 (79%), Gaps = 5/132 (4%)
 Frame = +1

Query  97   SNLNTG---KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRI  267
            +NLN     KA+A YNADA L+ EFEQS +SGKSF+YSRSV++AP+ V  E++TAYLSRI
Sbjct  1    NNLNNNRKSKAVALYNADAGLLDEFEQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRI  60

Query  268  QRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTL  441
            QRGGLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ 
Sbjct  61   QRGGLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSP  120

Query  442  SSRASLAKAVAS  477
            SS ASL  AV S
Sbjct  121  SSGASLVNAVGS  132



>dbj|BAJ15831.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15820.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15809.1| putative phytochrome E, partial [Pieris nana]
 dbj|BAJ15812.1| putative phytochrome E, partial [Pieris nana]
 dbj|BAJ15813.1| putative phytochrome E, partial [Pieris nana]
 dbj|BAJ15819.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15811.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15836.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>ref|XP_003546574.1| PREDICTED: phytochrome E-like [Glycine max]
Length=1121

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +1

Query  67   KAVTFSSSATSNLNT--GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            K  + S+SA SN NT   K +AQY+ADA+++AEFE S  SGKSFDYSR V+   + V+E+
Sbjct  10   KDTSLSTSAESNTNTKRDKILAQYSADAEILAEFELSGVSGKSFDYSRMVLDPSRLVSEQ  69

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGID  420
            +MTAYLS+IQRGGLIQPFGCMLAIEE +F+I+G+S+NCF LLGL+  ++  + M+LIG+D
Sbjct  70   KMTAYLSKIQRGGLIQPFGCMLAIEESTFRIIGYSDNCFQLLGLERQIDSKQFMNLIGVD  129

Query  421  ARTLFTLSSRASLAKAVAS  477
            A TLFT  S ASLAKA AS
Sbjct  130  ATTLFTPPSGASLAKAAAS  148



>emb|CAN62723.1| hypothetical protein VITISV_030984 [Vitis vinifera]
Length=1162

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 108/138 (78%), Gaps = 4/138 (3%)
 Frame = +1

Query  76   TFSSSATSNLNTGK----AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            TFSSSA SN+N        IAQYNADA+L+AEFEQS ESGKSF+YSRSV++AP++V E++
Sbjct  18   TFSSSAASNMNNPNSRNNTIAQYNADARLLAEFEQSGESGKSFNYSRSVMNAPESVPEDQ  77

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDA  423
            + AYLSR QRGGL+QPFGCMLAIEEP+F+I+ +SEN  D LGL +  E  +  SLIG+D 
Sbjct  78   IIAYLSRXQRGGLVQPFGCMLAIEEPTFRIISYSENSMDFLGLNTLSETTQLKSLIGVDV  137

Query  424  RTLFTLSSRASLAKAVAS  477
            RTLFT  S ASLAKA  S
Sbjct  138  RTLFTPPSSASLAKAAMS  155



>ref|NP_001276186.1| phytochrome E-like [Glycine max]
 gb|AEX08379.1| phytochrome E2 [Glycine max]
Length=1121

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +1

Query  67   KAVTFSSSATSNLNT--GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            K  + S+SA SN NT   K +AQY+ADA+++AEFE S  SGKSFDYSR V+   + V+E+
Sbjct  10   KDTSLSTSAESNTNTKRDKILAQYSADAEILAEFELSGVSGKSFDYSRMVLDPSRLVSEQ  69

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGID  420
            +MTAYLS+IQRGGLIQPFGCMLAIEE +F+I+G+S+NCF LLGL+  ++  + M+LIG+D
Sbjct  70   KMTAYLSKIQRGGLIQPFGCMLAIEESTFRIIGYSDNCFQLLGLERQIDSKQFMNLIGVD  129

Query  421  ARTLFTLSSRASLAKAVAS  477
            A TLFT  S ASLAKA AS
Sbjct  130  ATTLFTPPSGASLAKAAAS  148



>gb|EYU43280.1| hypothetical protein MIMGU_mgv1a000521mg [Erythranthe guttata]
Length=1098

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 4/146 (3%)
 Frame = +1

Query  52   MENYGKAVTFSSS-ATSNLNTGKA-IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQ  225
            M+  GK    SSS A SN+ T    +AQY+ADA+LMAEFE+S  SGK F+YS+SV +APQ
Sbjct  1    MDLQGKQADLSSSTAASNMRTNSTTMAQYSADARLMAEFEKSGASGKLFNYSKSVSYAPQ  60

Query  226  NV-TEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPER-  399
            +  T+E+MTAYLSRIQRGGL+QPFGCMLAI EP+F I+G+SENCFD+LGLK  +   +  
Sbjct  61   SASTQEQMTAYLSRIQRGGLVQPFGCMLAIGEPNFNIIGYSENCFDMLGLKDLLHSKQSI  120

Query  400  MSLIGIDARTLFTLSSRASLAKAVAS  477
            M L+G+D+RTLFT SS  SL KAV S
Sbjct  121  MGLMGVDSRTLFTPSSSTSLMKAVGS  146



>gb|KHN41345.1| Phytochrome E [Glycine soja]
Length=1099

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +1

Query  100  NLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGG  279
            N    K +AQY+ADA+++AEFEQS  SGKSFDYSR V+  P+ V+E++MTAYLS+IQRGG
Sbjct  2    NSKRDKILAQYSADAEILAEFEQSGVSGKSFDYSRMVLDPPRLVSEQKMTAYLSKIQRGG  61

Query  280  LIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTLSSRASL  459
            LIQPFGCMLAIEE +F+I+GFS+NCF LLGL+  ++  + M LIG+DA TLFT  S ASL
Sbjct  62   LIQPFGCMLAIEESTFRIIGFSDNCFQLLGLERQIDSKQFMGLIGVDATTLFTPPSGASL  121

Query  460  AKAVAS  477
            AKA AS
Sbjct  122  AKAAAS  127



>ref|XP_010247418.1| PREDICTED: phytochrome E-like [Nelumbo nucifera]
Length=1045

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 106/141 (75%), Gaps = 7/141 (5%)
 Frame = +1

Query  76   TFSSSATSNL-------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT  234
            T SSSA SN+       N  KAIAQYNADA L+AEFEQS ESGK FDY++SV   P +V 
Sbjct  13   THSSSAASNMRPNNSSSNKNKAIAQYNADASLLAEFEQSGESGKYFDYTKSVKSTPDSVP  72

Query  235  EEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIG  414
            EE +TAYLS+IQRGGL Q FGCMLAIEEPSF+I+ +SEN  D+LGL   ++  +  SL+G
Sbjct  73   EEHITAYLSKIQRGGLTQLFGCMLAIEEPSFRIIAYSENTIDMLGLSGLLDSKQLKSLLG  132

Query  415  IDARTLFTLSSRASLAKAVAS  477
            +DAR+LFT +S ASLAKA A+
Sbjct  133  VDARSLFTPASGASLAKAAAT  153



>dbj|BAJ15817.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCML IEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLTIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15815.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15818.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15830.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLEEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15822.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15814.1| putative phytochrome E, partial [Pieris nana]
 dbj|BAJ15816.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15823.1| putative phytochrome E, partial [Pieris nana]
 dbj|BAJ15825.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15829.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15810.1| putative phytochrome E, partial [Pieris nana]
 dbj|BAJ15824.1| putative phytochrome E, partial [Pieris nana]
 dbj|BAJ15832.1| putative phytochrome E, partial [Pieris nana]
 dbj|BAJ15833.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15826.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEP+FKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPNFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15828.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGID RTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDVRTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15821.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRS+++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSLVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAJ15827.1| putative phytochrome E, partial [Pieris nana]
Length=311

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGID RTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDVRTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63235.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63237.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63234.1| phytochrome E, partial [Pieris nana]
 dbj|BAI63232.1| phytochrome E, partial [Pieris nana]
 dbj|BAI63231.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63233.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63245.1| phytochrome E, partial [Pieris nana]
 dbj|BAI63230.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+LSS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSLSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>ref|XP_004488315.1| PREDICTED: phytochrome E-like isoform X3 [Cicer arietinum]
Length=959

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +1

Query  82   SSSATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLS  261
            S   T N N    +AQY ADA+++AEFEQS  SGKSFDYS+ ++  P+ V+EE++TAYLS
Sbjct  20   SKMKTINNNDNNKLAQYTADAEILAEFEQSGVSGKSFDYSKQLLDPPRLVSEEKITAYLS  79

Query  262  RIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTL  441
            ++QRGGLIQPFGCM+ IEEPSF+I+G+SENCF LLGL   +   + + L+ +DA TLFT 
Sbjct  80   KLQRGGLIQPFGCMVVIEEPSFRIIGYSENCFQLLGLNIEIGSEQFLGLLDVDATTLFTP  139

Query  442  SSRASLAKAVAS  477
            SS ASL KAV+S
Sbjct  140  SSGASLIKAVSS  151



>dbj|BAI63244.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63258.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63236.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63241.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63239.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63249.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63240.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63253.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAN14712.1| phytochrome E, partial [Lotus japonicus]
Length=943

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 7/138 (5%)
 Frame = +1

Query  85   SSATSNLNTG------KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEM  246
            SS TSN+NT       KA+AQ++ADA+ +AEFEQS  S KSFDYS++V+ +P+ V+EE+M
Sbjct  12   SSFTSNMNTATTSNKDKALAQFSADAENLAEFEQSGASDKSFDYSKTVLDSPRLVSEEKM  71

Query  247  TAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPER-MSLIGIDA  423
            TAYLS+IQRGGLIQ FGCMLAI E +F I+G+SENCF LLGL+  ++  ++ + LIG+DA
Sbjct  72   TAYLSKIQRGGLIQSFGCMLAIAESTFTIIGYSENCFQLLGLERHIDSKQQLLGLIGVDA  131

Query  424  RTLFTLSSRASLAKAVAS  477
             TLFT  S ASLAKAV+S
Sbjct  132  TTLFTPPSGASLAKAVSS  149



>dbj|BAN14708.1| phytochrome E, partial [Lotus japonicus]
Length=943

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 7/138 (5%)
 Frame = +1

Query  85   SSATSNLNTG------KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEM  246
            SS TSN+NT       KA+AQ++ADA+ +AEFEQS  S KSFDYS++V+ +P+ V+EE+M
Sbjct  12   SSFTSNMNTATTSNKDKALAQFSADAENLAEFEQSGASDKSFDYSKTVLDSPRLVSEEKM  71

Query  247  TAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPER-MSLIGIDA  423
            TAYLS+IQRGGLIQ FGCMLAI E +F I+G+SENCF LLGL+  ++  ++ + LIG+DA
Sbjct  72   TAYLSKIQRGGLIQSFGCMLAIAESTFTIIGYSENCFQLLGLERHIDSKQQLLGLIGVDA  131

Query  424  RTLFTLSSRASLAKAVAS  477
             TLFT  S ASLAKAV+S
Sbjct  132  TTLFTPPSGASLAKAVSS  149



>dbj|BAI63257.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63256.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63247.1| phytochrome E, partial [Pieris nana]
 dbj|BAI63238.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63252.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLEEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAN14706.1| phytochrome E, partial [Lotus japonicus]
 dbj|BAN14707.1| phytochrome E, partial [Lotus japonicus]
Length=943

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 7/138 (5%)
 Frame = +1

Query  85   SSATSNLNTG------KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEM  246
            SS TSN+NT       KA+AQ++ADA+ +AEFEQS  S KSFDYS++V+ +P+ V+EE+M
Sbjct  12   SSFTSNMNTATTSNKDKALAQFSADAENLAEFEQSGASDKSFDYSKTVLDSPRLVSEEKM  71

Query  247  TAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPER-MSLIGIDA  423
            TAYLS+IQRGGLIQ FGCMLAI E +F I+G+SENCF LLGL+  ++  ++ + LIG+DA
Sbjct  72   TAYLSKIQRGGLIQSFGCMLAIAESTFTIIGYSENCFQLLGLERHIDSKQQLLGLIGVDA  131

Query  424  RTLFTLSSRASLAKAVAS  477
             TLFT  S ASLAKAV+S
Sbjct  132  TTLFTPPSGASLAKAVSS  149



>dbj|BAI63250.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLEEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAN14709.1| phytochrome E, partial [Lotus japonicus]
 dbj|BAN14710.1| phytochrome E, partial [Lotus japonicus]
 dbj|BAN14711.1| phytochrome E, partial [Lotus japonicus]
Length=943

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 7/138 (5%)
 Frame = +1

Query  85   SSATSNLNTG------KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEM  246
            SS TSN+NT       KA+AQ++ADA+ +AEFEQS  S KSFDYS++V+ +P+ V+EE+M
Sbjct  12   SSFTSNMNTATTSNKDKALAQFSADAENLAEFEQSGASDKSFDYSKTVLDSPRLVSEEKM  71

Query  247  TAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPER-MSLIGIDA  423
            TAYLS+IQRGGLIQ FGCMLAI E +F I+G+SENCF LLGL+  ++  ++ + LIG+DA
Sbjct  72   TAYLSKIQRGGLIQSFGCMLAIAESTFTIIGYSENCFQLLGLERHIDSKQQLLGLIGVDA  131

Query  424  RTLFTLSSRASLAKAVAS  477
             TLFT  S ASLAKAV+S
Sbjct  132  TTLFTPPSGASLAKAVSS  149



>dbj|BAI63259.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63243.1| phytochrome E, partial [Pieris nana]
 dbj|BAI63254.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAN14729.1| phytochrome E, partial [Lotus japonicus]
Length=943

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 7/138 (5%)
 Frame = +1

Query  85   SSATSNLNTG------KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEM  246
            SS TSN+NT       KA+AQ++ADA+ +AEFEQS  S KSFDYS++V+ +P+ V+EE+M
Sbjct  12   SSFTSNMNTATTSNKDKALAQFSADAENLAEFEQSGASDKSFDYSKTVLDSPRLVSEEKM  71

Query  247  TAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPER-MSLIGIDA  423
            TAYLS+IQRGGLIQ FGCMLAI E +F I+G+SENCF LLGL+  ++  ++ + LIG+DA
Sbjct  72   TAYLSKIQRGGLIQSFGCMLAIAESTFTIIGYSENCFQLLGLERHIDSKQQLLGLIGVDA  131

Query  424  RTLFTLSSRASLAKAVAS  477
             TLFT  S ASLAKAV+S
Sbjct  132  TTLFTPPSGASLAKAVSS  149



>ref|XP_004488314.1| PREDICTED: phytochrome E-like isoform X2 [Cicer arietinum]
Length=1138

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +1

Query  82   SSSATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLS  261
            S   T N N    +AQY ADA+++AEFEQS  SGKSFDYS+ ++  P+ V+EE++TAYLS
Sbjct  20   SKMKTINNNDNNKLAQYTADAEILAEFEQSGVSGKSFDYSKQLLDPPRLVSEEKITAYLS  79

Query  262  RIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTL  441
            ++QRGGLIQPFGCM+ IEEPSF+I+G+SENCF LLGL   +   + + L+ +DA TLFT 
Sbjct  80   KLQRGGLIQPFGCMVVIEEPSFRIIGYSENCFQLLGLNIEIGSEQFLGLLDVDATTLFTP  139

Query  442  SSRASLAKAVAS  477
            SS ASL KAV+S
Sbjct  140  SSGASLIKAVSS  151



>ref|XP_004488313.1| PREDICTED: phytochrome E-like isoform X1 [Cicer arietinum]
Length=1139

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +1

Query  82   SSSATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLS  261
            S   T N N    +AQY ADA+++AEFEQS  SGKSFDYS+ ++  P+ V+EE++TAYLS
Sbjct  20   SKMKTINNNDNNKLAQYTADAEILAEFEQSGVSGKSFDYSKQLLDPPRLVSEEKITAYLS  79

Query  262  RIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTL  441
            ++QRGGLIQPFGCM+ IEEPSF+I+G+SENCF LLGL   +   + + L+ +DA TLFT 
Sbjct  80   KLQRGGLIQPFGCMVVIEEPSFRIIGYSENCFQLLGLNIEIGSEQFLGLLDVDATTLFTP  139

Query  442  SSRASLAKAVAS  477
            SS ASL KAV+S
Sbjct  140  SSGASLIKAVSS  151



>ref|XP_010100997.1| Phytochrome E [Morus notabilis]
 gb|EXB86588.1| Phytochrome E [Morus notabilis]
Length=1123

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 6/132 (5%)
 Frame = +1

Query  82   SSSATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLS  261
            +++ T N   GK IA+YNADA ++AEFEQS  SGKSF+YSRSV++A Q+V  +++TAYLS
Sbjct  25   TNAITDNDQKGKEIARYNADAGILAEFEQSGVSGKSFNYSRSVLNASQSVPGKQITAYLS  84

Query  262  RIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIGIDARTLFTL  441
            RIQRGGL+QPFGCM+AIE+PSF+I+ +SENCF +LG           SL+GIDARTLFT 
Sbjct  85   RIQRGGLVQPFGCMIAIEQPSFRIISYSENCFGILGFNG------EGSLLGIDARTLFTP  138

Query  442  SSRASLAKAVAS  477
             S ASL KA AS
Sbjct  139  PSGASLTKAAAS  150



>ref|XP_003595571.1| Phytochrome E [Medicago truncatula]
 gb|ABD33241.1| Bacteriophytochrome [Medicago truncatula]
 gb|AES65822.1| phytochrome protein [Medicago truncatula]
Length=1122

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 103/141 (73%), Gaps = 7/141 (5%)
 Frame = +1

Query  67   KAVTFSSSATSNLNTGK----AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT  234
            K V+ SSSA S +NT K     +AQY  DA+L+AEFEQSR  GKSF+YS++++  P+ V+
Sbjct  10   KGVSLSSSAESKMNTNKETEKTLAQYGVDAELLAEFEQSRVYGKSFEYSKTILDPPRLVS  69

Query  235  EEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLIG  414
            EE+M  YLSRIQRGG IQPFGC++ IEE +F+I+G+SENCF LLG    +     M LIG
Sbjct  70   EEKMITYLSRIQRGGFIQPFGCLVVIEESTFRIIGYSENCFQLLG---DIGSEHFMGLIG  126

Query  415  IDARTLFTLSSRASLAKAVAS  477
            +DA TLFT  S +SL KAVAS
Sbjct  127  VDATTLFTPPSGSSLVKAVAS  147



>dbj|BAI63242.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 101/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEP+FKI+G+SENCF+LLGL      E  +   LIGIDARTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPNFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDARTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63248.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGID RTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDVRTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63251.1| phytochrome E, partial [Pieris nana]
 dbj|BAI63260.1| phytochrome E, partial [Pieris japonica]
Length=657

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGID RTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDVRTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>dbj|BAI63246.1| phytochrome E, partial [Pieris nana]
Length=657

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  97   SNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRG  276
            +N    KA+A YNADA L+ EF+QS +SGKSF+YSRSV++AP+ V  E++TAYLSRIQRG
Sbjct  4    NNNRKSKAVALYNADAGLLDEFDQSADSGKSFNYSRSVVNAPKTVPAEQITAYLSRIQRG  63

Query  277  GLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSR  450
            GLIQPFGCMLAIEEPSFKI+G+SENCF+LLGL      E  +   LIGID RTLF+ SS 
Sbjct  64   GLIQPFGCMLAIEEPSFKIIGYSENCFNLLGLNLNNVFESNQERGLIGIDVRTLFSPSSG  123

Query  451  ASLAKAVAS  477
             SL  AV S
Sbjct  124  VSLVNAVGS  132



>ref|XP_008371559.1| PREDICTED: phytochrome E-like [Malus domestica]
Length=1130

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            K+IA Y  DA L+AE+EQS  SGKSF+Y+RSV+  P +V EE+ +AYLSRIQRG L+Q F
Sbjct  35   KSIAHYREDANLLAEYEQSAVSGKSFNYTRSVLFPPDSVPEEQXSAYLSRIQRGSLVQSF  94

Query  295  GCMLAIEEPSFKIVGFSENCFDLLG---LKSGVEPPERMSLIGIDARTLFTLSSRASLAK  465
            GCMLAIEEP+F+I+GFSENC +LLG   L S  E  E M LIG+D RTLFT  S ASL K
Sbjct  95   GCMLAIEEPTFRIIGFSENCHELLGLDKLDSVFESNELMGLIGVDCRTLFTPPSAASLTK  154

Query  466  AVAS  477
            A AS
Sbjct  155  AAAS  158



>gb|KGN65574.1| hypothetical protein Csa_1G461000 [Cucumis sativus]
Length=1085

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 102/147 (69%), Gaps = 14/147 (10%)
 Frame = +1

Query  79   FSSSATSNL------------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAP  222
            FSSSA SN             N   A+ QYNADA L+ +FE S  SG+SF+YSRSV+ AP
Sbjct  15   FSSSADSNTRAPPPPTTTSTDNRLAALVQYNADAGLLNKFELSDASGESFNYSRSVLEAP  74

Query  223  QNVTEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPE  396
             +V EE++TAYLS+IQRGGL+QPFGC+LAIEE SFKI+ FSENCF+LLGL          
Sbjct  75   VSVPEEQITAYLSKIQRGGLVQPFGCLLAIEESSFKIISFSENCFELLGLNDDQFGSAQG  134

Query  397  RMSLIGIDARTLFTLSSRASLAKAVAS  477
            +  LIG+D R LFT SS ASLAKA +S
Sbjct  135  KKGLIGVDMRALFTPSSGASLAKAASS  161



>ref|XP_004147430.1| PREDICTED: phytochrome E-like [Cucumis sativus]
Length=1134

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 102/147 (69%), Gaps = 14/147 (10%)
 Frame = +1

Query  79   FSSSATSNL------------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAP  222
            FSSSA SN             N   A+ QYNADA L+ +FE S  SG+SF+YSRSV+ AP
Sbjct  15   FSSSADSNTRAPPPPTTTSTDNRLAALVQYNADAGLLNKFELSDASGESFNYSRSVLEAP  74

Query  223  QNVTEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPE  396
             +V EE++TAYLS+IQRGGL+QPFGC+LAIEE SFKI+ FSENCF+LLGL          
Sbjct  75   VSVPEEQITAYLSKIQRGGLVQPFGCLLAIEESSFKIISFSENCFELLGLNDDQFGSAQG  134

Query  397  RMSLIGIDARTLFTLSSRASLAKAVAS  477
            +  LIG+D R LFT SS ASLAKA +S
Sbjct  135  KKGLIGVDMRALFTPSSGASLAKAASS  161



>ref|XP_009352111.1| PREDICTED: phytochrome E-like [Pyrus x bretschneideri]
Length=1130

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            K+IA Y  DA L+AE+EQS  SGKSF+Y+RSV+  P +V EE+++AYLSRIQRG L+Q F
Sbjct  35   KSIAHYREDANLLAEYEQSAVSGKSFNYTRSVLFPPDSVPEEQISAYLSRIQRGSLVQSF  94

Query  295  GCMLAIEEPSFKIVGFSENCFDLLG---LKSGVEPPERMSLIGIDARTLFTLSSRASLAK  465
            GCMLA+EEP+F+I+GFSENC++LLG   L S  +  E   LIG+D RTLFT  S ASL K
Sbjct  95   GCMLAVEEPTFRILGFSENCYELLGLDKLDSVFQSNELKGLIGVDCRTLFTPPSAASLTK  154

Query  466  AVAS  477
            A AS
Sbjct  155  AAAS  158



>emb|CDY61670.1| BnaC01g40810D [Brassica napus]
Length=1116

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 13/141 (9%)
 Frame = +1

Query  82   SSSATSNL------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            SSSA SN+      NT +   QY+ DA L+A+F+ S  SGKSF+YS+S+I  P NV +E 
Sbjct  6    SSSAASNMKQPQKSNTAQ---QYSVDAGLLADFDHSVNSGKSFNYSKSMISPPNNVPDER  62

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK--SGVEPPE--RMSLI  411
            +TAYLS IQRGGL+QPFGC++A++EPSF+I+G S+NC D LGL   S  +P E     LI
Sbjct  63   ITAYLSNIQRGGLVQPFGCLIAVQEPSFRILGVSDNCIDFLGLSLASTSQPNEFTVKGLI  122

Query  412  GIDARTLFTLSSRASLAKAVA  474
            GIDAR+LFT SS ASLAKA +
Sbjct  123  GIDARSLFTPSSGASLAKAAS  143



>dbj|BAD94419.1| phytochrome E [Arabidopsis thaliana]
Length=316

 Score =   142 bits (358),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 9/140 (6%)
 Frame = +1

Query  82   SSSATSNLNTGKA---IAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            SSSA SN+         AQY+ DA L A+F QS  +GKSF+YS+SVI  P +V +E +TA
Sbjct  6    SSSAASNMKPQPQKSNTAQYSVDAALFADFAQSIYTGKSFNYSKSVISPPNHVPDEHITA  65

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERMSLIG  414
            YLS IQRGGL+QPFGC++A+EEPSF+I+G S+N  D LGL S        E  +   LIG
Sbjct  66   YLSNIQRGGLVQPFGCLIAVEEPSFRILGLSDNSSDFLGLLSLPSTSHSGEFDKVKGLIG  125

Query  415  IDARTLFTLSSRASLAKAVA  474
            IDARTLFT SS ASL+KA +
Sbjct  126  IDARTLFTPSSGASLSKAAS  145



>ref|XP_008443902.1| PREDICTED: LOW QUALITY PROTEIN: phytochrome E [Cucumis melo]
Length=1132

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +1

Query  118  AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPFG  297
            A+ QYN DA L+ +FE S  SG+SF+YS+SV+ AP +V EE++TAYLS+IQRGGL+QPFG
Sbjct  38   ALVQYNVDAGLLNKFELSDASGESFNYSKSVLEAPVSVPEEQITAYLSKIQRGGLVQPFG  97

Query  298  CMLAIEEPSFKIVGFSENCFDLLGLKSGV--EPPERMSLIGIDARTLFTLSSRASLAKAV  471
            C+LAIEE SFKI+ FSENCF+LLGL          +  LIG+D R L T SS ASLAKA 
Sbjct  98   CLLAIEESSFKIISFSENCFELLGLNDDQFGSAQGKKGLIGVDMRALLTPSSGASLAKAA  157

Query  472  AS  477
            +S
Sbjct  158  SS  159



>ref|XP_011459628.1| PREDICTED: phytochrome E-like isoform X3 [Fragaria vesca subsp. 
vesca]
Length=1010

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            N  + IA  NADA L+ EFEQS  SGKSF+Y+ S I+APQ+V EE +TAY SRIQRG L+
Sbjct  46   NNDQTIAHCNADAGLLNEFEQSTVSGKSFNYTTSTINAPQSVPEERITAYFSRIQRGALV  105

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLK-SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            Q FGCMLA++E +FK++ +SENCF+LLGL  +  E  E  +LIG+DAR LF  SS  SLA
Sbjct  106  QSFGCMLAVDEATFKVICYSENCFELLGLNDTSSELKEVNTLIGVDARALFIPSSGESLA  165

Query  463  KAVAS  477
            +A A+
Sbjct  166  RASAA  170



>ref|XP_009131404.1| PREDICTED: phytochrome E [Brassica rapa]
Length=1114

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 99/142 (70%), Gaps = 14/142 (10%)
 Frame = +1

Query  82   SSSATSNL-------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+       NT +   QY+ DA L A+F+ S  SGKSF+YS+S+I  P NV +E
Sbjct  6    SSSAASNMEQPQQKSNTAQ---QYSVDAGLFADFDHSVYSGKSFNYSKSMISPPNNVPDE  62

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK-SGVEPPERMS---L  408
             +TAYLS IQRGGL+QPFGC++A++EPSF+I+G S+NC D LGL  +    P   +   L
Sbjct  63   HITAYLSTIQRGGLVQPFGCLIAVQEPSFRILGLSDNCIDFLGLSLASTSQPNHFTVKGL  122

Query  409  IGIDARTLFTLSSRASLAKAVA  474
            IGIDAR+LFT SS ASL KA +
Sbjct  123  IGIDARSLFTPSSAASLVKAAS  144



>ref|XP_004288913.2| PREDICTED: phytochrome E-like isoform X1 [Fragaria vesca subsp. 
vesca]
Length=1148

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            N  + IA  NADA L+ EFEQS  SGKSF+Y+ S I+APQ+V EE +TAY SRIQRG L+
Sbjct  46   NNDQTIAHCNADAGLLNEFEQSTVSGKSFNYTTSTINAPQSVPEERITAYFSRIQRGALV  105

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLK-SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            Q FGCMLA++E +FK++ +SENCF+LLGL  +  E  E  +LIG+DAR LF  SS  SLA
Sbjct  106  QSFGCMLAVDEATFKVICYSENCFELLGLNDTSSELKEVNTLIGVDARALFIPSSGESLA  165

Query  463  KAVAS  477
            +A A+
Sbjct  166  RASAA  170



>ref|XP_011459626.1| PREDICTED: phytochrome E-like isoform X2 [Fragaria vesca subsp. 
vesca]
Length=1147

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  85   SSATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSR  264
            ++ T   N  + IA  NADA L+ EFEQS  SGKSF+Y+ S I+APQ+V EE +TAY SR
Sbjct  39   NTTTIAANNDQTIAHCNADAGLLNEFEQSTVSGKSFNYTTSTINAPQSVPEERITAYFSR  98

Query  265  IQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK-SGVEPPERMSLIGIDARTLFTL  441
            IQRG L+Q FGCMLA++E +FK++ +SENCF+LLGL  +  E  E  +LIG+DAR LF  
Sbjct  99   IQRGALVQSFGCMLAVDEATFKVICYSENCFELLGLNDTSSELKEVNTLIGVDARALFIP  158

Query  442  SSRASLAKAVAS  477
            SS  SLA+A A+
Sbjct  159  SSGESLARASAA  170



>ref|XP_010529136.1| PREDICTED: phytochrome E [Tarenaya hassleriana]
Length=1120

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 99/144 (69%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLNT------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            S+SATSN+         + +AQY ADA ++AEF+QS  SGKSFDYS+ +I  P  V++E+
Sbjct  6    SASATSNMKPVGNSRPDRNVAQYTADAGILAEFDQSNSSGKSFDYSKWIISPPLTVSDEQ  65

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGL-------KSGVEPPERM  402
            +TAYLS+IQRGG +QPFGCMLA+EE  F+I+G SENC ++L L        SG E  +  
Sbjct  66   ITAYLSKIQRGGFVQPFGCMLAVEESGFRILGCSENCVEMLDLCVGSSFHGSGFEFKDVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIG DAR LF  SS ASLAKA +
Sbjct  126  GLIGSDARALFEPSSGASLAKAAS  149



>ref|XP_004295419.1| PREDICTED: phytochrome E-like isoform X1 [Fragaria vesca subsp. 
vesca]
Length=1162

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            N  + I   NADA L++EFEQS  SGKSF+Y+RS I+AP +V EE +TAY SRIQRG L+
Sbjct  62   NNDQTIVHCNADAGLLSEFEQSTVSGKSFNYTRSTINAPHSVPEERITAYFSRIQRGALV  121

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLK-SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            Q FGCMLA++E +FK++ +SENCFDLLGL  S     +  +LIG+DAR LF  SS  SLA
Sbjct  122  QSFGCMLAVDEATFKVICYSENCFDLLGLNVSSSTSKQVKTLIGVDARALFIPSSGDSLA  181

Query  463  KA  468
            +A
Sbjct  182  RA  183



>ref|XP_011460392.1| PREDICTED: phytochrome E-like isoform X2 [Fragaria vesca subsp. 
vesca]
Length=1161

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            N  + I   NADA L++EFEQS  SGKSF+Y+RS I+AP +V EE +TAY SRIQRG L+
Sbjct  62   NNDQTIVHCNADAGLLSEFEQSTVSGKSFNYTRSTINAPHSVPEERITAYFSRIQRGALV  121

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLK-SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            Q FGCMLA++E +FK++ +SENCFDLLGL  S     +  +LIG+DAR LF  SS  SLA
Sbjct  122  QSFGCMLAVDEATFKVICYSENCFDLLGLNVSSSTSKQVKTLIGVDARALFIPSSGDSLA  181

Query  463  KA  468
            +A
Sbjct  182  RA  183



>emb|CAK26504.1| putative phytochrome P [Picea abies]
 emb|CAK26505.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26506.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26508.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26509.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26510.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26512.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26513.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26514.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26515.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26516.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26517.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26518.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26519.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26521.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26526.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26527.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26528.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26531.1| putative phytochrome P [Picea abies]
 emb|CAK26532.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26534.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26536.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26538.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26539.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26540.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26541.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26542.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26543.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26544.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26545.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26546.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26547.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26548.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26549.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26551.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26552.1| putative phytochrome P, partial [Picea abies]
Length=264

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (72%), Gaps = 7/127 (6%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            N   A+AQYNADA+L+  FEQS ESGKSFDY+RS+    ++V E+++TAYLSRIQRGG I
Sbjct  2    NKATAMAQYNADARLLQVFEQSGESGKSFDYTRSIKSTTESVPEQQITAYLSRIQRGGRI  61

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP------PERMSLIGIDARTLFTLSS  447
            QPFGC+LA+EE +F+I+ +SEN  ++L L     P      PE ++ IG D RTLFT +S
Sbjct  62   QPFGCVLAVEETTFRIIAYSENAVEMLDLAPQSVPSMEQPQPEVLT-IGTDVRTLFTAAS  120

Query  448  RASLAKA  468
              SL KA
Sbjct  121  AHSLEKA  127



>emb|CAK26507.1| putative phytochrome P [Picea abies]
 emb|CAK26511.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26520.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26522.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26523.1| putative phytochrome P [Picea abies]
 emb|CAK26524.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26525.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26529.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26530.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26533.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26535.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26537.1| putative phytochrome P, partial [Picea abies]
 emb|CAK26550.1| putative phytochrome P [Picea abies]
Length=264

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            N   A+AQYNADA+L+  FEQS ESGKSFDY+RS+    ++V E+++TAYLSRIQRGG I
Sbjct  2    NKATAMAQYNADARLLQVFEQSGESGKSFDYTRSIKSTTESVPEQQITAYLSRIQRGGRI  61

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGL-----KSGVEPPERMSLIGIDARTLFTLSSR  450
            QPFGC+LA+EE +F+I+ +SEN  ++L L      S  +P   +  IG D RTLFT +S 
Sbjct  62   QPFGCVLAVEETTFRIIAYSENAVEMLDLAPQSVPSMEQPQLEVLTIGTDVRTLFTAASA  121

Query  451  ASLAKAVAS  477
             SL KA  +
Sbjct  122  HSLEKAAVA  130



>dbj|BAH47476.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFDNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47481.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47478.1| phytochrome E [Cardamine nipponica]
 dbj|BAH47479.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47477.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47480.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47475.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47473.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47474.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47471.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47472.1| phytochrome E [Cardamine nipponica]
Length=1116

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>dbj|BAH47482.1| phytochrome E [Cardamine resedifolia]
Length=1116

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI    +V++E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAGLFADFDQSVYSGKSFNYSKSVISPHNHVSDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SENC + LGL S        E     
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENCIEFLGLLSLDSTSQCAEFNNVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLF+ SS ASL+KA +
Sbjct  126  GLIGIDARTLFSPSSGASLSKAAS  149



>ref|NP_193547.4| phytochrome E [Arabidopsis thaliana]
 sp|P42498.2|PHYE_ARATH RecName: Full=Phytochrome E [Arabidopsis thaliana]
 gb|AEE84000.1| phytochrome E [Arabidopsis thaliana]
Length=1112

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 9/140 (6%)
 Frame = +1

Query  82   SSSATSNLN---TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            SSSA SN+         AQY+ DA L A+F QS  +GKSF+YS+SVI  P +V +E +TA
Sbjct  6    SSSAASNMKPQPQKSNTAQYSVDAALFADFAQSIYTGKSFNYSKSVISPPNHVPDEHITA  65

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERMSLIG  414
            YLS IQRGGL+QPFGC++A+EEPSF+I+G S+N  D LGL S        E  +   LIG
Sbjct  66   YLSNIQRGGLVQPFGCLIAVEEPSFRILGLSDNSSDFLGLLSLPSTSHSGEFDKVKGLIG  125

Query  415  IDARTLFTLSSRASLAKAVA  474
            IDARTLFT SS ASL+KA +
Sbjct  126  IDARTLFTPSSGASLSKAAS  145



>emb|CAA54075.1| phytochrome E [Arabidopsis thaliana]
 emb|CAB53654.1| phytochrome E [Arabidopsis thaliana]
 emb|CAB78815.1| phytochrome E [Arabidopsis thaliana]
Length=1112

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 9/140 (6%)
 Frame = +1

Query  82   SSSATSNLN---TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            SSSA SN+         AQY+ DA L A+F QS  +GKSF+YS+SVI  P +V +E +TA
Sbjct  6    SSSAASNMKPQPQKSNTAQYSVDAALFADFAQSIYTGKSFNYSKSVISPPNHVPDEHITA  65

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERMSLIG  414
            YLS IQRGGL+QPFGC++A+EEPSF+I+G S+N  D LGL S        E  +   LIG
Sbjct  66   YLSNIQRGGLVQPFGCLIAVEEPSFRILGLSDNSSDFLGLLSLPSTSHSGEFDKVKGLIG  125

Query  415  IDARTLFTLSSRASLAKAVA  474
            IDARTLFT SS ASL+KA +
Sbjct  126  IDARTLFTPSSGASLSKAAS  145



>gb|KFK28490.1| phytochrome e [Arabis alpina]
Length=1117

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 11/142 (8%)
 Frame = +1

Query  82   SSSATSNL------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            SSSA SN+      +T    AQY+ DA L A+F+ S  SGKSF+YS+SVI  P  V ++ 
Sbjct  6    SSSAASNMKPNHQKSTTNNTAQYSVDAALFADFDHSIFSGKSFNYSKSVISPPNYVPDQH  65

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-----ERMSL  408
            +TAYLS IQRGGL+QPFGC+LA++EPSF I+G SEN  DLLGL S          +   L
Sbjct  66   ITAYLSNIQRGGLVQPFGCLLAVQEPSFTILGLSENSIDLLGLSSSSSSSSCNEFKVEGL  125

Query  409  IGIDARTLFTLSSRASLAKAVA  474
            IGIDARTLFT SS +SLAKA +
Sbjct  126  IGIDARTLFTPSSGSSLAKAAS  147



>gb|KJB72840.1| hypothetical protein B456_011G200200 [Gossypium raimondii]
 gb|KJB72841.1| hypothetical protein B456_011G200200 [Gossypium raimondii]
Length=1144

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 99/144 (69%), Gaps = 13/144 (9%)
 Frame = +1

Query  85   SSATSNL----------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT  234
            SS TSN+          +  KAIAQY  DA+L A FEQS ESGKSFDYS+SV    Q+V 
Sbjct  28   SSGTSNMRASHTHHQADSISKAIAQYTVDARLHAVFEQSGESGKSFDYSQSVKTTTQSVP  87

Query  235  EEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSL-  408
            E+++TAYLS+IQRGG IQPFGCM+A++EPSF+I+ +SEN  ++LG+     P  ER+ + 
Sbjct  88   EQQITAYLSKIQRGGHIQPFGCMIAVDEPSFRIIAYSENAREMLGITPQSVPNLERIEVL  147

Query  409  -IGIDARTLFTLSSRASLAKAVAS  477
             IG D RTLFT SS   L KA A+
Sbjct  148  AIGTDVRTLFTPSSAVLLEKAFAA  171



>gb|KJB72839.1| hypothetical protein B456_011G200200 [Gossypium raimondii]
Length=1196

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 99/144 (69%), Gaps = 13/144 (9%)
 Frame = +1

Query  85   SSATSNL----------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT  234
            SS TSN+          +  KAIAQY  DA+L A FEQS ESGKSFDYS+SV    Q+V 
Sbjct  80   SSGTSNMRASHTHHQADSISKAIAQYTVDARLHAVFEQSGESGKSFDYSQSVKTTTQSVP  139

Query  235  EEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSL-  408
            E+++TAYLS+IQRGG IQPFGCM+A++EPSF+I+ +SEN  ++LG+     P  ER+ + 
Sbjct  140  EQQITAYLSKIQRGGHIQPFGCMIAVDEPSFRIIAYSENAREMLGITPQSVPNLERIEVL  199

Query  409  -IGIDARTLFTLSSRASLAKAVAS  477
             IG D RTLFT SS   L KA A+
Sbjct  200  AIGTDVRTLFTPSSAVLLEKAFAA  223



>ref|XP_009353857.1| PREDICTED: phytochrome E-like [Pyrus x bretschneideri]
 ref|XP_009360823.1| PREDICTED: phytochrome E-like [Pyrus x bretschneideri]
Length=1134

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            ++IA Y  DA L+AE+EQS  SG SF Y+RSV+  P +V EE++ AYLSRIQRG L+Q F
Sbjct  35   RSIAHYREDANLLAEYEQSAVSGTSFHYTRSVLFPPDSVPEEQIVAYLSRIQRGSLVQSF  94

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGL-KSG--VEPPERMSLIGIDARTLFT  438
            GCMLAI+EP+F+I+GFSENCF+LLGL KSG      E   LIGID RTLFT
Sbjct  95   GCMLAIKEPTFRIIGFSENCFELLGLDKSGSVFGSNELKGLIGIDCRTLFT  145



>ref|XP_002868009.1| hypothetical protein ARALYDRAFT_914880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44268.1| hypothetical protein ARALYDRAFT_914880 [Arabidopsis lyrata subsp. 
lyrata]
Length=1116

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 97/144 (67%), Gaps = 13/144 (9%)
 Frame = +1

Query  82   SSSATSNLN-------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN+             AQY+ DA L A+F+QS  SGKSF+YS+SVI  P  V +E
Sbjct  6    SSSAASNMKPLGDSKPQKSNTAQYSVDAALFADFDQSIYSGKSFNYSKSVISPPNYVPDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS------GVEPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SEN  + LGL S        E  +  
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENSSEFLGLLSLASTSHSGEFDKVK  125

Query  403  SLIGIDARTLFTLSSRASLAKAVA  474
             LIGIDARTLFT SS ASLAKA +
Sbjct  126  GLIGIDARTLFTPSSGASLAKAAS  149



>gb|ACC60966.1| phytochrome B [Vitis vinifera]
Length=1129

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 96/138 (70%), Gaps = 11/138 (8%)
 Frame = +1

Query  85   SSATSNLNT------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEM  246
            SS TSNL         KAIAQY  DA+L A +EQS ESGKSFDYS+SV    Q+V E+++
Sbjct  16   SSGTSNLRVYHTDSMSKAIAQYTMDARLHAVYEQSGESGKSFDYSQSVRTTTQSVPEQQI  75

Query  247  TAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIG  414
            TAYLS+IQRGG IQPFGCMLA++E +F+++ FSEN  ++LGL       +E PE + L+G
Sbjct  76   TAYLSKIQRGGHIQPFGCMLAVDEATFRVIAFSENAREMLGLTPQSVPSLEKPEIL-LVG  134

Query  415  IDARTLFTLSSRASLAKA  468
             D RTLFT SS   L KA
Sbjct  135  TDVRTLFTPSSAVLLEKA  152



>ref|XP_002278263.1| PREDICTED: phytochrome B [Vitis vinifera]
Length=1129

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 96/138 (70%), Gaps = 11/138 (8%)
 Frame = +1

Query  85   SSATSNLNT------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEM  246
            SS TSNL         KAIAQY  DA+L A +EQS ESGKSFDYS+SV    Q+V E+++
Sbjct  16   SSGTSNLRVYHTDSMSKAIAQYTMDARLHAVYEQSGESGKSFDYSQSVRTTTQSVPEQQI  75

Query  247  TAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIG  414
            TAYLS+IQRGG IQPFGCMLA++E +F+++ FSEN  ++LGL       +E PE + L+G
Sbjct  76   TAYLSKIQRGGHIQPFGCMLAVDEATFRVIAFSENAREMLGLTPQSVPSLEKPEIL-LVG  134

Query  415  IDARTLFTLSSRASLAKA  468
             D RTLFT SS   L KA
Sbjct  135  TDVRTLFTPSSAVLLEKA  152



>gb|ACC60970.1| phytochrome B [Vitis riparia]
Length=1129

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 96/138 (70%), Gaps = 11/138 (8%)
 Frame = +1

Query  85   SSATSNLNT------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEM  246
            SS TSNL         KAIAQY  DA+L A +EQS ESGKSFDYS+SV    Q+V E+++
Sbjct  16   SSGTSNLRVYHTDSMSKAIAQYTMDARLHAVYEQSGESGKSFDYSQSVRTTTQSVPEQQI  75

Query  247  TAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIG  414
            TAYLS+IQRGG IQPFGCMLA++E +F+++ FSEN  ++LGL       +E PE + L+G
Sbjct  76   TAYLSKIQRGGHIQPFGCMLAVDEATFRVIAFSENAREMLGLTPQSVPSLEKPEIL-LVG  134

Query  415  IDARTLFTLSSRASLAKA  468
             D RTLFT SS   L KA
Sbjct  135  TDVRTLFTPSSAVLLEKA  152



>gb|KHG20019.1| Phytochrome B [Gossypium arboreum]
Length=1132

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 99/144 (69%), Gaps = 13/144 (9%)
 Frame = +1

Query  85   SSATSNL----------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT  234
            SS T+N+          +  KAIAQY  DA+L A FEQS ESGKSFDYS+SV    Q+V 
Sbjct  32   SSGTTNMRASHTHHQADSISKAIAQYTVDARLHAVFEQSGESGKSFDYSQSVKTTTQSVP  91

Query  235  EEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSL-  408
            E+++TAYLS+IQRGG IQPFGCM+A++EPSF+I+ +SEN  ++LG+     P  ER+ + 
Sbjct  92   EQQITAYLSKIQRGGHIQPFGCMIAVDEPSFRIIAYSENAREMLGITPQSVPNLERIEVL  151

Query  409  -IGIDARTLFTLSSRASLAKAVAS  477
             IG D RTLFT SS   L KA A+
Sbjct  152  TIGTDVRTLFTPSSAVLLEKAFAA  175



>gb|KDP27911.1| hypothetical protein JCGZ_18991 [Jatropha curcas]
Length=1143

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 11/142 (8%)
 Frame = +1

Query  73   VTFSSSATSNL------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT  234
            V   SS TSNL      +  KAIAQY  DA+L A FEQS ESGKSFDYS+SV    Q+V 
Sbjct  27   VAPQSSGTSNLRVHNTESVSKAIAQYTVDAQLHAVFEQSGESGKSFDYSQSVRTTNQSVP  86

Query  235  EEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERM  402
            E+++TAYLS+IQRGG IQPFGCM+ ++E SF++ G+SEN  ++LGL       +E PE +
Sbjct  87   EQQITAYLSKIQRGGHIQPFGCMITVDEGSFRVTGYSENAREMLGLTPQSVPSLEKPEIL  146

Query  403  SLIGIDARTLFTLSSRASLAKA  468
            S IG D RTLFT SS   L KA
Sbjct  147  S-IGTDVRTLFTPSSAVLLEKA  167



>ref|XP_008358619.1| PREDICTED: phytochrome E-like [Malus domestica]
Length=1132

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            ++IA Y  DA L+AE+EQS  SG  F Y+RSV+  P +V EE++ AYLSRIQRG L+Q F
Sbjct  35   RSIAHYREDANLLAEYEQSAVSGTPFHYTRSVLFPPDSVPEEQIVAYLSRIQRGSLVQSF  94

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGL-KSG--VEPPERMSLIGIDARTLFT  438
            GCMLAI+EP+F+I+GFSENCF+LLGL KSG      E   LIGID RTLFT
Sbjct  95   GCMLAIKEPTFRIIGFSENCFELLGLDKSGSVFGSNELXGLIGIDCRTLFT  145



>ref|XP_010449502.1| PREDICTED: phytochrome E isoform X2 [Camelina sativa]
Length=1112

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 96/145 (66%), Gaps = 16/145 (11%)
 Frame = +1

Query  82   SSSATSNLN--------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTE  237
            SSSA SN+              AQY+ DA L A+F+ S  SGKSF+YS+SVI  P  V +
Sbjct  6    SSSAASNMKPLGGDSKPQKSNTAQYSVDAGLFADFDHSIYSGKSFNYSKSVISPPSYVPD  65

Query  238  EEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS--------GVEPP  393
            E +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SEN  + LGL S        G E  
Sbjct  66   EHITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGLSENSAEFLGLLSLASTSHSGGGEFD  125

Query  394  ERMSLIGIDARTLFTLSSRASLAKA  468
            +  +LIG DARTLFT SS ASLAKA
Sbjct  126  KVKALIGTDARTLFTPSSGASLAKA  150



>ref|XP_008383527.1| PREDICTED: phytochrome E-like [Malus domestica]
Length=1132

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            ++IA Y  DA L+AE+EQS  SG  F Y+RSV+  P +V EE++ AYLSRIQRG L+Q F
Sbjct  35   RSIAHYREDANLLAEYEQSAVSGTPFHYTRSVLFPPDSVPEEQIVAYLSRIQRGSLVQSF  94

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGL-KSG--VEPPERMSLIGIDARTLFT  438
            GCMLAI+EP+F+I+GFSENCF+LLGL KSG      E   LIGID RTLFT
Sbjct  95   GCMLAIKEPTFRIIGFSENCFELLGLDKSGSVFGSNELRGLIGIDCRTLFT  145



>ref|XP_010449501.1| PREDICTED: phytochrome E isoform X1 [Camelina sativa]
Length=1112

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 96/145 (66%), Gaps = 16/145 (11%)
 Frame = +1

Query  82   SSSATSNLN--------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTE  237
            SSSA SN+              AQY+ DA L A+F+ S  SGKSF+YS+SVI  P  V +
Sbjct  6    SSSAASNMKPLGGDSKPQKSNTAQYSVDAGLFADFDHSIYSGKSFNYSKSVISPPSYVPD  65

Query  238  EEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS--------GVEPP  393
            E +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SEN  + LGL S        G E  
Sbjct  66   EHITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENSAEFLGLLSLASTSHSGGGEFD  125

Query  394  ERMSLIGIDARTLFTLSSRASLAKA  468
            +  +LIG DARTLFT SS ASLAKA
Sbjct  126  KVKALIGTDARTLFTPSSGASLAKA  150



>ref|XP_002519230.1| phytochrome B, putative [Ricinus communis]
 gb|EEF43094.1| phytochrome B, putative [Ricinus communis]
Length=1141

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 99/144 (69%), Gaps = 11/144 (8%)
 Frame = +1

Query  67   KAVTFSSSATSNL---NT---GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQN  228
            +  T  SS TSNL   NT    KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+
Sbjct  23   QPTTAQSSGTSNLRAHNTESMSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTNQS  82

Query  229  VTEEEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPE  396
            + E+++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  +LLGL       +E PE
Sbjct  83   IAEQQITAYLSKIQRGGHIQPFGCMIAVDEASFRVIAYSENARELLGLMPQSVPSLEKPE  142

Query  397  RMSLIGIDARTLFTLSSRASLAKA  468
             +S IG D RTLFT SS   L KA
Sbjct  143  ILS-IGTDVRTLFTQSSALLLEKA  165



>ref|XP_010445296.1| PREDICTED: phytochrome E [Camelina sativa]
Length=1109

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 95/145 (66%), Gaps = 16/145 (11%)
 Frame = +1

Query  82   SSSATSNLN--------TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTE  237
            SSSA SN+              AQY+ DA L A+F+ S  SGKSF+YS+SVI  P  V +
Sbjct  6    SSSAASNMKPLGGDSKPQKSNTAQYSVDAGLFADFDHSIYSGKSFNYSKSVISPPSYVPD  65

Query  238  EEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS--------GVEPP  393
            E +TAYLS IQRGGL+QPFGC++A+EEPSF+I+G SEN  + LGL S        G E  
Sbjct  66   EHITAYLSNIQRGGLVQPFGCLIAVEEPSFRILGVSENSAEFLGLLSLASTSHSCGGEFD  125

Query  394  ERMSLIGIDARTLFTLSSRASLAKA  468
            +   LIG DARTLFT SS ASLAKA
Sbjct  126  KVKGLIGTDARTLFTPSSGASLAKA  150



>ref|XP_004134246.1| PREDICTED: phytochrome B-like [Cucumis sativus]
Length=1132

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 98/139 (71%), Gaps = 11/139 (8%)
 Frame = +1

Query  82   SSSATSNLNT------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            S++ TSNL +       KAIAQY  DA+L A FEQS ESGKSFDYS+S+  + Q+V E++
Sbjct  18   SNTNTSNLRSHRTDSISKAIAQYTVDARLHAVFEQSGESGKSFDYSQSIKTSTQSVPEQQ  77

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLI  411
            +TAYLS+IQRGG IQPFGCM+AIEE SF+++ +SEN  +LLGL       +E PE ++ I
Sbjct  78   ITAYLSKIQRGGHIQPFGCMIAIEEASFRVIAYSENARELLGLTPQSVPSLEKPEILT-I  136

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LFT +S   L KA
Sbjct  137  GTDVRNLFTSNSAILLEKA  155



>ref|XP_004165483.1| PREDICTED: phytochrome B-like [Cucumis sativus]
 gb|KGN57169.1| hypothetical protein Csa_3G166340 [Cucumis sativus]
Length=1132

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 98/139 (71%), Gaps = 11/139 (8%)
 Frame = +1

Query  82   SSSATSNLNT------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            S++ TSNL +       KAIAQY  DA+L A FEQS ESGKSFDYS+S+  + Q+V E++
Sbjct  18   SNTNTSNLRSHRTDSISKAIAQYTVDARLHAVFEQSGESGKSFDYSQSIKTSTQSVPEQQ  77

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLI  411
            +TAYLS+IQRGG IQPFGCM+AIEE SF+++ +SEN  +LLGL       +E PE ++ I
Sbjct  78   ITAYLSKIQRGGHIQPFGCMIAIEEASFRVIAYSENARELLGLTPQSVPSLEKPEILT-I  136

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LFT +S   L KA
Sbjct  137  GTDVRNLFTSNSAILLEKA  155



>ref|XP_006841448.1| hypothetical protein AMTR_s00003p00079190 [Amborella trichopoda]
 gb|ERN03123.1| hypothetical protein AMTR_s00003p00079190 [Amborella trichopoda]
Length=1124

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 94/138 (68%), Gaps = 10/138 (7%)
 Frame = +1

Query  85   SSATSNLNT-------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            SS  SN+ T        KAIAQYNADA+L A FEQS ESGKSFDYS+SV    ++V E++
Sbjct  12   SSGASNIRTHNNTETISKAIAQYNADARLHAVFEQSGESGKSFDYSQSVKSTTESVPEKQ  71

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSLI---G  414
            +TAYLS+IQRGG IQPFGCM+AIEE SF+++ +SEN  ++L L     P    + I    
Sbjct  72   ITAYLSKIQRGGHIQPFGCMIAIEESSFRVISYSENAIEMLDLMPQAVPSMDQTEILKVD  131

Query  415  IDARTLFTLSSRASLAKA  468
             D RTLFT SS  SLAKA
Sbjct  132  TDVRTLFTPSSALSLAKA  149



>ref|XP_008438960.1| PREDICTED: phytochrome B [Cucumis melo]
Length=1132

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 98/139 (71%), Gaps = 11/139 (8%)
 Frame = +1

Query  82   SSSATSNLNT------GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            S++ TSNL +       KAIAQY  DA+L A FEQS ESGKSFDYS+S+  + Q+V E++
Sbjct  18   SNTNTSNLRSHRTDSISKAIAQYTVDARLHAVFEQSGESGKSFDYSQSIRTSTQSVPEQQ  77

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLI  411
            +TAYLS+IQRGG IQPFGCM+AIEE SF+++ +SEN  +LLGL       +E PE ++ I
Sbjct  78   ITAYLSKIQRGGHIQPFGCMIAIEEASFRVIAYSENARELLGLTPQSVPSLEKPEILT-I  136

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LFT +S   L KA
Sbjct  137  GTDVRNLFTSNSAILLEKA  155



>gb|AHZ63958.1| phytochrome [Pinus parviflora]
Length=1132

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +1

Query  118  AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPFG  297
            A+AQYNADA+L+  FEQS ESGKSFDY+RS+    ++V E+++TAYLSRIQRGG+IQPFG
Sbjct  33   AMAQYNADARLLEVFEQSGESGKSFDYTRSIKSTTESVPEQQITAYLSRIQRGGIIQPFG  92

Query  298  CMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMS-----LIGIDARTLFTLSSRASLA  462
            C+LA+EE +F+I+ +SEN  ++L L     P    S      IG D RTLFT +S  SL 
Sbjct  93   CVLAVEETTFRIIAYSENAVEMLDLAPQSVPSMEQSQLEVLTIGTDVRTLFTAASSHSLV  152

Query  463  KAVAS  477
            KA  +
Sbjct  153  KAAVT  157



>gb|AHZ89696.1| phytochrome B [Dimocarpus longan]
Length=1155

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 4/129 (3%)
 Frame = +1

Query  94   TSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSV-IHAPQNVTEEEMTAYLSRIQ  270
            T ++   KAIAQY  DA+L A FEQS ESGKSFDYS+SV     Q+V E++++AYLSRIQ
Sbjct  50   TESVTVSKAIAQYTVDARLHAVFEQSGESGKSFDYSQSVRTTTSQSVPEQQISAYLSRIQ  109

Query  271  RGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLIGIDARTLFTL  441
            RGG IQPFGCM+A++EPSF+++G+SEN  ++LGL     P    + +  IG D RTLF  
Sbjct  110  RGGHIQPFGCMIAVDEPSFRVIGYSENAREMLGLTPQSVPNLEKQEILTIGTDIRTLFIS  169

Query  442  SSRASLAKA  468
            SS   L KA
Sbjct  170  SSSVLLEKA  178



>ref|XP_010318997.1| PREDICTED: phytochrome B1 [Solanum lycopersicum]
 sp|Q9ZS62.1|PHYB1_SOLLC RecName: Full=Phytochrome B1 [Solanum lycopersicum]
 emb|CAA05293.1| phytochrome B1 [Solanum lycopersicum]
Length=1131

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 92/135 (68%), Gaps = 7/135 (5%)
 Frame = +1

Query  85   SSATSNLN----TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            SS TSN+N      KAIAQY ADA+L A FEQS ESGKSFDYS+SV    Q+V E ++TA
Sbjct  21   SSGTSNMNYKDSISKAIAQYTADARLHAVFEQSGESGKSFDYSQSVKTTTQSVPERQITA  80

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLIGIDA  423
            YL++IQRGG IQPFGCM+A++E SF+I+ +SEN  ++L L     P      +  +G D 
Sbjct  81   YLTKIQRGGHIQPFGCMIAVDEASFRIIAYSENACEMLSLTPQSVPSLDKSEILTVGTDV  140

Query  424  RTLFTLSSRASLAKA  468
            RTLFT SS   L +A
Sbjct  141  RTLFTPSSSVLLERA  155



>ref|NP_001274786.1| phytochrome B [Solanum tuberosum]
 gb|ABC72086.1| phytochrome B [Solanum tuberosum]
Length=1130

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 93/135 (69%), Gaps = 7/135 (5%)
 Frame = +1

Query  85   SSATSNLN----TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTA  252
            SS TSN+N      KAIAQY ADA+L A FEQS ESGK FDYS SV    Q+V E ++TA
Sbjct  19   SSGTSNVNYKDSISKAIAQYTADARLHAVFEQSGESGKFFDYSESVKTTTQSVPERQITA  78

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSL--IGIDA  423
            YL++IQRGG IQPFGCM+A++E SF+++ +SEN F++L L     P  E+  +  IG D 
Sbjct  79   YLTKIQRGGHIQPFGCMIAVDEASFRVIAYSENAFEMLSLTPQSVPSLEKCEILTIGTDV  138

Query  424  RTLFTLSSRASLAKA  468
            RTLFT SS   L +A
Sbjct  139  RTLFTPSSSVLLERA  153



>ref|XP_007035809.1| Phytochrome B isoform 3, partial [Theobroma cacao]
 gb|EOY06735.1| Phytochrome B isoform 3, partial [Theobroma cacao]
Length=976

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 90/122 (74%), Gaps = 5/122 (4%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS E+GKSFDYS+SV    Q+V E+++TAYLS+IQRGG IQPF
Sbjct  42   KAIAQYTVDARLHAVFEQSGETGKSFDYSQSVRTTTQSVPEQQITAYLSKIQRGGHIQPF  101

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            GCM+A++EPSF+++ +SEN  ++LG+       +E  E ++ IG D RTLFT SS   L 
Sbjct  102  GCMMAVDEPSFRVIAYSENAREMLGITPQSVPNLEKTEVLT-IGTDVRTLFTPSSATLLE  160

Query  463  KA  468
            KA
Sbjct  161  KA  162



>ref|XP_007035808.1| Phytochrome B isoform 2 [Theobroma cacao]
 gb|EOY06734.1| Phytochrome B isoform 2 [Theobroma cacao]
Length=1070

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 90/122 (74%), Gaps = 5/122 (4%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS E+GKSFDYS+SV    Q+V E+++TAYLS+IQRGG IQPF
Sbjct  42   KAIAQYTVDARLHAVFEQSGETGKSFDYSQSVRTTTQSVPEQQITAYLSKIQRGGHIQPF  101

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            GCM+A++EPSF+++ +SEN  ++LG+       +E  E ++ IG D RTLFT SS   L 
Sbjct  102  GCMMAVDEPSFRVIAYSENAREMLGITPQSVPNLEKTEVLT-IGTDVRTLFTPSSATLLE  160

Query  463  KA  468
            KA
Sbjct  161  KA  162



>ref|XP_007035807.1| Phytochrome B isoform 1 [Theobroma cacao]
 gb|EOY06733.1| Phytochrome B isoform 1 [Theobroma cacao]
Length=1138

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 90/122 (74%), Gaps = 5/122 (4%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS E+GKSFDYS+SV    Q+V E+++TAYLS+IQRGG IQPF
Sbjct  42   KAIAQYTVDARLHAVFEQSGETGKSFDYSQSVRTTTQSVPEQQITAYLSKIQRGGHIQPF  101

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            GCM+A++EPSF+++ +SEN  ++LG+       +E  E ++ IG D RTLFT SS   L 
Sbjct  102  GCMMAVDEPSFRVIAYSENAREMLGITPQSVPNLEKTEVLT-IGTDVRTLFTPSSATLLE  160

Query  463  KA  468
            KA
Sbjct  161  KA  162



>ref|XP_010065155.1| PREDICTED: phytochrome B [Eucalyptus grandis]
 gb|KCW87973.1| hypothetical protein EUGRSUZ_A00380 [Eucalyptus grandis]
Length=1125

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 5/122 (4%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS ESG+SFDYS+SV    Q+V E+++TAYLS+IQRGG IQPF
Sbjct  30   KAIAQYTQDARLHAVFEQSGESGRSFDYSQSVRTTTQSVPEQQITAYLSKIQRGGHIQPF  89

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            GCM+A +E +F+I+ +SEN  D+LGL       +E PE +  IG D RTLFT SS A L 
Sbjct  90   GCMIAADESTFRILAYSENARDMLGLTPQSVPSLEKPEVLG-IGTDVRTLFTPSSGALLE  148

Query  463  KA  468
            KA
Sbjct  149  KA  150



>gb|AJE63445.1| phytochrome P [Picea abies]
Length=1132

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 5/125 (4%)
 Frame = +1

Query  118  AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPFG  297
            A+AQYNADA+L+  FEQS ESGKSFDY+RS+    ++V E+++TAYLSRIQRGG IQPFG
Sbjct  33   AMAQYNADARLLQVFEQSGESGKSFDYTRSIKSTTESVPEQQITAYLSRIQRGGRIQPFG  92

Query  298  CMLAIEEPSFKIVGFSENCFDLLGL-----KSGVEPPERMSLIGIDARTLFTLSSRASLA  462
            C+LA+EE +F+I+ +SEN  ++L L      S  +P   +  IG D RTLFT +S  SL 
Sbjct  93   CVLAVEETTFRIIAYSENAVEMLDLAPQSVPSMEQPQLEVLTIGTDVRTLFTAASAHSLE  152

Query  463  KAVAS  477
            KA  +
Sbjct  153  KAAVA  157



>sp|P29130.2|PHYB_TOBAC RecName: Full=Phytochrome B [Nicotiana tabacum]
 gb|AAA34092.1| type II phytochrome [Nicotiana tabacum]
Length=1132

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 98/141 (70%), Gaps = 10/141 (7%)
 Frame = +1

Query  73   VTFSSSATSNLN----TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT-E  237
            V   SS TSN+N      KAIAQY ADA+L A FEQS ESGKSFDYS+S+    Q+V  E
Sbjct  18   VQAQSSGTSNVNYKDSISKAIAQYTADARLHAVFEQSGESGKSFDYSQSIKTTTQSVVPE  77

Query  238  EEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMS  405
            +++TAYL++IQRGG IQPFGCM+A++E SF+++ +SEN  ++L L       +E PE ++
Sbjct  78   QQITAYLTKIQRGGHIQPFGCMIAVDEASFRVIAYSENACEMLSLTPQSVPSLERPEILT  137

Query  406  LIGIDARTLFTLSSRASLAKA  468
             +G D RTLFT SS   L +A
Sbjct  138  -VGTDVRTLFTPSSSVLLERA  157



>ref|XP_009789287.1| PREDICTED: phytochrome B [Nicotiana sylvestris]
 ref|XP_009789288.1| PREDICTED: phytochrome B [Nicotiana sylvestris]
Length=1133

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 98/141 (70%), Gaps = 10/141 (7%)
 Frame = +1

Query  73   VTFSSSATSNLN----TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT-E  237
            V   SS TSN+N      KAIAQY ADA+L A FEQS ESGKSFDYS+S+    Q+V  E
Sbjct  18   VQAQSSGTSNVNYKDSISKAIAQYTADARLHAVFEQSGESGKSFDYSQSIKTTTQSVVPE  77

Query  238  EEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMS  405
            +++TAYL++IQRGG IQPFGCM+A++E SF+++ +SEN  ++L L       +E PE ++
Sbjct  78   QQITAYLTKIQRGGHIQPFGCMIAVDEASFRVIAYSENACEMLSLTPQSVPSLERPEILT  137

Query  406  LIGIDARTLFTLSSRASLAKA  468
             +G D RTLFT SS   L +A
Sbjct  138  -VGTDVRTLFTPSSSVLLERA  157



>emb|CBJ94872.1| phytochrome B2 [Populus tremula]
Length=228

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE++TAYLS+IQRGG I
Sbjct  8    SVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEEQITAYLSKIQRGGHI  67

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLIGIDARTLFTLSSRAS  456
            QPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +G D R LF  SS   
Sbjct  68   QPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFVGADVRILFRPSSAVL  127

Query  457  LAKA  468
            L KA
Sbjct  128  LEKA  131



>gb|ACN40636.1| unknown [Picea sitchensis]
Length=1132

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 5/125 (4%)
 Frame = +1

Query  118  AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPFG  297
            A+AQYNADA+L+  FEQS ESGKSFDY+RS+    ++V E+++TAYLSRIQRGG IQPFG
Sbjct  33   AMAQYNADARLLQVFEQSGESGKSFDYTRSIKSTTESVPEQQITAYLSRIQRGGRIQPFG  92

Query  298  CMLAIEEPSFKIVGFSENCFDLLGL-----KSGVEPPERMSLIGIDARTLFTLSSRASLA  462
            C+LA+EE +F+I+ +SEN  ++L L      S  +P   +  IG D RTLFT +S  SL 
Sbjct  93   CVLAVEETTFRIIAYSENAVEMLDLAPQSVPSMEQPQLEVLTIGTDVRTLFTAASAHSLE  152

Query  463  KAVAS  477
            KA  +
Sbjct  153  KAAVA  157



>ref|XP_009606016.1| PREDICTED: phytochrome B [Nicotiana tomentosiformis]
 ref|XP_009606018.1| PREDICTED: phytochrome B [Nicotiana tomentosiformis]
Length=1131

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 97/141 (69%), Gaps = 10/141 (7%)
 Frame = +1

Query  73   VTFSSSATSNLN----TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT-E  237
            V   SS TSN+N      KAIAQY ADA+L A FEQS ESGKSFDYS+SV    Q+V  E
Sbjct  16   VQAQSSGTSNVNYKDSISKAIAQYTADARLHAVFEQSGESGKSFDYSQSVKTITQSVVPE  75

Query  238  EEMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMS  405
            +++TAYL++IQRGG IQPFGCM+A++E SF ++ +SEN  ++L L       +E PE ++
Sbjct  76   QQITAYLTKIQRGGHIQPFGCMIAVDEASFHVIAYSENACEMLSLTPQSVPSLERPEILT  135

Query  406  LIGIDARTLFTLSSRASLAKA  468
             +G D RTLFT SS   L +A
Sbjct  136  -VGTDVRTLFTPSSSVLLERA  155



>emb|CBJ94888.1| phytochrome B2 [Populus trichocarpa]
Length=184

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS  +G+SFDYS+SV    Q+V E+++TAYLS+IQRGG IQPF
Sbjct  8    KAIAQYTVDAQLHAVFEQSGGTGRSFDYSKSVRTTNQSVPEQQITAYLSKIQRGGHIQPF  67

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLIGIDARTLFTLSSRASLAK  465
            GCM+A +E SF+++ +SEN  D+LGL     P    + +  +G D R LF  SS   L K
Sbjct  68   GCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFVGADVRILFRPSSAVLLEK  127

Query  466  A  468
            A
Sbjct  128  A  128



>emb|CBJ94879.1| phytochrome B2 [Populus balsamifera]
Length=180

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            +  KAIAQY  DA+L A FEQS  +G+SFDYS+SV    Q+V E+++TAYLS+IQRGG I
Sbjct  3    SVSKAIAQYTVDAQLHAVFEQSGGTGRSFDYSKSVRTTNQSVPEQQITAYLSKIQRGGHI  62

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLIGIDARTLFTLSSRAS  456
            QPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +G D R LF  SS   
Sbjct  63   QPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFVGADVRILFRPSSAVL  122

Query  457  LAKA  468
            L KA
Sbjct  123  LEKA  126



>gb|ABP96522.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96527.1| phytochrome B, partial [Arabidopsis thaliana]
Length=282

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAP--QNVTEEEMTAYLSRIQRGGLIQ  288
            KAI QY  DA+L A FEQS ESGKSFDYS+S+       +V E+++TAYLSRIQRGG IQ
Sbjct  44   KAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQQITAYLSRIQRGGYIQ  103

Query  289  PFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRAS  456
            PFGCM+A++E SF+I+G+SEN  ++LGL       +E PE +++ G D R+LFT SS   
Sbjct  104  PFGCMIAVDESSFRIIGYSENAREMLGLMPQSVPTLEKPEILAM-GTDVRSLFTSSSSIL  162

Query  457  LAKA  468
            L +A
Sbjct  163  LERA  166



>gb|ABP96519.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96520.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96521.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96524.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96526.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96528.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96529.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96530.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96532.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96533.1| phytochrome B, partial [Arabidopsis thaliana]
Length=282

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAP--QNVTEEEMTAYLSRIQRGGLIQ  288
            KAI QY  DA+L A FEQS ESGKSFDYS+S+       +V E+++TAYLSRIQRGG IQ
Sbjct  44   KAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQQITAYLSRIQRGGYIQ  103

Query  289  PFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRAS  456
            PFGCM+A++E SF+I+G+SEN  ++LGL       +E PE +++ G D R+LFT SS   
Sbjct  104  PFGCMIAVDESSFRIIGYSENAREMLGLMPQSVPTLEKPEILAM-GTDVRSLFTSSSSIL  162

Query  457  LAKA  468
            L +A
Sbjct  163  LERA  166



>emb|CAZ64530.1| photochrome B2 [Populus trichocarpa]
Length=210

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLI  285
            +  KAIAQY  DA+L A FEQS  +G+SFDYS+SV    Q+V E+++TAYLS+IQRGG I
Sbjct  3    SVSKAIAQYTVDAQLHAVFEQSGGTGRSFDYSKSVRTTNQSVPEQQITAYLSKIQRGGHI  62

Query  286  QPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLIGIDARTLFTLSSRAS  456
            QPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +G D R LF  SS   
Sbjct  63   QPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFVGADVRILFRPSSAVL  122

Query  457  LAKA  468
            L KA
Sbjct  123  LEKA  126



>gb|AHZ63961.1| phytochrome, partial [Encephalartos barteri]
Length=957

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 93/135 (69%), Gaps = 7/135 (5%)
 Frame = +1

Query  94   TSNLNTGK-AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQ  270
            +SN NT   A+AQYN DA+L A FE+S ESG+SFDY+ S+ +A ++V E+++TAYLSR+Q
Sbjct  20   SSNPNTNTMAMAQYNEDARLHAVFEKSGESGQSFDYTTSIKYATESVPEQQITAYLSRMQ  79

Query  271  RGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP------ERMSLIGIDARTL  432
            RGG IQPFGCMLA+EE +++I+ +SEN   +L L     P       E    IG D RTL
Sbjct  80   RGGTIQPFGCMLAVEERTYRIIAYSENAVGMLDLAPQSVPTMEQQQQEEFLTIGTDVRTL  139

Query  433  FTLSSRASLAKAVAS  477
            FT SS  SL KA A+
Sbjct  140  FTPSSALSLEKAAAA  154



>ref|XP_006285990.1| hypothetical protein CARUB_v10007527mg [Capsella rubella]
 gb|EOA18888.1| hypothetical protein CARUB_v10007527mg [Capsella rubella]
Length=1116

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 13/142 (9%)
 Frame = +1

Query  82   SSSATSN---LNTGKAI----AQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SSSA SN   L   K +    +QY+ DA L A+F+ S  SGKSF+YS+SVI  P  V +E
Sbjct  6    SSSAASNMKPLGDSKPLKSNTSQYSVDAGLFADFDHSIYSGKSFNYSKSVISPPNYVPDE  65

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGV------EPPERM  402
             +TAYLS IQRGGL+QPFGC++A+EEP+F+I+G SENC + LGL S        E  +  
Sbjct  66   HITAYLSNIQRGGLVQPFGCLIAVEEPTFRILGVSENCAEFLGLLSLASSSHCGEVSKVK  125

Query  403  SLIGIDARTLFTLSSRASLAKA  468
             LIG DARTLFT SS ASLAKA
Sbjct  126  GLIGTDARTLFTPSSGASLAKA  147



>ref|XP_009372122.1| PREDICTED: phytochrome B-like [Pyrus x bretschneideri]
Length=1120

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 96/142 (68%), Gaps = 12/142 (8%)
 Frame = +1

Query  85   SSATSNL----NT---GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            SS TSN+    NT    KAIAQY  DA+L A FEQS ESGKSFDYS+S+     +V E++
Sbjct  7    SSGTSNIKAHHNTESMSKAIAQYTVDARLHAVFEQSGESGKSFDYSQSMKTTKDSVPEQQ  66

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSG----VEPPERMSLI  411
            +TAYLSRIQRGG +QPFGCM+A++E +F ++ +SEN  D+L L       +E PE ++ I
Sbjct  67   ITAYLSRIQRGGHVQPFGCMMAVDEATFGVIAYSENARDMLDLTPHSVPILEKPEILT-I  125

Query  412  GIDARTLFTLSSRASLAKAVAS  477
            G D RTLFT SS   L KA  +
Sbjct  126  GTDIRTLFTPSSAVLLEKAFGT  147



>ref|XP_009336299.1| PREDICTED: phytochrome B-like [Pyrus x bretschneideri]
Length=1120

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 95/139 (68%), Gaps = 12/139 (9%)
 Frame = +1

Query  85   SSATSNL----NT---GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            SS TSN+    NT    KAIAQY  DA+L A FEQS ESGKSFDYS+S+     +V E++
Sbjct  7    SSGTSNIKAHHNTESMSKAIAQYTVDARLHAVFEQSGESGKSFDYSQSMKTTKDSVPEQQ  66

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSG----VEPPERMSLI  411
            +TAYLSRIQRGG +QPFGCM+A++E +F ++ +SEN  D+L L       +E PE ++ I
Sbjct  67   ITAYLSRIQRGGHVQPFGCMMAVDEATFGVIAYSENARDMLDLTPHSVPILEKPEILT-I  125

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLFT SS   L KA
Sbjct  126  GTDIRTLFTPSSAVLLEKA  144



>gb|ABP96531.1| phytochrome B, partial [Arabidopsis thaliana]
Length=282

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQN--VTEEEMTAYLSRIQRGGLIQ  288
            KAI QY  DA+L A FEQS ESGKSFDYS+S+     +  V E+++TAYLSRIQRGG IQ
Sbjct  44   KAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYDSSVPEQQITAYLSRIQRGGYIQ  103

Query  289  PFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRAS  456
            PFGCM+A++E SF+I+G+SEN  ++LG+       +E PE +++ G D R+LFT SS   
Sbjct  104  PFGCMIAVDESSFRIIGYSENAREMLGIMPQSVPTLEKPEILAM-GTDVRSLFTSSSSIL  162

Query  457  LAKA  468
            L +A
Sbjct  163  LERA  166



>ref|XP_006419379.1| hypothetical protein CICLE_v10004218mg [Citrus clementina]
 gb|ESR32619.1| hypothetical protein CICLE_v10004218mg [Citrus clementina]
Length=1090

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = +1

Query  88   SATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRI  267
            +AT ++   KAIAQY  DA+L A FEQS ESGKSFDYS+SV     +V E++++AYLS+I
Sbjct  31   NATESMTVSKAIAQYTVDARLHAVFEQSGESGKSFDYSQSVRTTSHSVPEQQISAYLSKI  90

Query  268  QRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLIGIDARTLFT  438
            QRGG IQPFGC +A++E +F+++ +SEN  ++LGL     P    + +  IG D RTLFT
Sbjct  91   QRGGHIQPFGCTIAVDEATFRVIAYSENAGEMLGLAPQSVPNLEKQEILTIGTDVRTLFT  150

Query  439  LSSRASLAKA  468
             SS   L KA
Sbjct  151  SSSSVLLEKA  160



>ref|XP_010109967.1| Phytochrome B [Morus notabilis]
 gb|EXC24963.1| Phytochrome B [Morus notabilis]
Length=1172

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 90/145 (62%), Gaps = 17/145 (12%)
 Frame = +1

Query  94   TSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNV-TEEEMTAYLSRIQ  270
            T ++N  KA+AQY  DA+L A FEQS ESG+SF+YS+S+I        E+E+T YLS+IQ
Sbjct  45   TESVNMSKAVAQYTLDARLHAVFEQSGESGRSFNYSQSIIKTSTTTPDEQEITGYLSKIQ  104

Query  271  RGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP----------------ERM  402
            RGG IQPFGC LA+ EP+F+++ FSEN  D+LGL      P                +R+
Sbjct  105  RGGHIQPFGCTLAVHEPTFRLIAFSENTADMLGLNHNSNSPSYSITVPNLSEKPTETDRL  164

Query  403  SLIGIDARTLFTLSSRASLAKAVAS  477
              IG D RTLFT SS   L KA A+
Sbjct  165  LTIGTDVRTLFTPSSSILLEKAFAA  189



>emb|CAA74992.1| phytochrome B [Nicotiana plumbaginifolia]
Length=1135

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 95/136 (70%), Gaps = 10/136 (7%)
 Frame = +1

Query  88   SATSNLN----TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVT-EEEMTA  252
            S TSN+N      KAIAQY ADA+L A FEQS ESGKSFDYS+SV    Q+V  E+++TA
Sbjct  25   SGTSNVNYKDSISKAIAQYTADARLHAVFEQSGESGKSFDYSQSVKTTTQSVVPEQQITA  84

Query  253  YLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGID  420
            YL++IQRGG IQPFGCM+A++E SF ++ +SEN  ++L L       +E PE ++ +G D
Sbjct  85   YLTKIQRGGHIQPFGCMIAVDEASFGVIAYSENACEMLSLTPQSVPSLERPEILT-VGTD  143

Query  421  ARTLFTLSSRASLAKA  468
             RTLFT SS   L +A
Sbjct  144  VRTLFTPSSSVLLERA  159



>gb|ABP96523.1| phytochrome B, partial [Arabidopsis thaliana]
 gb|ABP96525.1| phytochrome B, partial [Arabidopsis thaliana]
Length=286

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAP--QNVTEEEMTAYLSRIQRGGLIQ  288
            KAI QY  DA+L A FEQS ESGKSFDYS+S+       +V E+++TAYLSRIQRGG IQ
Sbjct  48   KAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQQITAYLSRIQRGGYIQ  107

Query  289  PFGCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRAS  456
            PFGCM+A++E SF+I+G+SEN  ++LG+       +E PE +++ G D R+LFT SS   
Sbjct  108  PFGCMIAVDESSFRIIGYSENAREMLGIMPQSVPTLEKPEILAM-GTDVRSLFTSSSSIL  166

Query  457  LAKA  468
            L +A
Sbjct  167  LERA  170



>ref|XP_006488839.1| PREDICTED: phytochrome B-like isoform X1 [Citrus sinensis]
Length=1137

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = +1

Query  88   SATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRI  267
            +AT ++   KAIAQY  DA+L A FEQS ESGKSFDYS+SV     +V E++++AYLS+I
Sbjct  31   NATESMTVSKAIAQYTVDARLHAVFEQSGESGKSFDYSQSVRTTSHSVPEQQISAYLSKI  90

Query  268  QRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLIGIDARTLFT  438
            QRGG IQPFGC +A++E +F+++ +SEN  ++LGL     P    + +  IG D RTLFT
Sbjct  91   QRGGHIQPFGCTIAVDEATFRVIAYSENAGEMLGLAPQSVPNLEKQEILTIGTDVRTLFT  150

Query  439  LSSRASLAKA  468
             SS   L KA
Sbjct  151  SSSSVLLEKA  160



>ref|XP_008368328.1| PREDICTED: phytochrome B [Malus domestica]
 ref|XP_008368329.1| PREDICTED: phytochrome B [Malus domestica]
 ref|XP_008368330.1| PREDICTED: phytochrome B [Malus domestica]
 ref|XP_008368331.1| PREDICTED: phytochrome B [Malus domestica]
 ref|XP_008368332.1| PREDICTED: phytochrome B [Malus domestica]
Length=1120

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 94/139 (68%), Gaps = 12/139 (9%)
 Frame = +1

Query  85   SSATSNL-------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            SS TSN+       +  KAIAQY  DA+L A FEQS ESGKSFDYS+S+     +V E++
Sbjct  7    SSGTSNIKAHHNTESVSKAIAQYTVDARLHAVFEQSGESGKSFDYSQSMKTTKDSVPEQQ  66

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSG----VEPPERMSLI  411
            +TAYLS+IQRGG +QPFGCM+A++E +F ++ +SEN  D+L L       +E PE ++ I
Sbjct  67   ITAYLSKIQRGGHVQPFGCMMAVDEATFGVIAYSENARDMLDLTPQSVPILEKPEILT-I  125

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLFT SS   L KA
Sbjct  126  GTDVRTLFTPSSAVLLEKA  144



>gb|KDO71942.1| hypothetical protein CISIN_1g037299mg [Citrus sinensis]
Length=1111

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = +1

Query  88   SATSNLNTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRI  267
            +AT ++   KAIAQY  DA+L A FEQS ESGKSFDYS+SV     +V E++++AYLS+I
Sbjct  31   NATESMTVSKAIAQYTVDARLHAVFEQSGESGKSFDYSQSVRTMSHSVPEQQISAYLSKI  90

Query  268  QRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLIGIDARTLFT  438
            QRGG IQPFGC +A++E +F+++ +SEN  ++LGL     P    + +  IG D RTLFT
Sbjct  91   QRGGHIQPFGCTIAVDEATFRVIAYSENAGEMLGLAPQSVPNLEKQEILTIGTDVRTLFT  150

Query  439  LSSRASLAKA  468
             SS   L KA
Sbjct  151  SSSSVLLEKA  160



>ref|XP_007227356.1| hypothetical protein PRUPE_ppa000510mg [Prunus persica]
 gb|EMJ28555.1| hypothetical protein PRUPE_ppa000510mg [Prunus persica]
Length=1119

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS ESGKSFDYS+S+     +V E+++TAYLSRIQRGG IQPF
Sbjct  24   KAIAQYTVDARLHAVFEQSGESGKSFDYSQSMRTTKDSVPEQQITAYLSRIQRGGHIQPF  83

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLKSG----VEPPERMSLIGIDARTLFTLSSRASLA  462
            GCM+A++E +F ++ +SEN  DLL L       +E PE ++ IG D RTLFT SS   L 
Sbjct  84   GCMMAVDEATFGVIAYSENARDLLDLTPQSVPILEKPEILT-IGTDVRTLFTPSSAVLLE  142

Query  463  KA  468
            KA
Sbjct  143  KA  144



>gb|AGF69863.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69752.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69739.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69749.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69750.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69755.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|ADO62136.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62159.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62165.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62181.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62184.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62185.1| phytochrome B, partial [Helianthus annuus]
Length=262

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 5/121 (4%)
 Frame = +1

Query  118  AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPFG  297
            AIAQY  DA+L A +EQS ESGKSFDYS+S+     ++ E++MTAYLS+IQRGG IQPFG
Sbjct  1    AIAQYALDARLHAVYEQSGESGKSFDYSQSIKTTTDSIAEQQMTAYLSKIQRGGHIQPFG  60

Query  298  CMLAIEEPSFKIVGFSENCFDLLGLKSGVEP----PERMSLIGIDARTLFTLSSRASLAK  465
            CM+AI+  SF+++ FSEN  + LGL     P    PE ++ IG D +TLFT SS   L +
Sbjct  61   CMIAIDNTSFRVIAFSENARERLGLAPQSVPSLDKPEILT-IGTDVKTLFTPSSALLLER  119

Query  466  A  468
            A
Sbjct  120  A  120



>gb|AGF69737.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69730.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69734.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69825.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69839.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69867.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69873.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69866.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69744.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69729.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69736.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69738.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69741.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69742.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69743.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69747.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69751.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69753.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69754.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69756.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69757.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69758.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69759.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69761.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69762.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69763.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69767.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69769.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69770.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69771.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69773.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69778.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69781.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69793.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69803.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69804.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69805.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69809.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69812.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69813.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69815.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69816.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69817.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69818.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69819.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69822.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69823.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69824.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69826.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69827.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69831.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69833.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69835.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69836.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69837.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69838.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69840.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69841.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69842.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69843.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69845.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69847.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69848.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69849.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69850.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69851.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69852.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69853.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69854.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69855.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69860.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69862.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69871.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69733.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69768.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69772.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69779.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69780.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69802.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69806.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69807.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69808.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69810.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69811.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69814.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69832.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69834.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69844.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69846.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69868.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69869.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69875.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69877.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69879.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69795.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69746.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69745.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69728.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69732.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69720.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69785.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69797.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69719.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69721.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69722.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69723.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69724.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69725.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69726.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69727.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69731.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69735.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69760.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69765.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69766.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69774.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69775.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69776.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69777.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69783.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69784.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69786.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69787.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69789.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69790.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69791.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69794.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69796.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69800.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69801.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69821.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69828.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69829.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69856.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69857.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69858.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69859.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69861.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69864.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69865.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69870.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69874.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69876.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AGF69764.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69782.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69788.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69792.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69798.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69799.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69820.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69830.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69872.1| phytochrome B1 [Populus angustifolia]
 gb|AGF69878.1| phytochrome B1 [Populus angustifolia]
Length=1063

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|AAM91631.1| putative phytochrome D [Arabidopsis thaliana]
Length=496

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 6/127 (5%)
 Frame = +1

Query  106  NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQN--VTEEEMTAYLSRIQRGG  279
            +T KAI QY  DA+L A FEQS ESGKSFDYS+S+  AP +  V E+++TAYLSRIQRGG
Sbjct  55   STNKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTAPYDSSVPEQQITAYLSRIQRGG  114

Query  280  LIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKS----GVEPPERMSLIGIDARTLFTLSS  447
              QPFGC++A+EE +F I+G+SEN  ++LGL S     +E    +  IG D R+LF  SS
Sbjct  115  YTQPFGCLIAVEESTFTIIGYSENAREMLGLMSQSVPSIEDKSEVLTIGTDLRSLFKSSS  174

Query  448  RASLAKA  468
               L +A
Sbjct  175  YLLLERA  181



>ref|XP_011019946.1| PREDICTED: phytochrome B isoform X3 [Populus euphratica]
Length=986

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  23   SSGTSNIRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  82

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  83   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSE  142

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  143  GTDVRTLFRPSSSAMLEKA  161



>ref|XP_011019953.1| PREDICTED: phytochrome B isoform X4 [Populus euphratica]
Length=985

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  23   SSGTSNIRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  82

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  83   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSE  142

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  143  GTDVRTLFRPSSSAMLEKA  161



>ref|XP_008223364.1| PREDICTED: phytochrome B [Prunus mume]
Length=1119

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS ESGKSFDYS+S+     +V E+++TAYLS+IQRGG IQPF
Sbjct  24   KAIAQYTVDARLHAVFEQSGESGKSFDYSQSMRTTKDSVPEQQITAYLSKIQRGGHIQPF  83

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            GCM+A++E +F ++ +SEN  DLL L       +E PE ++ IG D RTLFT SS   L 
Sbjct  84   GCMMAVDEATFGVIAYSENARDLLDLTPQSVPNLEKPEILT-IGTDVRTLFTPSSAVLLE  142

Query  463  KA  468
            KA
Sbjct  143  KA  144



>gb|AEA50884.1| phyB1 [Populus tremula]
Length=695

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 93/139 (67%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LG      P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGFTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>ref|XP_002312330.2| Phytochrome B family protein [Populus trichocarpa]
 gb|EEE89697.2| Phytochrome B family protein [Populus trichocarpa]
Length=1142

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>gb|ADO62149.1| phytochrome B, partial [Helianthus annuus]
Length=262

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 5/121 (4%)
 Frame = +1

Query  118  AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPFG  297
            AIAQY  DA+L A +EQS ESGKSFDYS+S+     ++ E++MTAYLS+IQRGG IQPFG
Sbjct  1    AIAQYALDARLHAVYEQSGESGKSFDYSQSIKTTTDSIAEQQMTAYLSKIQRGGHIQPFG  60

Query  298  CMLAIEEPSFKIVGFSENCFDLLGLKSGVEP----PERMSLIGIDARTLFTLSSRASLAK  465
            CM+AI+  +F+++ FSEN  + LGL     P    PE ++ IG D +TLFT SS   L +
Sbjct  61   CMIAIDNTTFRVIAFSENARERLGLAPQSVPSLDKPEILT-IGTDVKTLFTPSSALLLER  119

Query  466  A  468
            A
Sbjct  120  A  120



>gb|ADO62060.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62061.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62062.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62063.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62064.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62065.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62066.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62067.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62068.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62069.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62070.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62071.1| phytochrome B, partial [Helianthus argophyllus]
 gb|ADO62072.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62073.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62074.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62075.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62076.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62077.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62078.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62079.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62080.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62081.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62082.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62083.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62084.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62085.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62086.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62087.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62088.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62089.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62090.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62091.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62092.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62093.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62094.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62095.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62096.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62097.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62098.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62099.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62100.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62101.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62102.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62103.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62104.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62105.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62107.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62108.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62110.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62111.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62112.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62113.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62114.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62115.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62116.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62117.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62118.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62119.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62120.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62121.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62122.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62123.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62124.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62125.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62126.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62127.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62128.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62129.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62130.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62131.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62132.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62133.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62134.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62135.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62137.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62138.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62139.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62140.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62141.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62142.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62143.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62144.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62145.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62146.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62147.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62148.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62150.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62151.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62152.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62153.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62154.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62155.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62156.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62157.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62158.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62160.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62161.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62162.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62163.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62164.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62166.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62167.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62168.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62169.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62170.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62171.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62172.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62173.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62174.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62175.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62176.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62177.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62178.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62179.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62180.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62182.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62183.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62186.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62187.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62188.1| phytochrome B, partial [Helianthus annuus]
 gb|ADO62189.1| phytochrome B, partial [Helianthus annuus]
Length=262

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 5/121 (4%)
 Frame = +1

Query  118  AIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPFG  297
            AIAQY  DA+L A +EQS ESGKSFDYS+S+     ++ E++MTAYLS+IQRGG IQPFG
Sbjct  1    AIAQYALDARLHAVYEQSGESGKSFDYSQSIKTTTDSIAEQQMTAYLSKIQRGGHIQPFG  60

Query  298  CMLAIEEPSFKIVGFSENCFDLLGLKSGVEP----PERMSLIGIDARTLFTLSSRASLAK  465
            CM+AI+  +F+++ FSEN  + LGL     P    PE ++ IG D +TLFT SS   L +
Sbjct  61   CMIAIDNTTFRVIAFSENARERLGLAPQSVPSLDKPEILT-IGTDVKTLFTPSSALLLER  119

Query  466  A  468
            A
Sbjct  120  A  120



>sp|P34094.2|PHYB_SOLTU RecName: Full=Phytochrome B [Solanum tuberosum]
 emb|CAA74908.1| phytochrome B [Solanum tuberosum]
Length=1130

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  91   ATSNLN----TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
             TSN+N      KAIAQY ADA+L A FEQS ESGK FDYS+SV    Q+V E ++TAYL
Sbjct  21   GTSNVNYKDSISKAIAQYTADARLHAVFEQSGESGKFFDYSQSVKTTTQSVPERQITAYL  80

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSL--IGIDART  429
            ++IQRGG IQPFGCM+A++E SF+++ +SEN  ++L L     P  E+  +  IG D RT
Sbjct  81   TKIQRGGHIQPFGCMIAVDEASFRVIAYSENACEMLSLTPQSVPSLEKCEILTIGTDVRT  140

Query  430  LFTLSSRASLAKA  468
            LFT SS   L +A
Sbjct  141  LFTPSSSVLLERA  153



>ref|XP_006358209.1| PREDICTED: phytochrome B [Solanum tuberosum]
Length=1130

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  91   ATSNLN----TGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYL  258
             TSN+N      KAIAQY ADA+L A FEQS ESGK FDYS+SV    Q+V E ++TAYL
Sbjct  21   GTSNVNYKDSISKAIAQYTADARLHAVFEQSGESGKFFDYSQSVKTTTQSVPERQITAYL  80

Query  259  SRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSL--IGIDART  429
            ++IQRGG IQPFGCM+A++E SF+++ +SEN  ++L L     P  E+  +  IG D RT
Sbjct  81   TKIQRGGHIQPFGCMIAVDEASFRVIAYSENACEMLSLTPQSVPSLEKCEILTIGTDVRT  140

Query  430  LFTLSSRASLAKA  468
            LFT SS   L +A
Sbjct  141  LFTPSSSVLLERA  153



>gb|AAG25725.1|AF309806_1 phytochrome B1 [Populus trichocarpa]
Length=1151

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>ref|XP_011019938.1| PREDICTED: phytochrome B isoform X2 [Populus euphratica]
Length=1140

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNIRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSE  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>ref|XP_011019931.1| PREDICTED: phytochrome B isoform X1 [Populus euphratica]
Length=1142

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  23   SSGTSNIRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  82

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  
Sbjct  83   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSE  142

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  143  GTDVRTLFRPSSSAMLEKA  161



>ref|XP_008360244.1| PREDICTED: phytochrome B-like isoform X2 [Malus domestica]
Length=1047

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 94/139 (68%), Gaps = 12/139 (9%)
 Frame = +1

Query  85   SSATSNL----NT---GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            SS TSN+    NT    KAIAQY  DA+L   FEQS ESGKSFDYS+S+     +V E++
Sbjct  7    SSGTSNIKAHHNTESMSKAIAQYTVDARLHTVFEQSGESGKSFDYSQSMKTTKDSVPEQQ  66

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSG----VEPPERMSLI  411
            +TAYLSRIQRGG +QPFGCM+A++E +F ++ +SEN  D+L L       +E PE ++ I
Sbjct  67   ITAYLSRIQRGGHVQPFGCMMAVDEATFGVIAYSENGRDMLDLTPQSVPILEKPEILT-I  125

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLFT SS   L KA
Sbjct  126  GTDIRTLFTPSSAVLLEKA  144



>ref|XP_008360243.1| PREDICTED: phytochrome B-like isoform X1 [Malus domestica]
Length=1120

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 94/139 (68%), Gaps = 12/139 (9%)
 Frame = +1

Query  85   SSATSNL----NT---GKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEE  243
            SS TSN+    NT    KAIAQY  DA+L   FEQS ESGKSFDYS+S+     +V E++
Sbjct  7    SSGTSNIKAHHNTESMSKAIAQYTVDARLHTVFEQSGESGKSFDYSQSMKTTKDSVPEQQ  66

Query  244  MTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSG----VEPPERMSLI  411
            +TAYLSRIQRGG +QPFGCM+A++E +F ++ +SEN  D+L L       +E PE ++ I
Sbjct  67   ITAYLSRIQRGGHVQPFGCMMAVDEATFGVIAYSENGRDMLDLTPQSVPILEKPEILT-I  125

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLFT SS   L KA
Sbjct  126  GTDIRTLFTPSSAVLLEKA  144



>gb|AEK06044.1| phytochrome B1, partial [Populus balsamifera]
Length=928

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE++TAYLS+IQRGG IQPF
Sbjct  17   KAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEEQITAYLSKIQRGGHIQPF  76

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--GIDARTLFTLSSRASLAK  465
            GCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  G D RTLF  SS A L K
Sbjct  77   GCMIAVDEGSFRVIAYSENAKEMLGLTPQSXPSLDKQEILSDGTDVRTLFRPSSSAMLEK  136

Query  466  A  468
            A
Sbjct  137  A  137



>ref|XP_011100755.1| PREDICTED: phytochrome B-like [Sesamum indicum]
Length=1145

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 89/122 (73%), Gaps = 5/122 (4%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KA+AQY  DA+L A FEQS ESGKSFDYS+S+    Q+V E+++TAYLS++QRGG IQPF
Sbjct  58   KAVAQYTLDARLHAVFEQSGESGKSFDYSQSIRTTNQSVPEQQITAYLSKMQRGGRIQPF  117

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP----PERMSLIGIDARTLFTLSSRASLA  462
            GCM+A+++ SF+++ +SEN  ++LGL     P    PE ++ IG D RTLFT SS   L 
Sbjct  118  GCMIAVDDSSFRVLAYSENAREMLGLSPQSVPTLQRPEILT-IGTDVRTLFTPSSSVLLE  176

Query  463  KA  468
            +A
Sbjct  177  RA  178



>gb|AEK06055.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06056.1| phytochrome B1, partial [Populus balsamifera]
Length=928

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE++TAYLS+IQRGG IQPF
Sbjct  17   KAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEEQITAYLSKIQRGGHIQPF  76

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--GIDARTLFTLSSRASLAK  465
            GCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  G D RTLF  SS A L K
Sbjct  77   GCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSDGTDVRTLFRPSSSAMLEK  136

Query  466  A  468
            A
Sbjct  137  A  137



>ref|XP_007147366.1| hypothetical protein PHAVU_006G118200g [Phaseolus vulgaris]
 gb|ESW19360.1| hypothetical protein PHAVU_006G118200g [Phaseolus vulgaris]
Length=1132

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 87/125 (70%), Gaps = 4/125 (3%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS ESG+SFDYS+S+   P++V E+++TAYL +IQRGG IQPF
Sbjct  35   KAIAQYTEDARLHAVFEQSGESGRSFDYSQSIRLTPESVPEQQITAYLLKIQRGGFIQPF  94

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPPERMSL----IGIDARTLFTLSSRASLA  462
            G M+A+ EPSF+I+ +SEN  D+LG+     P     L    +G D RTLFT SS   L 
Sbjct  95   GSMIAVGEPSFRILAYSENARDMLGITPQSVPSIDDKLDAFALGADVRTLFTQSSALLLE  154

Query  463  KAVAS  477
            KA A+
Sbjct  155  KAFAA  159



>gb|AEK06039.1| phytochrome B1, partial [Populus balsamifera]
Length=928

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE++TAYLS+IQRGG IQPF
Sbjct  17   KAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEEQITAYLSKIQRGGHIQPF  76

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--GIDARTLFTLSSRASLAK  465
            GCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  G D RTLF  SS A L K
Sbjct  77   GCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSDGTDVRTLFRPSSSAMLEK  136

Query  466  A  468
            A
Sbjct  137  A  137



>gb|AEK06040.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06041.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06042.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06043.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06045.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06046.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06047.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06048.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06049.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06050.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06051.1| phytochrome B1, partial [Populus balsamifera]
Length=928

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE++TAYLS+IQRGG IQPF
Sbjct  17   KAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEEQITAYLSKIQRGGHIQPF  76

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--GIDARTLFTLSSRASLAK  465
            GCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  G D RTLF  SS A L K
Sbjct  77   GCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSDGTDVRTLFRPSSSAMLEK  136

Query  466  A  468
            A
Sbjct  137  A  137



>gb|AEK06052.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06053.1| phytochrome B1, partial [Populus balsamifera]
 gb|AEK06054.1| phytochrome B1, partial [Populus balsamifera]
Length=928

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE++TAYLS+IQRGG IQPF
Sbjct  17   KAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEEQITAYLSKIQRGGHIQPF  76

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--GIDARTLFTLSSRASLAK  465
            GCM+A++E SF+++ +SEN  ++LGL     P  ++  ++  G D RTLF  SS A L K
Sbjct  77   GCMIAVDEGSFRVIAYSENAKEMLGLTPQSVPSLDKQEILSDGTDVRTLFRPSSSAMLEK  136

Query  466  A  468
            A
Sbjct  137  A  137



>emb|CAJ21328.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21299.1| phytochrome B2 [Populus tremula]
Length=1144

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>ref|XP_011071377.1| PREDICTED: phytochrome B [Sesamum indicum]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 91/122 (75%), Gaps = 5/122 (4%)
 Frame = +1

Query  115  KAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEEEMTAYLSRIQRGGLIQPF  294
            KA+AQ+  DA+L A FE+S ESGKSFDYS+SV    ++V E+++TAYLS++QRGG IQPF
Sbjct  51   KAVAQFTVDARLHAVFERSGESGKSFDYSQSVRTTNESVPEQQITAYLSKMQRGGHIQPF  110

Query  295  GCMLAIEEPSFKIVGFSENCFDLLGLK----SGVEPPERMSLIGIDARTLFTLSSRASLA  462
            GCM+A++E +F+++G+SEN  ++LGL       +E PE ++ IG D RTLFT SS   L 
Sbjct  111  GCMIAVDEVNFRVIGYSENAREMLGLTPQSVPSLERPEILT-IGTDVRTLFTPSSSVLLE  169

Query  463  KA  468
            +A
Sbjct  170  RA  171



>emb|CAJ21331.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21295.1| phytochrome B2 [Populus tremula]
Length=1144

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21312.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21304.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21308.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>gb|AEK26584.1| phytochrome B1 [Populus tremula]
Length=1128

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 93/139 (67%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  SGKSFDYS+SV    Q+V EE
Sbjct  21   SSGTSNMRQHHHATESVSKAIAQYTVDAQLHAVFEQSGGSGKSFDYSQSVRTTSQSVPEE  80

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEPP-ERMSLI--  411
            ++TAYLS+IQRGG IQPFGCM+A++E SF+++ +SEN  ++LG      P  ++  ++  
Sbjct  81   QITAYLSKIQRGGHIQPFGCMIAVDEGSFRVIAYSENAKEMLGFTPQSVPSLDKQEILSD  140

Query  412  GIDARTLFTLSSRASLAKA  468
            G D RTLF  SS A L KA
Sbjct  141  GTDVRTLFRPSSSAMLEKA  159



>emb|CAJ21298.1| phytochrome B2 [Populus tremula]
Length=1144

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21297.1| phytochrome B2 [Populus tremula]
Length=1144

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21300.1| phytochrome B2 [Populus tremula]
Length=1144

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21318.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21324.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21317.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21292.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21334.1| phytochrome B2 [Populus tremula]
Length=1144

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21296.1| phytochrome B2 [Populus tremula]
Length=1144

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21319.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21309.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21314.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21316.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21321.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21311.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21310.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21332.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21305.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



>emb|CAJ21322.1| phytochrome B2 [Populus tremula]
Length=1146

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = +1

Query  85   SSATSNL--------NTGKAIAQYNADAKLMAEFEQSRESGKSFDYSRSVIHAPQNVTEE  240
            SS TSN+        +  KAIAQY  DA+L A FEQS  +GKSFDYS+SV    Q+V EE
Sbjct  19   SSGTSNMRQHHHPTESVSKAIAQYTVDAQLHAVFEQSGGTGKSFDYSKSVRTPNQSVPEE  78

Query  241  EMTAYLSRIQRGGLIQPFGCMLAIEEPSFKIVGFSENCFDLLGLKSGVEP---PERMSLI  411
            ++TAYLS+IQRGG IQPFGCM+A +E SF+++ +SEN  D+LGL     P    + +  +
Sbjct  79   QITAYLSKIQRGGHIQPFGCMIAADEQSFRVIAYSENAKDMLGLTPQSVPSLEKQEILFV  138

Query  412  GIDARTLFTLSSRASLAKA  468
            G D R LF  SS   L KA
Sbjct  139  GADVRILFRPSSAVLLEKA  157



Lambda      K        H        a         alpha
   0.315    0.129    0.352    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730