BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004M21

Length=533
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342320.1|  PREDICTED: TBCC domain-containing protein 1-...    239   3e-72   Solanum tuberosum [potatoes]
ref|XP_009629812.1|  PREDICTED: TBCC domain-containing protein 1-...    233   9e-70   Nicotiana tomentosiformis
ref|XP_009629687.1|  PREDICTED: TBCC domain-containing protein 1-...    231   6e-69   Nicotiana tomentosiformis
ref|XP_004249279.1|  PREDICTED: TBCC domain-containing protein 1        230   9e-69   Solanum lycopersicum
ref|XP_006351339.1|  PREDICTED: TBCC domain-containing protein 1-...    230   9e-69   Solanum tuberosum [potatoes]
ref|XP_009772589.1|  PREDICTED: TBCC domain-containing protein 1-...    229   3e-68   Nicotiana sylvestris
ref|XP_009797552.1|  PREDICTED: TBCC domain-containing protein 1-...    226   3e-67   Nicotiana sylvestris
emb|CDP20019.1|  unnamed protein product                                219   2e-64   Coffea canephora [robusta coffee]
ref|XP_008240958.1|  PREDICTED: TBCC domain-containing protein 1 ...    201   8e-58   Prunus mume [ume]
ref|XP_008240959.1|  PREDICTED: TBCC domain-containing protein 1 ...    201   8e-58   Prunus mume [ume]
ref|XP_002278205.1|  PREDICTED: TBCC domain-containing protein 1-...    200   3e-57   Vitis vinifera
ref|XP_007203759.1|  hypothetical protein PRUPE_ppa003584mg             198   8e-57   Prunus persica
ref|XP_010548390.1|  PREDICTED: TBCC domain-containing protein 1-...    197   3e-56   Tarenaya hassleriana [spider flower]
gb|KDO57724.1|  hypothetical protein CISIN_1g041482mg                   186   4e-56   Citrus sinensis [apfelsine]
gb|KJB82777.1|  hypothetical protein B456_013G212400                    191   8e-56   Gossypium raimondii
ref|NP_181752.3|  C-CAP/cofactor C-like domain-containing protein       194   2e-55   
ref|NP_973669.1|  C-CAP/cofactor C-like domain-containing protein       194   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010524365.1|  PREDICTED: TBCC domain-containing protein 1-...    194   4e-55   Tarenaya hassleriana [spider flower]
gb|KJB82778.1|  hypothetical protein B456_013G212400                    191   5e-55   Gossypium raimondii
ref|XP_008367539.1|  PREDICTED: TBCC domain-containing protein 1-...    189   5e-55   
ref|XP_009369834.1|  PREDICTED: TBCC domain-containing protein 1-...    193   6e-55   Pyrus x bretschneideri [bai li]
ref|XP_009369843.1|  PREDICTED: TBCC domain-containing protein 1-...    193   6e-55   Pyrus x bretschneideri [bai li]
ref|XP_003554199.1|  PREDICTED: TBCC domain-containing protein 1-...    193   6e-55   Glycine max [soybeans]
ref|XP_008392091.1|  PREDICTED: TBCC domain-containing protein 1        193   7e-55   
gb|KHF98763.1|  TBCC domain-containing 1                                194   8e-55   Gossypium arboreum [tree cotton]
ref|XP_009376106.1|  PREDICTED: TBCC domain-containing protein 1-...    193   9e-55   Pyrus x bretschneideri [bai li]
ref|XP_003520533.1|  PREDICTED: TBCC domain-containing protein 1-...    192   1e-54   Glycine max [soybeans]
ref|XP_003554198.1|  PREDICTED: TBCC domain-containing protein 1-...    192   2e-54   Glycine max [soybeans]
ref|XP_010265832.1|  PREDICTED: TBCC domain-containing protein 1-...    191   2e-54   
ref|XP_008393107.1|  PREDICTED: uncharacterized protein LOC103455298    189   2e-54   
ref|XP_010111391.1|  TBCC domain-containing protein 1                   194   3e-54   
ref|XP_011468069.1|  PREDICTED: TBCC domain-containing protein 1 ...    191   4e-54   Fragaria vesca subsp. vesca
ref|XP_004304384.1|  PREDICTED: TBCC domain-containing protein 1 ...    191   4e-54   Fragaria vesca subsp. vesca
ref|XP_003521203.1|  PREDICTED: TBCC domain-containing protein 1-...    191   4e-54   Glycine max [soybeans]
ref|XP_010265831.1|  PREDICTED: TBCC domain-containing protein 1-...    191   4e-54   Nelumbo nucifera [Indian lotus]
gb|AGJ83863.1|  tublin binding cofactor C                               191   6e-54   Gossypium hirsutum [American cotton]
ref|XP_010507501.1|  PREDICTED: uncharacterized protein LOC104784134    189   6e-54   Camelina sativa [gold-of-pleasure]
gb|KJB82780.1|  hypothetical protein B456_013G212400                    190   7e-54   Gossypium raimondii
emb|CDX79886.1|  BnaA05g02700D                                          191   7e-54   
ref|XP_010257397.1|  PREDICTED: TBCC domain-containing protein 1-...    190   1e-53   Nelumbo nucifera [Indian lotus]
gb|KFK35082.1|  hypothetical protein AALP_AA5G233000                    190   1e-53   Arabis alpina [alpine rockcress]
ref|XP_006402830.1|  hypothetical protein EUTSA_v10005862mg             190   1e-53   Eutrema salsugineum [saltwater cress]
gb|KJB82776.1|  hypothetical protein B456_013G212400                    190   1e-53   Gossypium raimondii
ref|NP_567059.1|  Tubulin binding cofactor C domain-containing pr...    189   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427682.1|  PREDICTED: TBCC domain-containing protein 1-...    189   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007162298.1|  hypothetical protein PHAVU_001G140300g             189   2e-53   Phaseolus vulgaris [French bean]
ref|NP_001190120.1|  Tubulin binding cofactor C domain-containing...    189   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KDP24597.1|  hypothetical protein JCGZ_25513                         189   3e-53   Jatropha curcas
ref|XP_010516427.1|  PREDICTED: TBCC domain-containing protein 1-...    189   3e-53   Camelina sativa [gold-of-pleasure]
gb|KJB15037.1|  hypothetical protein B456_002G156800                    188   4e-53   Gossypium raimondii
ref|XP_006290821.1|  hypothetical protein CARUB_v10016930mg             189   4e-53   Capsella rubella
gb|KHN07410.1|  TBCC domain-containing protein 1                        188   5e-53   Glycine soja [wild soybean]
ref|XP_002876443.1|  hypothetical protein ARALYDRAFT_486241             188   5e-53   
emb|CDX98257.1|  BnaC06g16180D                                          188   5e-53   
ref|XP_007162300.1|  hypothetical protein PHAVU_001G140500g             188   6e-53   Phaseolus vulgaris [French bean]
gb|KHG16745.1|  TBCC domain-containing 1                                188   6e-53   Gossypium arboreum [tree cotton]
gb|KJB15036.1|  hypothetical protein B456_002G156800                    188   7e-53   Gossypium raimondii
gb|KJB15038.1|  hypothetical protein B456_002G156800                    188   8e-53   Gossypium raimondii
ref|XP_009104081.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    187   1e-52   Brassica rapa
gb|EYU39914.1|  hypothetical protein MIMGU_mgv1a003654mg                187   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_009139004.1|  PREDICTED: TBCC domain-containing protein 1-...    187   2e-52   Brassica rapa
emb|CDX67713.1|  BnaA07g17530D                                          187   2e-52   
ref|XP_009142814.1|  PREDICTED: TBCC domain-containing protein 1        187   2e-52   Brassica rapa
ref|XP_007028946.1|  Tubulin binding cofactor C domain-containing...    186   2e-52   
emb|CDY53502.1|  BnaC04g02540D                                          187   2e-52   Brassica napus [oilseed rape]
ref|XP_006411483.1|  hypothetical protein EUTSA_v10016442mg             186   3e-52   Eutrema salsugineum [saltwater cress]
emb|CDY61748.1|  BnaA04g27540D                                          186   4e-52   Brassica napus [oilseed rape]
gb|KJB16388.1|  hypothetical protein B456_002G228100                    186   4e-52   Gossypium raimondii
ref|XP_006437044.1|  hypothetical protein CICLE_v10031101mg             186   5e-52   Citrus clementina [clementine]
ref|XP_010672700.1|  PREDICTED: TBCC domain-containing protein 1        185   6e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009116487.1|  PREDICTED: TBCC domain-containing protein 1        185   7e-52   Brassica rapa
gb|KGN54813.1|  hypothetical protein Csa_4G507430                       185   8e-52   Cucumis sativus [cucumbers]
ref|XP_004156008.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    185   9e-52   
ref|XP_004146385.1|  PREDICTED: TBCC domain-containing protein 1-...    185   1e-51   Cucumis sativus [cucumbers]
ref|XP_006485027.1|  PREDICTED: TBCC domain-containing protein 1-...    184   2e-51   Citrus sinensis [apfelsine]
emb|CAB67617.1|  putative protein                                       184   2e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47657.1|  BnaC04g23940D                                          184   3e-51   Brassica napus [oilseed rape]
gb|EPS74445.1|  hypothetical protein M569_00304                         183   5e-51   Genlisea aurea
gb|KJB36105.1|  hypothetical protein B456_006G141400                    182   5e-51   Gossypium raimondii
gb|KJB36106.1|  hypothetical protein B456_006G141400                    182   9e-51   Gossypium raimondii
ref|XP_011078850.1|  PREDICTED: TBCC domain-containing protein 1-...    182   9e-51   Sesamum indicum [beniseed]
ref|XP_004497930.1|  PREDICTED: TBCC domain-containing protein 1-...    181   2e-50   Cicer arietinum [garbanzo]
ref|XP_002532335.1|  conserved hypothetical protein                     181   3e-50   Ricinus communis
gb|KHG18606.1|  TBCC domain-containing 1                                181   3e-50   Gossypium arboreum [tree cotton]
ref|XP_006381055.1|  tubulin-specific chaperone C-related family ...    181   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002323291.1|  tubulin-specific chaperone C-related family ...    180   4e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010517737.1|  PREDICTED: TBCC domain-containing protein 1-...    180   6e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010943570.1|  PREDICTED: TBCC domain-containing protein 1-...    180   6e-50   Elaeis guineensis
ref|XP_006293916.1|  hypothetical protein CARUB_v10022907mg             179   8e-50   
ref|XP_008800652.1|  PREDICTED: TBCC domain-containing protein 1-...    179   1e-49   Phoenix dactylifera
ref|XP_010508603.1|  PREDICTED: TBCC domain-containing protein 1-...    177   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_011020269.1|  PREDICTED: TBCC domain-containing protein 1 ...    176   2e-48   Populus euphratica
ref|XP_011020268.1|  PREDICTED: TBCC domain-containing protein 1 ...    176   2e-48   Populus euphratica
ref|XP_011020267.1|  PREDICTED: TBCC domain-containing protein 1 ...    176   2e-48   Populus euphratica
ref|XP_011033250.1|  PREDICTED: TBCC domain-containing protein 1 ...    175   3e-48   Populus euphratica
ref|XP_011033249.1|  PREDICTED: TBCC domain-containing protein 1 ...    175   4e-48   Populus euphratica
ref|XP_010506033.1|  PREDICTED: TBCC domain-containing protein 1-...    175   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008442093.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    172   6e-47   Cucumis melo [Oriental melon]
ref|XP_002881827.1|  hypothetical protein ARALYDRAFT_483312             171   1e-46   
gb|KHN26370.1|  TBCC domain-containing protein 1                        171   1e-46   Glycine soja [wild soybean]
ref|XP_010928451.1|  PREDICTED: TBCC domain-containing protein 1 ...    171   2e-46   
ref|XP_010928450.1|  PREDICTED: TBCC domain-containing protein 1 ...    171   2e-46   
emb|CDY06067.1|  BnaA09g37130D                                          168   6e-46   
ref|XP_011075175.1|  PREDICTED: TBCC domain-containing protein 1-...    167   2e-45   Sesamum indicum [beniseed]
ref|XP_006850073.1|  hypothetical protein AMTR_s00022p00213770          167   3e-45   Amborella trichopoda
emb|CDX71986.1|  BnaC08g28880D                                          167   3e-45   
gb|KHN26369.1|  TBCC domain-containing protein 1                        167   3e-45   Glycine soja [wild soybean]
ref|XP_009391882.1|  PREDICTED: TBCC domain-containing protein 1-...    164   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795746.1|  PREDICTED: LOW QUALITY PROTEIN: TBCC domain-...    162   2e-43   Phoenix dactylifera
ref|XP_008787292.1|  PREDICTED: TBCC domain-containing protein 1-...    159   2e-42   Phoenix dactylifera
ref|XP_009411800.1|  PREDICTED: TBCC domain-containing protein 1-...    159   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004493562.1|  PREDICTED: TBCC domain-containing protein 1-...    157   9e-42   Cicer arietinum [garbanzo]
ref|XP_010913921.1|  PREDICTED: TBCC domain-containing protein 1-...    155   3e-41   Elaeis guineensis
gb|ABR16182.1|  unknown                                                 152   9e-40   Picea sitchensis
gb|KEH41654.1|  tubulin-binding cofactor C domain protein               149   1e-38   Medicago truncatula
ref|XP_003625224.1|  TBCC domain-containing protein                     146   1e-37   
ref|XP_010038901.1|  PREDICTED: TBCC domain-containing protein 1        143   1e-36   
ref|XP_003563624.1|  PREDICTED: TBCC domain-containing protein 1-...    134   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_002986516.1|  hypothetical protein SELMODRAFT_182480             133   4e-33   
ref|XP_002964936.1|  hypothetical protein SELMODRAFT_439144             129   2e-31   Selaginella moellendorffii
gb|EEC80975.1|  hypothetical protein OsI_23703                          128   2e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_001058077.1|  Os06g0614300                                       128   4e-31   
dbj|BAJ93674.1|  predicted protein                                      122   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010233970.1|  PREDICTED: TBCC domain-containing protein 1-...    119   5e-28   Brachypodium distachyon [annual false brome]
ref|XP_003571239.1|  PREDICTED: TBCC domain-containing protein 1-...    119   5e-28   Brachypodium distachyon [annual false brome]
ref|XP_001757659.1|  predicted protein                                  118   2e-27   
gb|AFW66196.1|  hypothetical protein ZEAMMB73_400795                    117   2e-27   
ref|XP_004965884.1|  PREDICTED: TBCC domain-containing protein 1-...    117   2e-27   Setaria italica
gb|AAB88648.1|  hypothetical protein                                    116   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ACN28202.1|  unknown                                                 117   4e-27   Zea mays [maize]
ref|XP_002453473.1|  hypothetical protein SORBIDRAFT_04g006490          117   4e-27   Sorghum bicolor [broomcorn]
dbj|BAJ90629.1|  predicted protein                                      117   5e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE66013.1|  hypothetical protein OsJ_21970                          115   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008643390.1|  PREDICTED: hypothetical protein isoform X2         114   3e-26   Zea mays [maize]
ref|XP_008643389.1|  PREDICTED: hypothetical protein isoform X1         114   3e-26   Zea mays [maize]
ref|NP_001144767.1|  hypothetical protein                               114   3e-26   Zea mays [maize]
gb|AFN53653.1|  putative G-patch domain protein                         113   6e-26   Linum usitatissimum
ref|XP_004951581.1|  PREDICTED: TBCC domain-containing protein 1-...    112   1e-25   Setaria italica
ref|XP_001778693.1|  predicted protein                                  112   2e-25   
gb|AFW76295.1|  hypothetical protein ZEAMMB73_911559                    110   4e-25   
ref|NP_001168301.1|  hypothetical protein                               110   8e-25   Zea mays [maize]
ref|XP_008657282.1|  PREDICTED: spidroin-1-like                         103   4e-23   
gb|EEC72669.1|  hypothetical protein OsI_06222                          105   5e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_001758135.1|  predicted protein                                  103   2e-22   
ref|NP_001046181.1|  Os02g0194800                                       103   2e-22   
emb|CBI30042.3|  unnamed protein product                              94.4    2e-19   Vitis vinifera
ref|XP_001765734.1|  predicted protein                                84.3    1e-15   
gb|EMS61357.1|  hypothetical protein TRIUR3_14905                     75.1    2e-14   Triticum urartu
ref|XP_006657134.1|  PREDICTED: TBCC domain-containing protein 1-...  77.0    3e-13   Oryza brachyantha
ref|XP_006648417.1|  PREDICTED: TBCC domain-containing protein 1-...  75.5    9e-13   Oryza brachyantha
gb|EEE56495.1|  hypothetical protein OsJ_05741                        74.7    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656241.1|  PREDICTED: uncharacterized protein LOC103635607  67.8    5e-11   Zea mays [maize]
ref|XP_002505027.1|  predicted protein                                49.7    4e-04   Micromonas commoda



>ref|XP_006342320.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Solanum 
tuberosum]
Length=567

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +3

Query  114  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  293
            P YIHPRR+PFEHGLL I KLIFTDGTQTLGPIKDKLLSLS++S +RVN +S++E+LQIS
Sbjct  18   PAYIHPRRDPFEHGLLPIPKLIFTDGTQTLGPIKDKLLSLSSESTYRVNPESIAESLQIS  77

Query  294  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  473
            PD A+L+LET+A VLH+ SDPLV+A P+E+ SVGVNVFDLVVFLYIQSYKRLLPKGHKDS
Sbjct  78   PDQAQLLLETIACVLHSVSDPLVTAKPSEIGSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  137

Query  474  AAVADVWPSTSAFDGXLSAL  533
            AAVADVWPSTSAFDG LSAL
Sbjct  138  AAVADVWPSTSAFDGFLSAL  157



>ref|XP_009629812.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=570

 Score =   233 bits (593),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +3

Query  99   AGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSE  278
            A +  PIYIHPRREPF+HGLL I+KLIFTDGTQTL PI+DKLLSL++ SAHR N ++++E
Sbjct  16   ASSTAPIYIHPRREPFQHGLLPISKLIFTDGTQTLLPIRDKLLSLTSGSAHRANFEAIAE  75

Query  279  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  458
             LQIS +HARLVLET+A+VLH++SDP+V+A P+E+ SVGVNVFDL++FL+IQSYKRLLPK
Sbjct  76   ALQISHEHARLVLETIASVLHSDSDPIVTAKPSEIGSVGVNVFDLMLFLHIQSYKRLLPK  135

Query  459  GHKDSAAVADVWPSTSAFDGXLSAL  533
            GHKDSAAVADVWPSTSAFDG LSAL
Sbjct  136  GHKDSAAVADVWPSTSAFDGFLSAL  160



>ref|XP_009629687.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=572

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 129/145 (89%), Gaps = 5/145 (3%)
 Frame = +3

Query  114  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSAD-----SAHRVNSKSVSE  278
            PIYIHPRREPFEHGLL I KLIFTDGTQTLGPIKDKLLS  +      +  RVN++S++E
Sbjct  18   PIYIHPRREPFEHGLLPIPKLIFTDGTQTLGPIKDKLLSSLSSSESSTTHQRVNTESIAE  77

Query  279  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  458
            +LQISP+HARLVLET+A VLH++SDPLV+A P+EV SVGVNVFDLVVFLYIQSYKRLLPK
Sbjct  78   SLQISPEHARLVLETIACVLHSDSDPLVTAKPSEVGSVGVNVFDLVVFLYIQSYKRLLPK  137

Query  459  GHKDSAAVADVWPSTSAFDGXLSAL  533
            GHKDSAAVADVWPSTSAFDG LSAL
Sbjct  138  GHKDSAAVADVWPSTSAFDGFLSAL  162



>ref|XP_004249279.1| PREDICTED: TBCC domain-containing protein 1 [Solanum lycopersicum]
Length=569

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  96   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  275
            +  +  P+YIHPRREPFEHGLL I KLIFTDG QTL  I+DKLLSLS+ S HRVN ++++
Sbjct  14   STASTSPVYIHPRREPFEHGLLPIPKLIFTDGAQTLTQIRDKLLSLSSGSTHRVNFEAIA  73

Query  276  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  455
            E LQIS DHARLV+ET+A+VLH++SDP V+A P+E+ SVGVNVFDL++FLYIQSYKRLLP
Sbjct  74   EALQISHDHARLVIETIASVLHSDSDPSVTAKPSEIGSVGVNVFDLMMFLYIQSYKRLLP  133

Query  456  KGHKDSAAVADVWPSTSAFDGXLSAL  533
            KGHKDSAAVADVWPSTSAFDG LSAL
Sbjct  134  KGHKDSAAVADVWPSTSAFDGFLSAL  159



>ref|XP_006351339.1| PREDICTED: TBCC domain-containing protein 1-like [Solanum tuberosum]
Length=569

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  114  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  293
            P+YIHPRREPFEHGLL I KLIFTDG QTL PI+DKLLSLS+ S HRVN ++++E  QIS
Sbjct  20   PVYIHPRREPFEHGLLPIPKLIFTDGAQTLIPIRDKLLSLSSGSIHRVNFEAIAEAFQIS  79

Query  294  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  473
             DHARLV+ET+A+VLH++SDP V+A P+E+ SVGVNVFDL++FLYIQSYKRLLPKGHKDS
Sbjct  80   HDHARLVIETIASVLHSDSDPSVTAKPSEIGSVGVNVFDLMMFLYIQSYKRLLPKGHKDS  139

Query  474  AAVADVWPSTSAFDGXLSAL  533
            AAVADVWPSTSAFDG LSAL
Sbjct  140  AAVADVWPSTSAFDGFLSAL  159



>ref|XP_009772589.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=568

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  99   AGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSE  278
            A +  PIYIHPRREPF+HGLL I+KLIFTDGTQTL PI+DKLLSL++ SA R N ++++E
Sbjct  14   ASSTAPIYIHPRREPFQHGLLPISKLIFTDGTQTLLPIRDKLLSLTSGSALRANFEAIAE  73

Query  279  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  458
             LQIS +HARLVLET+A+VLH++SDP+V+A P+E+ SVGVNVFDL++FL+IQSYKRLLPK
Sbjct  74   ALQISHEHARLVLETIASVLHSDSDPIVTAKPSEIGSVGVNVFDLMLFLHIQSYKRLLPK  133

Query  459  GHKDSAAVADVWPSTSAFDGXLSAL  533
            GHKDSAAVADVWPSTSAFDG LSAL
Sbjct  134  GHKDSAAVADVWPSTSAFDGFLSAL  158



>ref|XP_009797552.1| PREDICTED: TBCC domain-containing protein 1-like [Nicotiana sylvestris]
Length=572

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 128/145 (88%), Gaps = 5/145 (3%)
 Frame = +3

Query  114  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSAD-----SAHRVNSKSVSE  278
            PIYIHPRREPFEHGLL I KLIFTDGTQTLGPIKDKLLS  +      +  RVN++S++E
Sbjct  18   PIYIHPRREPFEHGLLPIPKLIFTDGTQTLGPIKDKLLSSLSSSESSTTNQRVNTESIAE  77

Query  279  TLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK  458
            +LQIS +HARLVLET+A VLH++SDPLV+A P+EV S+GVNVFDLVVFLYIQSYKRLLPK
Sbjct  78   SLQISLEHARLVLETIACVLHSDSDPLVTAKPSEVGSIGVNVFDLVVFLYIQSYKRLLPK  137

Query  459  GHKDSAAVADVWPSTSAFDGXLSAL  533
            GHKDSAAVADVWPSTSAFDG LSAL
Sbjct  138  GHKDSAAVADVWPSTSAFDGFLSAL  162



>emb|CDP20019.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 4/143 (3%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADS----AHRVNSKSVSETL  284
            IYIHPRREPFEHGLL I KLIF+DGTQ+L  IKDKLLSLS+ S     HRVNS +++ETL
Sbjct  35   IYIHPRREPFEHGLLPIPKLIFSDGTQSLASIKDKLLSLSSSSSSESTHRVNSAAIAETL  94

Query  285  QISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGH  464
            QISPDHARLVL+T+++VLHN++DPLV+A P+E+D VG+ VFDLVVFLY+QSYKRLLPKGH
Sbjct  95   QISPDHARLVLDTISSVLHNDTDPLVNAKPSEIDDVGIGVFDLVVFLYVQSYKRLLPKGH  154

Query  465  KDSAAVADVWPSTSAFDGXLSAL  533
            +DSAAVADVWPSTSAFDG LSAL
Sbjct  155  RDSAAVADVWPSTSAFDGFLSAL  177



>ref|XP_008240958.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Prunus 
mume]
Length=565

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = +3

Query  96   AAGTAEP-IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSV  272
            ++ T +P + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S  S+HRVNS ++
Sbjct  11   SSSTKDPALLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEQS--SSHRVNSAAI  68

Query  273  SETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  452
            SE LQIS DHARLVL+T+A+VLH+ESDPL+ + P  VD VG +V DLV+FLYIQSYK+LL
Sbjct  69   SEVLQISIDHARLVLDTLASVLHSESDPLLKSKPDVVDEVGADVNDLVLFLYIQSYKKLL  128

Query  453  PKGHKDSAAVADVWPSTSAFDGXLSAL  533
            P+ HKDSAAVADVWPSTSAFDG LSAL
Sbjct  129  PRTHKDSAAVADVWPSTSAFDGYLSAL  155



>ref|XP_008240959.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Prunus 
mume]
Length=564

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = +3

Query  96   AAGTAEP-IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSV  272
            ++ T +P + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S  S+HRVNS ++
Sbjct  11   SSSTKDPALLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEQS--SSHRVNSAAI  68

Query  273  SETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  452
            SE LQIS DHARLVL+T+A+VLH+ESDPL+ + P  VD VG +V DLV+FLYIQSYK+LL
Sbjct  69   SEVLQISIDHARLVLDTLASVLHSESDPLLKSKPDVVDEVGADVNDLVLFLYIQSYKKLL  128

Query  453  PKGHKDSAAVADVWPSTSAFDGXLSAL  533
            P+ HKDSAAVADVWPSTSAFDG LSAL
Sbjct  129  PRTHKDSAAVADVWPSTSAFDGYLSAL  155



>ref|XP_002278205.1| PREDICTED: TBCC domain-containing protein 1-like [Vitis vinifera]
Length=568

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +3

Query  111  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSAD-SAHRVNSKSVSETLQ  287
            E ++IHPRREPFEHGLL I KLIFTD   TL P++DKL++ +AD    RV+SK++S+ LQ
Sbjct  17   ESVFIHPRREPFEHGLLPIPKLIFTDPNATLAPLRDKLVAAAADHPTRRVDSKALSDALQ  76

Query  288  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  467
            IS DHARLV++T+ +VLH+++DPLV A  +E+D+VG +V+DL++FLYIQSYKRLLP+ HK
Sbjct  77   ISLDHARLVVDTLTSVLHDDADPLVRAKSSEIDAVGADVYDLILFLYIQSYKRLLPRTHK  136

Query  468  DSAAVADVWPSTSAFDGXLSAL  533
            DSAAVADVWPSTSAFDG LSAL
Sbjct  137  DSAAVADVWPSTSAFDGYLSAL  158



>ref|XP_007203759.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
 gb|EMJ04958.1| hypothetical protein PRUPE_ppa003584mg [Prunus persica]
Length=564

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +3

Query  96   AAGTAEP-IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSV  272
            ++ T +P + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S  S+HRVNS ++
Sbjct  11   SSSTKDPALLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEQS--SSHRVNSAAI  68

Query  273  SETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  452
            SE LQIS DHARLVL+T+A+VL +ESDPL+ + P  VD VG +V DLV+FLYIQSYK+LL
Sbjct  69   SEVLQISIDHARLVLDTLASVLQSESDPLLKSKPDVVDEVGADVNDLVLFLYIQSYKKLL  128

Query  453  PKGHKDSAAVADVWPSTSAFDGXLSAL  533
            P+ HKDSAAVADVWPSTSAFDG LSAL
Sbjct  129  PRTHKDSAAVADVWPSTSAFDGYLSAL  155



>ref|XP_010548390.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=577

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRREPFEHGLL I KLIFTD  QTL P+K KL +  A S +RV S ++SE LQIS 
Sbjct  31   LVIHPRREPFEHGLLPIQKLIFTDPIQTLTPVKQKLAA--AASNNRVGSSALSEALQISG  88

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARLVLET+A+VLH+++DPL+ A P EVDS+G ++ DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  89   DHARLVLETLASVLHSDADPLIRAKPEEVDSIGADLRDLVLFLYIQSYKKLLPRTHKDSA  148

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  149  AVADVWPSTSAFDGYLSAL  167



>gb|KDO57724.1| hypothetical protein CISIN_1g041482mg [Citrus sinensis]
Length=192

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 112/137 (82%), Gaps = 5/137 (4%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLI +D  QTL P+K KL         RVNS++++E+LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLILSDPIQTLIPLKQKL-----APTGRVNSETLAESLQISIDH  81

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            A+LVL T+A+VLH ++DP+V A PAE+DSVG ++ DL++FLYIQSYKRLLP+ HKDSA+V
Sbjct  82   AQLVLNTLASVLHADADPIVKARPAEIDSVGADLRDLILFLYIQSYKRLLPRTHKDSASV  141

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  142  ADVWPSTSAFDGYLSAL  158



>gb|KJB82777.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=357

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  141  AVADVWPSTSAFDGYLSAL  159



>ref|NP_181752.3| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC10092.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=562

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL SL+ +  HRV S ++S+ L IS 
Sbjct  22   LIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASLATN--HRVGSAAISDALSISD  79

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARLVLET+++VLH E+DPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSA
Sbjct  80   DHARLVLETLSSVLHCETDPLVLAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSA  139

Query  477  AVADVWPSTSAFDGXLSAL  533
            +VADVWPSTSAFDG LSAL
Sbjct  140  SVADVWPSTSAFDGYLSAL  158



>ref|NP_973669.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
 gb|AAU05480.1| At2g42230 [Arabidopsis thaliana]
 gb|AAU95425.1| At2g42230 [Arabidopsis thaliana]
 dbj|BAE98485.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10091.1| C-CAP/cofactor C-like domain-containing protein [Arabidopsis 
thaliana]
Length=568

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL SL+ +  HRV S ++S+ L IS 
Sbjct  22   LIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASLATN--HRVGSAAISDALSISD  79

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARLVLET+++VLH E+DPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSA
Sbjct  80   DHARLVLETLSSVLHCETDPLVLAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSA  139

Query  477  AVADVWPSTSAFDGXLSAL  533
            +VADVWPSTSAFDG LSAL
Sbjct  140  SVADVWPSTSAFDGYLSAL  158



>ref|XP_010524365.1| PREDICTED: TBCC domain-containing protein 1-like [Tarenaya hassleriana]
Length=569

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 116/137 (85%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF+D  Q LGP+K+KL++  A S +RV S ++S+ LQIS DH
Sbjct  25   IHPRREPFEHGLLPIQKLIFSDPIQALGPVKEKLVA--AASNNRVGSAALSDALQISGDH  82

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+A+VLH++SDPLV A   EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  83   ARLVLETLASVLHSDSDPLVLAKAEEVDSVGADLRDLILFLYIQSYKKLLPRPHKDSAAV  142

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  143  ADVWPSTSAFDGYLSAL  159



>gb|KJB82778.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=434

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  141  AVADVWPSTSAFDGYLSAL  159



>ref|XP_008367539.1| PREDICTED: TBCC domain-containing protein 1-like [Malus domestica]
Length=381

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            D A+LVL+T+A+VLH+ESD LV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDLLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  137  AVADVWPSTSAFDGYLSAL  155



>ref|XP_009369834.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=565

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  137  AVADVWPSTSAFDGYLSAL  155



>ref|XP_009369843.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=564

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  137  AVADVWPSTSAFDGYLSAL  155



>ref|XP_003554199.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+  ++SE+LQIS +H
Sbjct  21   VHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSN--QRVDLAAISESLQISIEH  78

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A++LH++S+PLV AN  E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASILHSDSEPLVVANLVEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  483  ADVWPSTSAFDGXLSAL  533
             DVWPSTSAFDG LSAL
Sbjct  139  TDVWPSTSAFDGYLSAL  155



>ref|XP_008392091.1| PREDICTED: TBCC domain-containing protein 1 [Malus domestica]
Length=564

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  137  AVADVWPSTSAFDGYLSAL  155



>gb|KHF98763.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=598

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I KLIFTD  Q L P+K KL S S+ S HRVNS ++++ LQIS +H
Sbjct  24   LHPRREPFEHGLLPIQKLIFTDPLQALIPLKQKLASSSSSSTHRVNSDALADALQISSEH  83

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARL+L+T+A+VLH+E DPLV+A+P +VDSVG ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  84   ARLILDTLASVLHSEPDPLVNAHPDDVDSVGSDLSDLILFLYIQSYKRLLPRSHKDSAAV  143

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  144  ADVWPSTSAFDGYLSAL  160



>ref|XP_009376106.1| PREDICTED: TBCC domain-containing protein 1-like [Pyrus x bretschneideri]
Length=564

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSAAISEALQISI  76

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            D A+LVL+T+A+VLH+ESDPLV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDPLVKAKPDGIDEAGADVNDLVLFLYIQSYKKLLPRTHKDSA  136

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  137  AVADVWPSTSAFDGYLSAL  155



>ref|XP_003520533.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=565

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I +LIF+D TQTL  +K KLL LS++   RV+S ++SE+LQI  +H
Sbjct  21   VHPRREPFEHGLLPIPRLIFSDPTQTLISLKQKLLELSSN--QRVDSAAISESLQIPIEH  78

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A++LH++S+PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASILHSDSEPLVAAKLEEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  139  ADVWPSTSAFDGYLSAL  155



>ref|XP_003554198.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Glycine 
max]
Length=566

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I + IF+D  QTL P+K KLL LS++   RV+S ++SE+LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRFIFSDPAQTLIPLKQKLLELSSN--QRVDSAAISESLQISIEH  78

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A+VLH++++PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASVLHSDAEPLVAAKLDEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  483  ADVWPSTSAFDGXLSAL  533
             DVWPSTSAFDG LSAL
Sbjct  139  TDVWPSTSAFDGYLSAL  155



>ref|XP_010265832.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=520

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  290
            EP+++  RREPFE+GLL I+KLIF+D T TLGP+K+KL+  ++ S  R+++  +SE LQI
Sbjct  18   EPVFLRARREPFEYGLLPISKLIFSDRTATLGPLKEKLIQRASSSPPRIDADGISEVLQI  77

Query  291  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  470
            S ++A LVL+T+AAVL ++SDPLVSA P E+ SVG NV DL++FLYIQSYKRLLPK HKD
Sbjct  78   SIENAHLVLDTLAAVLPSDSDPLVSAKPHELGSVGANVDDLILFLYIQSYKRLLPKTHKD  137

Query  471  SAAVADVWPSTSAFDGXLSAL  533
            SA+VADVWPSTSAFDG LSAL
Sbjct  138  SASVADVWPSTSAFDGYLSAL  158



>ref|XP_008393107.1| PREDICTED: uncharacterized protein LOC103455298 [Malus domestica]
Length=450

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRREPFEHGLL I KLIFTD TQTL P+K KL+  S   +HRV+S ++SE LQIS 
Sbjct  19   LLIHPRREPFEHGLLPIPKLIFTDPTQTLIPLKQKLIEKSP--SHRVDSXAISEALQISI  76

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            D A+LVL+T+A+VLH+ESD LV A P  +D  G +V DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  77   DQAKLVLDTLASVLHSESDLLVKAKPDGIDEAGADVHDLVLFLYIQSYKKLLPRTHKDSA  136

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  137  AVADVWPSTSAFDGYLSAL  155



>ref|XP_010111391.1| TBCC domain-containing protein 1 [Morus notabilis]
 gb|EXC30869.1| TBCC domain-containing protein 1 [Morus notabilis]
Length=760

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 116/137 (85%), Gaps = 1/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I KLIFTD TQTL P+K KL+  S+ +  R+++ ++++  QIS DH
Sbjct  32   MHPRREPFEHGLLPIPKLIFTDPTQTLIPLKRKLVEQSS-TGQRISASAIADAFQISIDH  90

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A++LH+ESDPLV A P+E+D VG +V DLV+FLYIQSYKRLLP+ HKDSA+V
Sbjct  91   ARLVLDTLASILHSESDPLVRAKPSEIDDVGADVHDLVLFLYIQSYKRLLPRTHKDSASV  150

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  151  ADVWPSTSAFDGYLSAL  167



>ref|XP_011468069.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 113/137 (82%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF D TQTL P+K KL+  S +  HRVN+ ++SE+LQIS D 
Sbjct  25   IHPRREPFEHGLLSIPKLIFADPTQTLIPLKHKLIEQSPN--HRVNAAAISESLQISIDL  82

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A+VLH ESDPLV A P  +D VG +V DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  83   ARLVLDTLASVLHLESDPLVLAKPDVIDEVGADVHDLVLFLYIQSYKKLLPRTHKDSAAV  142

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  143  ADVWPSTSAFDGYLSAL  159



>ref|XP_004304384.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=569

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 113/137 (82%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF D TQTL P+K KL+  S +  HRVN+ ++SE+LQIS D 
Sbjct  25   IHPRREPFEHGLLSIPKLIFADPTQTLIPLKHKLIEQSPN--HRVNAAAISESLQISIDL  82

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A+VLH ESDPLV A P  +D VG +V DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  83   ARLVLDTLASVLHLESDPLVLAKPDVIDEVGADVHDLVLFLYIQSYKKLLPRTHKDSAAV  142

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  143  ADVWPSTSAFDGYLSAL  159



>ref|XP_003521203.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max]
Length=566

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL  S++   RV+S ++SE+LQIS + 
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLESSSN--QRVDSAAISESLQISIEQ  78

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A+VLH++++PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASVLHSDAEPLVAAKLGEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  139  ADVWPSTSAFDGYLSAL  155



>ref|XP_010265831.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=567

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  111  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  290
            EP+++  RREPFE+GLL I+KLIF+D T TLGP+K+KL+  ++ S  R+++  +SE LQI
Sbjct  18   EPVFLRARREPFEYGLLPISKLIFSDRTATLGPLKEKLIQRASSSPPRIDADGISEVLQI  77

Query  291  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  470
            S ++A LVL+T+AAVL ++SDPLVSA P E+ SVG NV DL++FLYIQSYKRLLPK HKD
Sbjct  78   SIENAHLVLDTLAAVLPSDSDPLVSAKPHELGSVGANVDDLILFLYIQSYKRLLPKTHKD  137

Query  471  SAAVADVWPSTSAFDGXLSAL  533
            SA+VADVWPSTSAFDG LSAL
Sbjct  138  SASVADVWPSTSAFDGYLSAL  158



>gb|AGJ83863.1| tublin binding cofactor C [Gossypium hirsutum]
Length=570

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I KLIFTD  Q L P+K KL S S+ S  RVNS ++++ LQIS +H
Sbjct  24   LHPRREPFEHGLLPIQKLIFTDPLQALIPLKQKLASSSSSSTQRVNSDALADALQISSEH  83

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARL+L+T+A+VLH+E DPLV+A+P +VDSVG ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  84   ARLILDTLASVLHSEPDPLVNAHPDDVDSVGSDLRDLILFLYIQSYKRLLPRSHKDSAAV  143

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  144  ADVWPSTSAFDGYLSAL  160



>ref|XP_010507501.1| PREDICTED: uncharacterized protein LOC104784134 [Camelina sativa]
Length=512

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  33   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  90

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  91   ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  150

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  151  ADVWPSTSAFDGYLSAL  167



>gb|KJB82780.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=534

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  141  AVADVWPSTSAFDGYLSAL  159



>emb|CDX79886.1| BnaA05g02700D [Brassica napus]
Length=582

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR PFEHGLL I  L+FTD  QTL PIK KL S + +  +RV S ++SE L IS DH
Sbjct  23   IHPRRAPFEHGLLPIPNLLFTDPIQTLAPIKQKLASSATN--NRVGSPAISEALSISSDH  80

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+A+VLH+E+DPLV A P EVDS+G +V DLV+F+Y+QSYKRL+P+ HKDSAAV
Sbjct  81   ARLVLETLASVLHSETDPLVVAKPEEVDSIGADVRDLVLFMYVQSYKRLMPRTHKDSAAV  140

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPS SAFDG LSAL
Sbjct  141  ADVWPSASAFDGYLSAL  157



>ref|XP_010257397.1| PREDICTED: TBCC domain-containing protein 1-like [Nelumbo nucifera]
Length=575

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 122/146 (84%), Gaps = 5/146 (3%)
 Frame = +3

Query  111  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH-----RVNSKSVS  275
            EP+++  RREPFE+GLL I+KLIF+DGT TLGP+K+KL+  ++ S+      RV++  +S
Sbjct  20   EPVFLRARREPFEYGLLPISKLIFSDGTATLGPLKEKLIQRASASSPPSSPLRVDADGIS  79

Query  276  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  455
            E LQIS ++ARLVL+T+AAVLH++SDPLVSA+P E+DSVG +V  L++FLYIQSYKRLLP
Sbjct  80   EVLQISIENARLVLDTLAAVLHSDSDPLVSASPQELDSVGADVNYLILFLYIQSYKRLLP  139

Query  456  KGHKDSAAVADVWPSTSAFDGXLSAL  533
            + HKDS AVADVWPSTSAFDG LSAL
Sbjct  140  RTHKDSVAVADVWPSTSAFDGYLSAL  165



>gb|KFK35082.1| hypothetical protein AALP_AA5G233000 [Arabis alpina]
Length=576

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL PIK KL   S +  +RV S +V++ LQIS DH
Sbjct  32   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPIKQKLADASTN--NRVGSVAVADVLQISGDH  89

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  90   ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  149

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  150  ADVWPSTSAFDGYLSAL  166



>ref|XP_006402830.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
 gb|ESQ44283.1| hypothetical protein EUTSA_v10005862mg [Eutrema salsugineum]
Length=573

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S +V++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAVADVLQISGDH  88

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  149  ADVWPSTSAFDGYLSAL  165



>gb|KJB82776.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
 gb|KJB82779.1| hypothetical protein B456_013G212400 [Gossypium raimondii]
Length=569

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSFALRVGSAALADALQISS  80

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARL+L+T+++VLH+ESDPLV+A P +VDS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDVDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  141  AVADVWPSTSAFDGYLSAL  159



>ref|NP_567059.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK96632.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AAL36073.1| AT3g57890/T10K17_100 [Arabidopsis thaliana]
 gb|AEE79713.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=573

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  88

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  149  ADVWPSTSAFDGYLSAL  165



>ref|XP_010427682.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=575

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  32   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  89

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  90   ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  149

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  150  ADVWPSTSAFDGYLSAL  166



>ref|XP_007162298.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
 gb|ESW34292.1| hypothetical protein PHAVU_001G140300g [Phaseolus vulgaris]
Length=566

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 116/137 (85%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I +LIF+D  QTL  +K KLL LS++   RV+S ++SE LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLISLKRKLLQLSSN--QRVDSAAISEALQISIEH  78

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLV++T+A++LH++S+PLV+A   E DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVIDTLASILHSDSEPLVAAKLDEADSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  139  ADVWPSTSAFDGYLSAL  155



>ref|NP_001190120.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE79714.1| Tubulin binding cofactor C domain-containing protein [Arabidopsis 
thaliana]
Length=609

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  88

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  149  ADVWPSTSAFDGYLSAL  165



>gb|KDP24597.1| hypothetical protein JCGZ_25513 [Jatropha curcas]
Length=568

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 113/137 (82%), Gaps = 5/137 (4%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF D TQTL  ++ KL+S       RV+S +++++LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLIFPDPTQTLTQLRQKLVSHP-----RVDSATLADSLQISTDH  81

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A+VLH+E DPLV A P ++DSVG ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  82   ARLVLDTLASVLHSECDPLVKAQPGDIDSVGADLHDLILFLYIQSYKRLLPRTHKDSAAV  141

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  142  ADVWPSTSAFDGYLSAL  158



>ref|XP_010516427.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010516428.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=612

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  68   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  125

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  126  ARLVLETLGSVLHSESDPLVKAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  185

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  186  ADVWPSTSAFDGYLSAL  202



>gb|KJB15037.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=536

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I KLIF D  Q L P+K K  S    S  RV+S +++E LQIS DH
Sbjct  24   LHPRREPFEHGLLTIQKLIFNDPVQALTPLKQKFAS---PSTQRVDSAALAELLQISFDH  80

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            +RLVLET+A+VLH+ESDPLV+A P +VDS+G ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  81   SRLVLETLASVLHSESDPLVTALPDDVDSIGADLRDLILFLYIQSYKRLLPRSHKDSAAV  140

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPS SAFDG LSAL
Sbjct  141  ADVWPSMSAFDGYLSAL  157



>ref|XP_006290821.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 ref|XP_006290822.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23719.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
 gb|EOA23720.1| hypothetical protein CARUB_v10016930mg [Capsella rubella]
Length=573

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  29   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNYRVGSAAIADVLQISGDH  86

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDS+G ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  87   ARLVLETLGSVLHSESDPLVKAKPEEVDSLGADLRDLILFLYIQSYKKLLPRTHKDSAAV  146

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  147  ADVWPSTSAFDGYLSAL  163



>gb|KHN07410.1| TBCC domain-containing protein 1 [Glycine soja]
Length=566

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 116/137 (85%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL  S++   RV+S ++SE+LQIS + 
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLESSSN--QRVDSAAISESLQISIEQ  78

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A+VLH++++PLV+A   E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLASVLHSDAEPLVAAKLDEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  138

Query  483  ADVWPSTSAFDGXLSAL  533
             DVWPSTSAFDG LSAL
Sbjct  139  TDVWPSTSAFDGYLSAL  155



>ref|XP_002876443.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52702.1| hypothetical protein ARALYDRAFT_486241 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S  +++ LQIS DH
Sbjct  29   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAVIADVLQISGDH  86

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  87   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  146

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  147  ADVWPSTSAFDGYLSAL  163



>emb|CDX98257.1| BnaC06g16180D [Brassica napus]
Length=590

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    + S +RV S ++++ LQIS DH
Sbjct  23   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKHKLTE--SASNNRVGSAAIADVLQISGDH  80

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  81   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  140

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  141  ADVWPSTSAFDGYLSAL  157



>ref|XP_007162300.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
 gb|ESW34294.1| hypothetical protein PHAVU_001G140500g [Phaseolus vulgaris]
Length=565

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 116/137 (85%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+S ++S++LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLQLSSN--QRVDSVAISDSLQISIEH  78

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            A+LVL+T+A++LH++S+PL  A   E+DSVGV+V DLV+FLYIQSYKR+LP+ HKDS AV
Sbjct  79   AKLVLDTLASILHSDSEPLTVAKFGEIDSVGVDVHDLVLFLYIQSYKRILPRTHKDSVAV  138

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  139  ADVWPSTSAFDGFLSAL  155



>gb|KHG16745.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=569

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 114/139 (82%), Gaps = 3/139 (2%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            I +HPRREPFEHGLL I KLIFTD  Q L  +K+KL   S+  A RV S ++++ LQIS 
Sbjct  24   ILLHPRREPFEHGLLPIQKLIFTDPVQALTQLKEKL---SSSLALRVGSAALADALQISS  80

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARL+L+T+++VLH+ESDPLV+A P + DS+G ++ DLV+FLYIQSYKRLLP+ HKDSA
Sbjct  81   DHARLILDTLSSVLHSESDPLVTARPEDFDSIGADLRDLVLFLYIQSYKRLLPRSHKDSA  140

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  141  AVADVWPSTSAFDGYLSAL  159



>gb|KJB15036.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=567

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I KLIF D  Q L P+K K  S    S  RV+S +++E LQIS DH
Sbjct  24   LHPRREPFEHGLLTIQKLIFNDPVQALTPLKQKFAS---PSTQRVDSAALAELLQISFDH  80

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            +RLVLET+A+VLH+ESDPLV+A P +VDS+G ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  81   SRLVLETLASVLHSESDPLVTALPDDVDSIGADLRDLILFLYIQSYKRLLPRSHKDSAAV  140

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPS SAFDG LSAL
Sbjct  141  ADVWPSMSAFDGYLSAL  157



>gb|KJB15038.1| hypothetical protein B456_002G156800 [Gossypium raimondii]
Length=582

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I KLIF D  Q L P+K K  S    S  RV+S +++E LQIS DH
Sbjct  24   LHPRREPFEHGLLTIQKLIFNDPVQALTPLKQKFAS---PSTQRVDSAALAELLQISFDH  80

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            +RLVLET+A+VLH+ESDPLV+A P +VDS+G ++ DL++FLYIQSYKRLLP+ HKDSAAV
Sbjct  81   SRLVLETLASVLHSESDPLVTALPDDVDSIGADLRDLILFLYIQSYKRLLPRSHKDSAAV  140

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPS SAFDG LSAL
Sbjct  141  ADVWPSMSAFDGYLSAL  157



>ref|XP_009104081.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Brassica rapa]
Length=554

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    + S +RV S ++++ LQIS DH
Sbjct  23   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLTE--SASNNRVGSAAIADVLQISGDH  80

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  81   ARLVLETLGSVLHSESDPLVGAKPEEVDSVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  140

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  141  ADVWPSTSAFDGYLSAL  157



>gb|EYU39914.1| hypothetical protein MIMGU_mgv1a003654mg [Erythranthe guttata]
Length=571

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = +3

Query  108  AEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  287
            A    +HPRREPFEHGLL I KLIF DG QTL  +K  LL+  ++S HRV+S++++  LQ
Sbjct  22   ASTFQLHPRREPFEHGLLPIPKLIFNDGVQTLSGLKSTLLA--SNSNHRVSSENLAGVLQ  79

Query  288  ISPDHARLVLETVAAVLHNESDPLVSANPAE-VDSVGVNVFDLVVFLYIQSYKRLLPKGH  464
            I  +H+RLV+ET+++VL+++SDPLV+A+ +E VD +GVNVFDL+VFL IQSYKRLLPKGH
Sbjct  80   IPIEHSRLVIETLSSVLYDDSDPLVTASTSEEVDEIGVNVFDLLVFLCIQSYKRLLPKGH  139

Query  465  KDSAAVADVWPSTSAFDGXLSAL  533
            KDSAAVADVWPSTSAFDG LS L
Sbjct  140  KDSAAVADVWPSTSAFDGFLSVL  162



>ref|XP_009139004.1| PREDICTED: TBCC domain-containing protein 1-like [Brassica rapa]
Length=569

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL FTD  QTL PIK KL    A S +RV S +++E LQIS DH
Sbjct  25   IHPRRVSFEHGLLPIQKLAFTDPIQTLAPIKQKLAD--AASNNRVGSDAIAEALQISGDH  82

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+E DPLV A P EVDSVG ++ DLV+FLY+QSYK+++P+ HKDSAAV
Sbjct  83   ARLVLETLGSVLHSEGDPLVRAKPEEVDSVGADLRDLVLFLYVQSYKKMMPRTHKDSAAV  142

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  143  ADVWPSTSAFDGYLSAL  159



>emb|CDX67713.1| BnaA07g17530D [Brassica napus]
Length=598

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    + S +RV S ++++ LQIS DH
Sbjct  23   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLTE--SASNNRVGSAAIADVLQISGDH  80

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  81   ARLVLETLGSVLHSESDPLVGAKPEEVDSVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  140

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  141  ADVWPSTSAFDGYLSAL  157



>ref|XP_009142814.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=569

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR PFEHGLL I  L+FTD  QTL PIK KL S + +  +RV S ++S+ L IS DH
Sbjct  25   IHPRRVPFEHGLLPIPNLLFTDPIQTLAPIKQKLASSATN--NRVGSPAISDALSISSDH  82

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+A+VLH+E+DPLV A P EVD VG +V DLV+F+Y+QSYKRL+P+ HKDSAAV
Sbjct  83   ARLVLETLASVLHSETDPLVVAKPEEVDLVGADVRDLVLFMYVQSYKRLMPRTHKDSAAV  142

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPS SAFDG LSAL
Sbjct  143  ADVWPSASAFDGYLSAL  159



>ref|XP_007028946.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 ref|XP_007028947.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09448.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY09449.1| Tubulin binding cofactor C domain-containing protein isoform 
1 [Theobroma cacao]
Length=567

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 118/153 (77%), Gaps = 10/153 (7%)
 Frame = +3

Query  96   AAGTAEPI-------YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHR  254
            +  T++PI        +HPRREPFEHGLL I KLIFTD  Q L P+K K  S    S HR
Sbjct  8    STSTSDPIPSRSPTTLLHPRREPFEHGLLPIQKLIFTDPVQALTPLKQKHAS---SSTHR  64

Query  255  VNSKSVSETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQ  434
            V+S ++++ LQIS DHARLVL+T+A+VLH+ESD LV+A   +VDSVG ++ DL++FLYIQ
Sbjct  65   VDSVALADALQISADHARLVLDTLASVLHSESDQLVTARSDDVDSVGADLRDLILFLYIQ  124

Query  435  SYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            SYKRLLP+ HKDSAAVADVWPSTSAFDG LSAL
Sbjct  125  SYKRLLPRSHKDSAAVADVWPSTSAFDGYLSAL  157



>emb|CDY53502.1| BnaC04g02540D [Brassica napus]
Length=599

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR PFEHGLL I  L+F D  QTL PIK KL S + +  +RV S +VSE L IS DH
Sbjct  25   IHPRRVPFEHGLLPIPNLLFADPIQTLAPIKQKLASSATN--NRVGSPAVSEALSISSDH  82

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+A+VLH+E+DPLV A P EVDS+G +V DLV+F+Y+QSYK+L+P+ HKDSAAV
Sbjct  83   ARLVLETLASVLHSETDPLVVAKPEEVDSIGADVRDLVLFMYVQSYKKLMPRTHKDSAAV  142

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPS SAFDG LSAL
Sbjct  143  ADVWPSASAFDGYLSAL  159



>ref|XP_006411483.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
 gb|ESQ52936.1| hypothetical protein EUTSA_v10016442mg [Eutrema salsugineum]
Length=572

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 112/137 (82%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            I+PRR PFEHGLL I KL+FTD  Q L PIK KL S++ +  +RV S ++S+ L IS DH
Sbjct  28   IYPRRVPFEHGLLPIQKLVFTDPIQNLAPIKQKLASVAKN--NRVGSAAISDALLISGDH  85

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+E+DPLV A P EVDS+G ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  86   ARLVLETLGSVLHSETDPLVLAKPEEVDSIGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  145

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  146  ADVWPSTSAFDGYLSAL  162



>emb|CDY61748.1| BnaA04g27540D [Brassica napus]
Length=595

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 108/137 (79%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL FTD  QTL PIK KL    A S +RV S +++E LQIS DH
Sbjct  25   IHPRRVSFEHGLLPIQKLAFTDPIQTLAPIKQKLAD--AASNNRVGSDAIAEALQISGDH  82

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+E DPLV A P EVDSVG ++ DLV+FLY+QSYK+L P+ HKDSAAV
Sbjct  83   ARLVLETLGSVLHSEGDPLVRAKPEEVDSVGADLRDLVLFLYVQSYKKLTPRTHKDSAAV  142

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  143  ADVWPSTSAFDGYLSAL  159



>gb|KJB16388.1| hypothetical protein B456_002G228100 [Gossypium raimondii]
Length=572

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKL--LSLSADSAHRVNSKSVSETLQISP  296
            +HPRREPFEHGLL I KLIFTD  Q L P+K KL   S S+ S HRVNS ++++ LQIS 
Sbjct  24   LHPRREPFEHGLLPIQKLIFTDPLQALIPLKQKLASSSSSSSSTHRVNSDALADALQISS  83

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            +HARL+L+T+A+VLH+E DPLV+A+P +V SVG ++ DL++FLYIQSYKRLLP+ HKDSA
Sbjct  84   EHARLILDTLASVLHSEPDPLVNAHPDDVGSVGSDLRDLILFLYIQSYKRLLPRSHKDSA  143

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  144  AVADVWPSTSAFDGYLSAL  162



>ref|XP_006437044.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
 gb|ESR50284.1| hypothetical protein CICLE_v10031101mg [Citrus clementina]
Length=568

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 112/137 (82%), Gaps = 5/137 (4%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLI +D  QTL P+K KL         RVNS++++E+LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLILSDPIQTLIPLKQKLAPTG-----RVNSETLAESLQISIDH  81

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            A+LVL+T+ +VLH ++DP+V A PAE+DSVG ++ DL++FLYIQSYKRLLP+ HKDSA+V
Sbjct  82   AQLVLDTLGSVLHADADPIVKARPAEIDSVGADLRDLILFLYIQSYKRLLPRTHKDSASV  141

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  142  ADVWPSTSAFDGYLSAL  158



>ref|XP_010672700.1| PREDICTED: TBCC domain-containing protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=568

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +3

Query  111  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLS-LSADSAHRVNSKSVSETLQ  287
            +PI +H RREPFE+GLL I+KLIFTDGT TLG +K+KLL   S+  + RV+  ++++ LQ
Sbjct  19   DPITLHTRREPFEYGLLPISKLIFTDGTATLGSLKEKLLQHASSSDSFRVDLSAIADILQ  78

Query  288  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  467
            IS +H+RLVL+T+A+VL  +SDPLV A P +V ++G NVFDL++FL IQSYKRLLP+ HK
Sbjct  79   ISQEHSRLVLDTLASVLPFDSDPLVVAKPDDVPAIGANVFDLILFLCIQSYKRLLPRTHK  138

Query  468  DSAAVADVWPSTSAFDGXLSAL  533
            DSAAVADVWPSTSAFDG LSAL
Sbjct  139  DSAAVADVWPSTSAFDGYLSAL  160



>ref|XP_009116487.1| PREDICTED: TBCC domain-containing protein 1 [Brassica rapa]
Length=570

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  26   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLAD--AASNNRVGSGAIADALQISGDH  83

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+E DPLV A P EV+SVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  84   ARLVLETLGSVLHSEGDPLVGAKPEEVESVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  143

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  144  ADVWPSTSAFDGYLSAL  160



>gb|KGN54813.1| hypothetical protein Csa_4G507430 [Cucumis sativus]
Length=561

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +3

Query  111  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  287
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+ S +R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSSPS-NRLNSSAISESLQ  78

Query  288  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  467
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDSVGV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNATPHDVDSVGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  468  DSAAVADVWPSTSAFDGXLSAL  533
            DSAAVADVWPSTSAFDG LSAL
Sbjct  139  DSAAVADVWPSTSAFDGYLSAL  160



>ref|XP_004156008.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Cucumis sativus]
Length=570

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +3

Query  111  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  287
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+ S +R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSSPS-NRLNSSAISESLQ  78

Query  288  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  467
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDSVGV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNATPHDVDSVGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  468  DSAAVADVWPSTSAFDGXLSAL  533
            DSAAVADVWPSTSAFDG LSAL
Sbjct  139  DSAAVADVWPSTSAFDGYLSAL  160



>ref|XP_004146385.1| PREDICTED: TBCC domain-containing protein 1-like [Cucumis sativus]
Length=570

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 2/142 (1%)
 Frame = +3

Query  111  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  287
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+ S +R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSSPS-NRLNSSAISESLQ  78

Query  288  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  467
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDSVGV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNATPHDVDSVGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  468  DSAAVADVWPSTSAFDGXLSAL  533
            DSAAVADVWPSTSAFDG LSAL
Sbjct  139  DSAAVADVWPSTSAFDGYLSAL  160



>ref|XP_006485027.1| PREDICTED: TBCC domain-containing protein 1-like [Citrus sinensis]
Length=568

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 112/137 (82%), Gaps = 5/137 (4%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLI +D  QTL P+K KL         RVNS++++E+LQIS DH
Sbjct  27   IHPRREPFEHGLLPIPKLILSDPIQTLIPLKLKLAPTG-----RVNSETLAESLQISIDH  81

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            A+LVL+T+ +VLH ++DP+V A PAE+DSVG ++ DL++FLYIQSYKRLLP+ HKDSA+V
Sbjct  82   AQLVLDTLGSVLHADADPIVKARPAEIDSVGADLRDLILFLYIQSYKRLLPRTHKDSASV  141

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  142  ADVWPSTSAFDGYLSAL  158



>emb|CAB67617.1| putative protein [Arabidopsis thaliana]
Length=570

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 2/136 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+FTD  QTL P+K KL    A S +RV S ++++ LQIS DH
Sbjct  31   IHPRRVSFEHGLLPIQKLVFTDPIQTLAPVKQKLAD--AASNNRVGSAAIADVLQISGDH  88

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+ESDPLV A P EVDSVG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  89   ARLVLETLGSVLHSESDPLVRAKPEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  148

Query  483  ADVWPSTSAFDGXLSA  530
            ADVWPSTSAFDG  ++
Sbjct  149  ADVWPSTSAFDGYFNS  164



>emb|CDY47657.1| BnaC04g23940D [Brassica napus]
Length=648

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 108/137 (79%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPR   FEHGLL I KL FTD  QTL PIK KL    A S +RV S +++E LQIS DH
Sbjct  25   IHPRLVSFEHGLLPIQKLAFTDPIQTLAPIKQKLAD--AASNNRVGSAAIAEALQISGDH  82

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+E DPLV A P EVDSVG ++ DLV+FLY+QSYK+L+P+ HKDSAAV
Sbjct  83   ARLVLETLGSVLHSEGDPLVRAKPEEVDSVGADLRDLVLFLYVQSYKKLMPRTHKDSAAV  142

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  143  ADVWPSTSAFDGYLSAL  159



>gb|EPS74445.1| hypothetical protein M569_00304, partial [Genlisea aurea]
Length=572

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 110/138 (80%), Gaps = 3/138 (2%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +H RREPFEHGLL I KLIFTDG QTL  +K  LLS S+D   RVN++ VS  LQI  +H
Sbjct  24   LHARREPFEHGLLPIPKLIFTDGVQTLSNVKSALLSASSD--ERVNTEIVSAVLQIPIEH  81

Query  303  ARLVLETVAAVLHNESDPLVSAN-PAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  479
            + +++ET++AVLH+ESDPL  A  P E+  +G NVFDL+V LYIQSYKRL+PKGHKDSAA
Sbjct  82   SCILMETLSAVLHDESDPLGRAKTPEEIGGIGANVFDLLVLLYIQSYKRLVPKGHKDSAA  141

Query  480  VADVWPSTSAFDGXLSAL  533
            VADVWPSTSAFDG LSAL
Sbjct  142  VADVWPSTSAFDGFLSAL  159



>gb|KJB36105.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=555

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 3/137 (2%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL + KLIFTD  Q L  +K KL+S    S  RV+S +++++LQIS DH
Sbjct  21   LHPRREPFEHGLLPMQKLIFTDPLQALTSLKQKLVS---SSIQRVDSAALADSLQISLDH  77

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A+VLH+ESDPLV++   +VDSVG ++ DL++FLYIQSYKRLLP+ HKD+AAV
Sbjct  78   ARLVLDTLASVLHSESDPLVTSRFDDVDSVGADLLDLILFLYIQSYKRLLPRLHKDAAAV  137

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  138  ADVWPSTSAFDGYLSAL  154



>gb|KJB36106.1| hypothetical protein B456_006G141400 [Gossypium raimondii]
Length=606

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 114/137 (83%), Gaps = 3/137 (2%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL + KLIFTD  Q L  +K KL+S    S  RV+S +++++LQIS DH
Sbjct  21   LHPRREPFEHGLLPMQKLIFTDPLQALTSLKQKLVS---SSIQRVDSAALADSLQISLDH  77

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A+VLH+ESDPLV++   +VDSVG ++ DL++FLYIQSYKRLLP+ HKD+AAV
Sbjct  78   ARLVLDTLASVLHSESDPLVTSRFDDVDSVGADLLDLILFLYIQSYKRLLPRLHKDAAAV  137

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  138  ADVWPSTSAFDGYLSAL  154



>ref|XP_011078850.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=573

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 3/139 (2%)
 Frame = +3

Query  120  YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPD  299
            +++PRREPF+HGLL I KLIFTDGTQTL  +K  LLS S++   RVNS +++  LQI   
Sbjct  27   HLYPRREPFDHGLLPIPKLIFTDGTQTLSHLKSMLLSSSSN--QRVNSDTLARVLQIPIG  84

Query  300  HARLVLETVAAVLHNESDPLVSAN-PAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            HARL++ET+++VLH++SDPLV A  P E+D +GVNVFDL+VFLYIQSYKRLLPKGHKDSA
Sbjct  85   HARLLIETISSVLHDDSDPLVKACVPDEIDEIGVNVFDLLVFLYIQSYKRLLPKGHKDSA  144

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  145  AVADVWPSTSAFDGFLSAL  163



>ref|XP_004497930.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=561

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 113/137 (82%), Gaps = 2/137 (1%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPF+HGLL I KLIF+D TQ+L  +K KLL  S++  HRV+S ++S++LQIS DH
Sbjct  16   IHPRREPFDHGLLPIQKLIFSDPTQSLTALKKKLLDSSSN--HRVDSAAISDSLQISTDH  73

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            A+L+L+T+A+V H++S+PLV   P + D+VG +V DLV+ LYIQSYKRLLP+ HKDSA+V
Sbjct  74   AKLLLDTLASVHHSDSEPLVRNEPGQNDAVGADVHDLVLLLYIQSYKRLLPRSHKDSASV  133

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG  SAL
Sbjct  134  ADVWPSTSAFDGYFSAL  150



>ref|XP_002532335.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30037.1| conserved hypothetical protein [Ricinus communis]
Length=572

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 111/137 (81%), Gaps = 4/137 (3%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF D TQ L  +K KL S +     R+++  ++E+LQIS DH
Sbjct  30   IHPRREPFEHGLLPIPKLIFPDPTQALSQLKQKLASHNG----RIDTAILAESLQISTDH  85

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A++LH+++DPLV A P ++D VG ++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  86   ARLVLDTLASILHSDADPLVKAQPGDIDLVGADLRDLILFLYIQSYKKLLPRTHKDSAAV  145

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  146  ADVWPSTSAFDGYLSAL  162



>gb|KHG18606.1| TBCC domain-containing 1 [Gossypium arboreum]
Length=582

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I KLIFTD  Q L  +K KL+S    S  RV+S ++++ L+IS DH
Sbjct  21   LHPRREPFEHGLLPIQKLIFTDPLQALTSLKQKLVS---SSTQRVDSAALADALEISLDH  77

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+A+VLH ESDPLV++   +VDSVG ++ DL++FLYIQSYKRLLP+ HKD+AAV
Sbjct  78   ARLVLDTLASVLHAESDPLVTSRFDDVDSVGADLLDLILFLYIQSYKRLLPRSHKDAAAV  137

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAF+G LSAL
Sbjct  138  ADVWPSTSAFEGYLSAL  154



>ref|XP_006381055.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|ERP58852.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=585

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 5/137 (4%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++E+LQIS DH
Sbjct  37   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLAESLQISTDH  91

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARL+L+T+A+VLH++SDPLV A P EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  92   ARLILDTLASVLHSDSDPLVKARPDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  151

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  152  ADVWPSTSAFDGYLSAL  168



>ref|XP_002323291.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
 gb|EEF05052.1| tubulin-specific chaperone C-related family protein [Populus 
trichocarpa]
Length=571

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF D TQ L  +K KL S      +RVNS  ++++LQI  DH
Sbjct  29   IHPRREPFEHGLLPIPKLIFPDTTQILTQLKQKLAS-----HNRVNSSLLADSLQIPADH  83

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARL+L+T+A+VL++ESDPLV A P EVDS G ++ DL++FLYIQSYK+LLP+ HKD+AAV
Sbjct  84   ARLILDTLASVLNSESDPLVKAPPDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAAAV  143

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  144  ADVWPSTSAFDGYLSAL  160



>ref|XP_010517737.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=572

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 3/138 (2%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR PFEHGLL I KL+FTD  QTL PIK KL + + +  +RV S +VS+ L IS D+
Sbjct  30   IHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSAAVSDALLISGDN  87

Query  303  ARLVLETVAAVLHNESDPLVSANPAE-VDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  479
            ARLVLET+ +VLH E+DPLV A  +E VDSVGV++ DL++FLYIQSYK+LLP+ HKDSAA
Sbjct  88   ARLVLETLGSVLHCENDPLVLAKKSEEVDSVGVDLRDLILFLYIQSYKKLLPRTHKDSAA  147

Query  480  VADVWPSTSAFDGXLSAL  533
            VADVWPSTSAFDG LSAL
Sbjct  148  VADVWPSTSAFDGYLSAL  165



>ref|XP_010943570.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=579

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 9/146 (6%)
 Frame = +3

Query  96   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  275
             AG   P+ + PRREPFEHGLL I KLIF+DGT TLGP++DKLL LS+    RV++ +++
Sbjct  21   GAGAGAPLLLRPRREPFEHGLLPIPKLIFSDGTLTLGPLRDKLLGLSSTRPGRVDAPALA  80

Query  276  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  455
            E LQISPDHARLVL+T+A+VL   SDP   A  A+       V+DLV+FLYIQ+YKRLLP
Sbjct  81   EALQISPDHARLVLDTLASVL--PSDPPDPAGTAD-------VYDLVLFLYIQTYKRLLP  131

Query  456  KGHKDSAAVADVWPSTSAFDGXLSAL  533
            K HKDS  VADVWPSTSAFDG  SAL
Sbjct  132  KAHKDSVTVADVWPSTSAFDGFFSAL  157



>ref|XP_006293916.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
 gb|EOA26814.1| hypothetical protein CARUB_v10022907mg [Capsella rubella]
Length=570

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 112/144 (78%), Gaps = 3/144 (2%)
 Frame = +3

Query  102  GTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSET  281
              + PI IHPRR PFEHGL+ I KL+FTD  QTL PIK KL + + +  +RV S ++S+ 
Sbjct  24   ANSNPI-IHPRRVPFEHGLIPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSAAISDA  80

Query  282  LQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKG  461
            L IS D ARLVLET+ +VLH E+DPLV A P EVDS+G ++ DLV+FLYIQSYK+L P+ 
Sbjct  81   LLISGDQARLVLETLGSVLHCETDPLVLAKPEEVDSIGADLRDLVLFLYIQSYKKLQPRT  140

Query  462  HKDSAAVADVWPSTSAFDGXLSAL  533
            HKD+A+VADVWPSTSAFDG LSAL
Sbjct  141  HKDAASVADVWPSTSAFDGYLSAL  164



>ref|XP_008800652.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=577

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 9/146 (6%)
 Frame = +3

Query  96   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  275
            AAG   P  + PRREPFEHGLL I KLIF+DGT TLGP++DKLL LS+    RV++ +++
Sbjct  19   AAGAGAPFLLRPRREPFEHGLLPIPKLIFSDGTLTLGPLRDKLLGLSSPCPGRVDAPALA  78

Query  276  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  455
            E LQISPD ARLVL+T+A+VL   SDP   A  A+       V+DLV+FLYIQ+YKRLLP
Sbjct  79   EALQISPDRARLVLDTLASVL--PSDPPDPAGTAD-------VYDLVLFLYIQTYKRLLP  129

Query  456  KGHKDSAAVADVWPSTSAFDGXLSAL  533
            K HKDSA VADVWPSTSAFDG  SAL
Sbjct  130  KAHKDSANVADVWPSTSAFDGFFSAL  155



>ref|XP_010508603.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=565

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 4/137 (3%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR PFEHGL+ I KL+FTD  QTL PIK KL + + +  +RV S ++++ L IS D+
Sbjct  26   IHPRRVPFEHGLIPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSTAIADALLISGDN  83

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH E+DPLV A   EVDSVGV++ DL++FLYIQSYK+LLP+ HKDSAAV
Sbjct  84   ARLVLETLGSVLHCENDPLVLAQ--EVDSVGVDLRDLILFLYIQSYKKLLPRTHKDSAAV  141

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  142  ADVWPSTSAFDGYLSAL  158



>ref|XP_011020269.1| PREDICTED: TBCC domain-containing protein 1 isoform X3 [Populus 
euphratica]
Length=577

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++++LQIS DH
Sbjct  33   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLADSLQISTDH  87

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARL+L+T+A+VLH++SDPLV A   EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  88   ARLILDTLASVLHSDSDPLVKARSDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  147

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  148  ADVWPSTSAFDGYLSAL  164



>ref|XP_011020268.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=579

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++++LQIS DH
Sbjct  33   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLADSLQISTDH  87

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARL+L+T+A+VLH++SDPLV A   EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  88   ARLILDTLASVLHSDSDPLVKARSDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  147

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  148  ADVWPSTSAFDGYLSAL  164



>ref|XP_011020267.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=581

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 110/137 (80%), Gaps = 5/137 (4%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF D T TL  +K +L      + +RVNS  ++++LQIS DH
Sbjct  33   IHPRREPFEHGLLPIPKLIFPDPTPTLIQLKQQL-----STHNRVNSSLLADSLQISTDH  87

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARL+L+T+A+VLH++SDPLV A   EVDS G ++ DL++FLYIQSYK+LLP+ HKD+A+V
Sbjct  88   ARLILDTLASVLHSDSDPLVKARSDEVDSAGADLRDLILFLYIQSYKKLLPRTHKDAASV  147

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  148  ADVWPSTSAFDGYLSAL  164



>ref|XP_011033250.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Populus 
euphratica]
Length=569

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 110/138 (80%), Gaps = 7/138 (5%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH-RVNSKSVSETLQISPD  299
            IHPRREPFEHGLL I KLIF D TQ L  +K KL      + H RVNS  ++++LQIS D
Sbjct  27   IHPRREPFEHGLLPIPKLIFPDTTQILTQLKQKL------ARHDRVNSSLLADSLQISAD  80

Query  300  HARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  479
            HARL+L+T+A+VL++ESDPLV A   EVDSV  ++ DL++FLYIQSYK+LLP+ HKD+AA
Sbjct  81   HARLILDTLASVLNSESDPLVKAPSDEVDSVDADLRDLILFLYIQSYKKLLPRTHKDAAA  140

Query  480  VADVWPSTSAFDGXLSAL  533
            VADVWPSTSAFDG LSAL
Sbjct  141  VADVWPSTSAFDGYLSAL  158



>ref|XP_011033249.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Populus 
euphratica]
Length=575

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 110/138 (80%), Gaps = 7/138 (5%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH-RVNSKSVSETLQISPD  299
            IHPRREPFEHGLL I KLIF D TQ L  +K KL      + H RVNS  ++++LQIS D
Sbjct  27   IHPRREPFEHGLLPIPKLIFPDTTQILTQLKQKL------ARHDRVNSSLLADSLQISAD  80

Query  300  HARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  479
            HARL+L+T+A+VL++ESDPLV A   EVDSV  ++ DL++FLYIQSYK+LLP+ HKD+AA
Sbjct  81   HARLILDTLASVLNSESDPLVKAPSDEVDSVDADLRDLILFLYIQSYKKLLPRTHKDAAA  140

Query  480  VADVWPSTSAFDGXLSAL  533
            VADVWPSTSAFDG LSAL
Sbjct  141  VADVWPSTSAFDGYLSAL  158



>ref|XP_010506033.1| PREDICTED: TBCC domain-containing protein 1-like [Camelina sativa]
Length=568

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 110/138 (80%), Gaps = 3/138 (2%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR PFEHGL+ I KL+FTD  Q L PIK KL + + +  +RV S ++S+ L IS D+
Sbjct  26   IHPRRVPFEHGLIPIQKLVFTDPIQALAPIKQKLAASATN--NRVGSAAISDALLISVDN  83

Query  303  ARLVLETVAAVLHNESDPLVSANPAE-VDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAA  479
            ARLVLET+ +VLH E+DPLV A  +E VDSVG ++ DL++FLYIQSYK+LLP+ HKDSAA
Sbjct  84   ARLVLETLGSVLHCENDPLVLAQKSEEVDSVGADLRDLILFLYIQSYKKLLPRTHKDSAA  143

Query  480  VADVWPSTSAFDGXLSAL  533
            VADVWPSTSAFDG LSAL
Sbjct  144  VADVWPSTSAFDGYLSAL  161



>ref|XP_008442093.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1-like [Cucumis melo]
Length=570

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +3

Query  111  EPI-YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQ  287
            +PI  IHPRREPFEHGLL I KLIF+D  QTL P+K KLL  S+  + R+NS ++SE+LQ
Sbjct  20   DPISLIHPRREPFEHGLLPIPKLIFSDPIQTLIPLKQKLLQSSS-PSSRLNSSAISESLQ  78

Query  288  ISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHK  467
            IS DHARLVL+T+A+VLH++SDPLV+A P +VDS+GV+V DL++FLYIQSYKRLLP+ HK
Sbjct  79   ISIDHARLVLDTLASVLHSDSDPLVNAAPHDVDSIGVDVLDLLLFLYIQSYKRLLPRSHK  138

Query  468  DSAAVADVWPSTSAFDGXLSAL  533
            DSAAVADVWPSTSAFDG LSAL
Sbjct  139  DSAAVADVWPSTSAFDGYLSAL  160



>ref|XP_002881827.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58086.1| hypothetical protein ARALYDRAFT_483312 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL + + +  +RV S ++S+ L IS 
Sbjct  22   LVIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLAASATN--NRVGSAAISDALSISN  79

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARLVLET+ +VLH E+DPLV A P EVDSVG ++ DL++FL+IQSYK+LLP+ HKDSA
Sbjct  80   DHARLVLETLGSVLHCETDPLVLAKPEEVDSVGADLRDLLLFLFIQSYKKLLPRTHKDSA  139

Query  477  AVADVWPSTSAFDGXLSAL  533
            +VADVWPSTSAFDG LSAL
Sbjct  140  SVADVWPSTSAFDGYLSAL  158



>gb|KHN26370.1| TBCC domain-containing protein 1 [Glycine soja]
Length=553

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 105/137 (77%), Gaps = 14/137 (10%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            +HPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+  ++SE+LQIS +H
Sbjct  21   VHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSN--QRVDLAAISESLQISIEH  78

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARL            S+PLV AN  E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARL------------SEPLVVANLVEIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  126

Query  483  ADVWPSTSAFDGXLSAL  533
             DVWPSTSAFDG LSAL
Sbjct  127  TDVWPSTSAFDGYLSAL  143



>ref|XP_010928451.1| PREDICTED: TBCC domain-containing protein 1 isoform X2 [Elaeis 
guineensis]
Length=557

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 111/141 (79%), Gaps = 11/141 (8%)
 Frame = +3

Query  114  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  293
            P+ + PRREPFE+GLL I KLIF+DGT TLGP++DKLL LS+  +  V++ +++E LQIS
Sbjct  38   PLLLRPRREPFEYGLLPIPKLIFSDGTLTLGPLRDKLLGLSSPCSGCVDALALAEALQIS  97

Query  294  PDHARLVLETVAAVLHNES-DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  470
            PD ARLVL+T+A+VL +++ DP  +A          +V+DLV+FLYIQSYKRLLPK HKD
Sbjct  98   PDLARLVLDTLASVLPSDTPDPAGTA----------DVYDLVLFLYIQSYKRLLPKAHKD  147

Query  471  SAAVADVWPSTSAFDGXLSAL  533
            SAAVADVWPSTSAFDG  SAL
Sbjct  148  SAAVADVWPSTSAFDGYFSAL  168



>ref|XP_010928450.1| PREDICTED: TBCC domain-containing protein 1 isoform X1 [Elaeis 
guineensis]
Length=592

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 111/141 (79%), Gaps = 11/141 (8%)
 Frame = +3

Query  114  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  293
            P+ + PRREPFE+GLL I KLIF+DGT TLGP++DKLL LS+  +  V++ +++E LQIS
Sbjct  38   PLLLRPRREPFEYGLLPIPKLIFSDGTLTLGPLRDKLLGLSSPCSGCVDALALAEALQIS  97

Query  294  PDHARLVLETVAAVLHNES-DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  470
            PD ARLVL+T+A+VL +++ DP  +A          +V+DLV+FLYIQSYKRLLPK HKD
Sbjct  98   PDLARLVLDTLASVLPSDTPDPAGTA----------DVYDLVLFLYIQSYKRLLPKAHKD  147

Query  471  SAAVADVWPSTSAFDGXLSAL  533
            SAAVADVWPSTSAFDG  SAL
Sbjct  148  SAAVADVWPSTSAFDGYFSAL  168



>emb|CDY06067.1| BnaA09g37130D [Brassica napus]
Length=513

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 102/137 (74%), Gaps = 11/137 (8%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    A S +RV S  ++E LQIS DH
Sbjct  26   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKQKLAD--AASNNRVGSGVIAEALQISGDH  83

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVLET+ +VLH+E DPL         SVG ++ DLV+FLYIQSYK+LLP+ HKDSAAV
Sbjct  84   ARLVLETLGSVLHSEGDPL---------SVGADLRDLVLFLYIQSYKKLLPRTHKDSAAV  134

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  135  ADVWPSTSAFDGYLSAL  151



>ref|XP_011075175.1| PREDICTED: TBCC domain-containing protein 1-like [Sesamum indicum]
Length=570

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 116/139 (83%), Gaps = 3/139 (2%)
 Frame = +3

Query  120  YIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPD  299
            ++HPRREPFEHGLL I KLIFTDGTQTL     K   LS+ S +RV+S+++S  LQI  +
Sbjct  24   HLHPRREPFEHGLLPIPKLIFTDGTQTL--SLLKSTLLSSSSNYRVSSETLSRVLQIPIE  81

Query  300  HARLVLETVAAVLHNESDPLVSANPA-EVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            H+R+++ET+++VLH++SDPLV A  + E++ +G NVFDL+VFLYIQSYKRLLPKGHKDSA
Sbjct  82   HSRILIETLSSVLHDDSDPLVKARTSKEIEEIGANVFDLLVFLYIQSYKRLLPKGHKDSA  141

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  142  AVADVWPSTSAFDGFLSAL  160



>ref|XP_006850073.1| hypothetical protein AMTR_s00022p00213770 [Amborella trichopoda]
 gb|ERN11654.1| hypothetical protein AMTR_s00022p00213770 [Amborella trichopoda]
Length=589

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 113/157 (72%), Gaps = 14/157 (9%)
 Frame = +3

Query  105  TAEPIY-IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADS--------AHRV  257
            TA P + +H RREPFE+GLL I+KLIFTDGT TL P++DK   LS +         + R+
Sbjct  14   TAPPTFSLHIRREPFEYGLLPISKLIFTDGTSTLAPLRDKFFQLSFNKDSFSLSSSSLRI  73

Query  258  NSKSVSETLQISPDHARLVLETVAAVLHNE-----SDPLVSANPAEVDSVGVNVFDLVVF  422
            ++  +S+ L+IS ++A LVL+T+A VL +      SDPLV A P E+D +G NV DL++F
Sbjct  74   DASGISQALEISIENAHLVLDTLATVLPDYGDVGLSDPLVYAKPDEIDKIGANVCDLILF  133

Query  423  LYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            LYIQSYK+LLP+ HKDSA++ADVWPSTS FDG L AL
Sbjct  134  LYIQSYKKLLPRPHKDSASIADVWPSTSVFDGYLCAL  170



>emb|CDX71986.1| BnaC08g28880D [Brassica napus]
Length=565

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 104/139 (75%), Gaps = 15/139 (11%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSA--HRVNSKSVSETLQISP  296
            IHPRR  FEHGLL I KL+F D  QTL P+K KL    AD+A  +RV S  ++E LQIS 
Sbjct  26   IHPRRVSFEHGLLPIQKLVFADPIQTLAPVKRKL----ADAATNNRVGSGVIAEVLQISG  81

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARLVLET+ +VLH+E DPL         SVG ++ DLV+FLYIQSYK+LLP+ HKDSA
Sbjct  82   DHARLVLETLGSVLHSEGDPL---------SVGADLRDLVLFLYIQSYKKLLPRTHKDSA  132

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  133  AVADVWPSTSAFDGYLSAL  151



>gb|KHN26369.1| TBCC domain-containing protein 1 [Glycine soja]
Length=551

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 104/137 (76%), Gaps = 17/137 (12%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I +LIF+D  QTL P+K KLL LS++   RV+S ++SE+LQIS +H
Sbjct  21   IHPRREPFEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSN--QRVDSAAISESLQISIEH  78

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            ARLVL+T+                 E+DSVGV+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  79   ARLVLDTLLD---------------EIDSVGVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  123

Query  483  ADVWPSTSAFDGXLSAL  533
             DVWPSTSAFDG LSAL
Sbjct  124  TDVWPSTSAFDGYLSAL  140



>ref|XP_009391882.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 103/139 (74%), Gaps = 10/139 (7%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + + PRREPFEHGLL I KLIF+DGTQTL  + DKLL  S  S HRV+  ++++  QIS 
Sbjct  34   LLLRPRREPFEHGLLPIPKLIFSDGTQTLAALADKLLHRSISSPHRVDVPALADAFQISL  93

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            DHARL L+T+A+VL  E DP         D V  NV D+V+FLY+QSYKRL+P+ HKDSA
Sbjct  94   DHARLALDTLASVLPFEPDP---------DGVA-NVHDIVLFLYVQSYKRLVPRPHKDSA  143

Query  477  AVADVWPSTSAFDGXLSAL  533
            A+ADVWPSTSAFDG LSAL
Sbjct  144  AIADVWPSTSAFDGYLSAL  162



>ref|XP_008795746.1| PREDICTED: LOW QUALITY PROTEIN: TBCC domain-containing protein 
1 [Phoenix dactylifera]
Length=577

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 9/140 (6%)
 Frame = +3

Query  114  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  293
            P+ + PRREPFE+GLL I KLIF+DGT TLG ++DKLL LS+     V++ +++E LQIS
Sbjct  22   PLLLRPRREPFEYGLLPIPKLIFSDGTLTLGTLRDKLLGLSSPCPGSVDALALAEALQIS  81

Query  294  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  473
             D ARLVL+T+A+VL     P  + +PA       +V+DLV+FLYIQSYKRLLPK H+DS
Sbjct  82   ADLARLVLDTLASVL-----PSGTQDPAGT----ADVYDLVLFLYIQSYKRLLPKAHRDS  132

Query  474  AAVADVWPSTSAFDGXLSAL  533
            AAVADVWPSTSAFDG  SAL
Sbjct  133  AAVADVWPSTSAFDGYFSAL  152



>ref|XP_008787292.1| PREDICTED: TBCC domain-containing protein 1-like [Phoenix dactylifera]
Length=574

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 105/138 (76%), Gaps = 12/138 (9%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            + PRRE FEHGLL I+KLIF+DGT TL  IK+KLL  S  S +RV++ ++++TLQISPD 
Sbjct  31   LRPRRELFEHGLLPISKLIFSDGTLTLASIKNKLLQRSIPSPNRVDAPTIADTLQISPDI  90

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGV-NVFDLVVFLYIQSYKRLLPKGHKDSAA  479
            A LVL+T+AAVL           P++  S G  +V DLV+FLYIQSYKRL+P+ HKDSAA
Sbjct  91   AFLVLDTLAAVL-----------PSDSGSAGTADVHDLVLFLYIQSYKRLVPRAHKDSAA  139

Query  480  VADVWPSTSAFDGXLSAL  533
            VADVWPSTSAFDG LSAL
Sbjct  140  VADVWPSTSAFDGYLSAL  157



>ref|XP_009411800.1| PREDICTED: TBCC domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 107/146 (73%), Gaps = 10/146 (7%)
 Frame = +3

Query  96   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  275
            AAG +  + + PRREPFEHGLL I KLIF+DGT TL  + DKLL  S  S HRV++ S++
Sbjct  26   AAGGSLQLLLRPRREPFEHGLLPIPKLIFSDGTLTLAALADKLLRRSIPSPHRVDATSLA  85

Query  276  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  455
            + LQIS D+ARL L+T+A+VL +E DP  +A          +V  LV+FL IQSYKRL+P
Sbjct  86   DALQISLDYARLALDTLASVLPSEPDPDGTA----------DVHVLVLFLCIQSYKRLVP  135

Query  456  KGHKDSAAVADVWPSTSAFDGXLSAL  533
            + HKDSAA+ADVWPSTSAFDG LSAL
Sbjct  136  RPHKDSAAIADVWPSTSAFDGYLSAL  161



>ref|XP_004493562.1| PREDICTED: TBCC domain-containing protein 1-like [Cicer arietinum]
Length=555

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 105/137 (77%), Gaps = 13/137 (9%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I +LIF+D  QTL  +K KL+  S++  +RV+S ++S++LQIS + 
Sbjct  22   IHPRREPFEHGLLPIPRLIFSDPAQTLISLKHKLIESSSN--NRVDSVAISDSLQISVEQ  79

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            A+LVL+T+A+VL           P E DS  V+V DLV+FLYIQSYKRLLP+ HKDSAAV
Sbjct  80   AKLVLDTLASVL-----------PHESDSDTVDVHDLVLFLYIQSYKRLLPRTHKDSAAV  128

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  129  ADVWPSTSAFDGYLSAL  145



>ref|XP_010913921.1| PREDICTED: TBCC domain-containing protein 1-like [Elaeis guineensis]
Length=577

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 103/138 (75%), Gaps = 12/138 (9%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            + PRRE FEHGLL I+KLIF+DGT TL  +K+KLL  S  S+ RV++ ++++ LQISPD 
Sbjct  31   LRPRRELFEHGLLPISKLIFSDGTLTLASLKNKLLQRSIPSSDRVDALTIADALQISPDI  90

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGV-NVFDLVVFLYIQSYKRLLPKGHKDSAA  479
            A LVL T+AAVL           P++  S G  +V DLV+FLYIQSYKRLLP+ HKDSAA
Sbjct  91   ALLVLGTLAAVL-----------PSDPGSAGTADVHDLVLFLYIQSYKRLLPRAHKDSAA  139

Query  480  VADVWPSTSAFDGXLSAL  533
            VADVWPSTSAFDG LSAL
Sbjct  140  VADVWPSTSAFDGYLSAL  157



>gb|ABR16182.1| unknown [Picea sitchensis]
Length=609

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 113/172 (66%), Gaps = 32/172 (19%)
 Frame = +3

Query  114  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLS---------------------  230
            P+++H RREPFE+GLL +  L+FTDGT TL  +++KLL                      
Sbjct  7    PLFLHLRREPFEYGLLPLPHLMFTDGTSTLKSVREKLLQNSFTYTVNNNNHNSNNDDNNN  66

Query  231  -----LSADSAHRVNSKSVSETLQISPDHARLVLETVAAVL------HNESDPLVSANPA  377
                 +S   + RVN+  ++E+LQ+S DHAR+V++T+AAVL         +DPLV A+  
Sbjct  67   DNNGEVSRSFSRRVNATGIAESLQLSEDHARVVIDTLAAVLPEYGRGGGAADPLVHASYV  126

Query  378  EVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            +VDS+G +V+DL++FL IQ+YK+L+P+ HKD+A+VADVWPSTSAFDG  + L
Sbjct  127  DVDSIGADVYDLILFLLIQTYKKLVPRPHKDAASVADVWPSTSAFDGIFATL  178



>gb|KEH41654.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=553

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = +3

Query  114  PIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQIS  293
            P  IHPRREPFEHGL+ I KLIF+D TQ+L  +K  LL+ S+++   ++S  +S++LQIS
Sbjct  13   PTMIHPRREPFEHGLIPIPKLIFSDPTQSLLTLKQTLLASSSNNL--ISSAIISDSLQIS  70

Query  294  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDS  473
             +HA+L+L+T+++V+H+E+D  V  + AE D     V+DL++ LYIQSYK+LLP+ +KD 
Sbjct  71   TEHAQLLLDTLSSVVHHEND--VVFDGAECD-----VYDLILLLYIQSYKKLLPRSNKDP  123

Query  474  AAVADVWPSTSAFDGXLSAL  533
            A+VADVWPSTSAFDG  SAL
Sbjct  124  ASVADVWPSTSAFDGYFSAL  143



>ref|XP_003625224.1| TBCC domain-containing protein [Medicago truncatula]
 gb|ABN08645.1| Tubulin binding cofactor C [Medicago truncatula]
 gb|AES81442.1| tubulin-binding cofactor C domain protein [Medicago truncatula]
Length=558

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 11/137 (8%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIF+D  QTL   K KLL  S++  +RV S ++SE+LQIS + 
Sbjct  23   IHPRREPFEHGLLPIPKLIFSDPAQTLISFKHKLLESSSN--NRVGSVAISESLQISVEQ  80

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAV  482
            A+LVL+T+A+VL     P  S + ++   V     DLV+FLY+QSYKRLLP+ HKDSAAV
Sbjct  81   AKLVLDTLASVL-----PSESDSESDSVDVN----DLVLFLYVQSYKRLLPRTHKDSAAV  131

Query  483  ADVWPSTSAFDGXLSAL  533
            ADVWPSTSAFDG LSAL
Sbjct  132  ADVWPSTSAFDGYLSAL  148



>ref|XP_010038901.1| PREDICTED: TBCC domain-containing protein 1 [Eucalyptus grandis]
Length=523

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 88/111 (79%), Gaps = 3/111 (3%)
 Frame = +3

Query  201  LGPIKDKLLSLSADSAHRVNSKSVSETLQISPDHARLVLETVAAVLHNESDPLVSANPAE  380
            L P+K KL      +  R   + ++E+LQISPDHARLVL+T+ +VLH++SDPLV A P E
Sbjct  6    LLPLKQKLWGSPVTTRRR---RRLAESLQISPDHARLVLDTLVSVLHSDSDPLVRAKPDE  62

Query  381  VDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            VDS+G +V DLV+FLYIQSYK+LLP+ HKDS AVADVWPSTSAFDG LSAL
Sbjct  63   VDSLGADVNDLVLFLYIQSYKKLLPRSHKDSVAVADVWPSTSAFDGYLSAL  113



>ref|XP_003563624.1| PREDICTED: TBCC domain-containing protein 1-like [Brachypodium 
distachyon]
Length=583

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 97/140 (69%), Gaps = 11/140 (8%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRRE FEHGLL I KL+F +GT  QTL  +K +LL      + RV + +++E LQI  
Sbjct  36   LRPRRESFEHGLLPIPKLVFPEGTLTQTLAQLKGRLLE---SGSGRVGAPALAEALQIPV  92

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVG-VNVFDLVVFLYIQSYKRLLPKGHKDS  473
            + A LVL T+AAVL  + DP +      VD  G  ++ D+++FLYIQSYKRL+P+ HKDS
Sbjct  93   EQAALVLGTLAAVLPTDEDPALG-----VDGAGEADLRDVLLFLYIQSYKRLVPRAHKDS  147

Query  474  AAVADVWPSTSAFDGXLSAL  533
             +VADVWPSTSAFDG LSAL
Sbjct  148  PSVADVWPSTSAFDGYLSAL  167



>ref|XP_002986516.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
 gb|EFJ12373.1| hypothetical protein SELMODRAFT_182480 [Selaginella moellendorffii]
Length=570

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 98/148 (66%), Gaps = 7/148 (5%)
 Frame = +3

Query  96   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVS  275
            A+   EP ++H RREPFE+G+L +  L+  DG  +L  +++KLL        RV   ++ 
Sbjct  13   ASAQGEPPWLHVRREPFEYGMLPLPSLMHHDGVGSLRELREKLLD-----NRRVGVAAIV  67

Query  276  ETLQISPDHARLVLETVAAVL--HNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRL  449
            E L +S  HA LVL+T+A+VL   ++ D L  A  AE+D+VG +V DL++FLYIQ Y+R+
Sbjct  68   ECLGLSEAHALLVLDTLASVLPDGDDCDQLARAYAAEIDTVGAHVDDLLLFLYIQIYRRV  127

Query  450  LPKGHKDSAAVADVWPSTSAFDGXLSAL  533
             P+ HKD AAVADVWPSTS FDG  S L
Sbjct  128  PPRSHKDPAAVADVWPSTSPFDGFFSTL  155



>ref|XP_002964936.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
 gb|EFJ33774.1| hypothetical protein SELMODRAFT_439144 [Selaginella moellendorffii]
Length=599

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 102/169 (60%), Gaps = 23/169 (14%)
 Frame = +3

Query  96   AAGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLL----------------  227
            A+   EP ++H RREPFE+G+L +  L+  DG  +L  +++KLL                
Sbjct  16   ASAQGEPPWLHVRREPFEYGMLPLPSLMHHDGVGSLRELREKLLDKSIPQTSWQSGGGNA  75

Query  228  -----SLSADSAHRVNSKSVSETLQISPDHARLVLETVAAVL--HNESDPLVSANPAEVD  386
                 +++   + RV   ++ E L +S  HA LVL+T+A+VL   ++ D L  A  AE+D
Sbjct  76   SEDSSAMAQQPSRRVGVAAIVECLGLSEAHALLVLDTLASVLPDGDDCDQLARAYAAEID  135

Query  387  SVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            +VG +V DL++FLYIQ Y+R+ P+ HKD AAVADVWPSTS FDG  S L
Sbjct  136  TVGAHVDDLLLFLYIQIYRRVPPRSHKDPAAVADVWPSTSPFDGFFSTL  184



>gb|EEC80975.1| hypothetical protein OsI_23703 [Oryza sativa Indica Group]
Length=568

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 98/146 (67%), Gaps = 18/146 (12%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLS-----ADSAHRVNSKSVS  275
            + + PRR  FEHGLL I KL+F +GT  QTL   K++L++ +     A +A RV + +++
Sbjct  31   LLLRPRRVAFEHGLLPIPKLVFPEGTLTQTLAQTKERLIAAAGGDGDASAAPRVGAAALA  90

Query  276  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  455
            E LQI  + A LVL T+AAVL           PAE ++   ++ D+++FLYIQSYKRL+P
Sbjct  91   EALQIPRELAALVLGTLAAVL-----------PAEEEAEDADLRDVLLFLYIQSYKRLVP  139

Query  456  KGHKDSAAVADVWPSTSAFDGXLSAL  533
            + HKDS AV DVWPSTSAFDG LSAL
Sbjct  140  RAHKDSPAVTDVWPSTSAFDGYLSAL  165



>ref|NP_001058077.1| Os06g0614300 [Oryza sativa Japonica Group]
 dbj|BAD35569.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAD35914.1| tubulin-specific chaperone C-like [Oryza sativa Japonica Group]
 dbj|BAF19991.1| Os06g0614300 [Oryza sativa Japonica Group]
Length=581

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 97/144 (67%), Gaps = 18/144 (13%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLS-----ADSAHRVNSKSVSET  281
            + PRR  FEHGLL I KL+F +GT  QTL   K++L++ +     A +A RV + +++E 
Sbjct  33   LRPRRVAFEHGLLPIPKLVFPEGTLTQTLAQTKERLIAAAGGDGDASAAPRVGAAALAEA  92

Query  282  LQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKG  461
            LQI  + A LVL T+AAVL           PAE ++   ++ D+++FLYIQSYKRL+P+ 
Sbjct  93   LQIPRELAALVLGTLAAVL-----------PAEEEAEDADLRDVLLFLYIQSYKRLVPRA  141

Query  462  HKDSAAVADVWPSTSAFDGXLSAL  533
            HKDS AV DVWPSTSAFDG LSAL
Sbjct  142  HKDSPAVTDVWPSTSAFDGYLSAL  165



>dbj|BAJ93674.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=570

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 92/135 (68%), Gaps = 8/135 (6%)
 Frame = +3

Query  138  EPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAH-RVNSKSVSETLQISPDHAR  308
            E FEHGLL I KLIF +GT  QTL  +K+KL+  +A +   RV + +++E LQI PD A 
Sbjct  28   EAFEHGLLPIPKLIFPEGTLAQTLSQLKEKLVPAAAAAGDGRVGAAALAEALQIPPDQAA  87

Query  309  LVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVAD  488
            L +  +AAVL  + DP + A          ++ D+++FLYIQSYKRL+P+ HKDS AVAD
Sbjct  88   LAIGMLAAVLPGD-DPALDAGGGG----SADLRDVLLFLYIQSYKRLVPRPHKDSPAVAD  142

Query  489  VWPSTSAFDGXLSAL  533
            VWPSTSAFDG LS L
Sbjct  143  VWPSTSAFDGYLSVL  157



>ref|XP_010233970.1| PREDICTED: TBCC domain-containing protein 1-like isoform X2 [Brachypodium 
distachyon]
Length=560

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 93/139 (67%), Gaps = 9/139 (6%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRR  FEHGLL I KLIF +G   QTL  +KDKL   + D   RV++ ++++ LQI P
Sbjct  24   LRPRRVAFEHGLLPIPKLIFPEGALAQTLSQLKDKLAPAAVDG--RVSAAALADALQIPP  81

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            D A L L  +AAV H   DP + A          ++ D+++FLYIQSYKRL+P+ HKDS 
Sbjct  82   DQAALALGMLAAV-HPADDPALGAG----GDGSADLRDVLLFLYIQSYKRLVPRPHKDSP  136

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  137  AVADVWPSTSAFDGYLSAL  155



>ref|XP_003571239.1| PREDICTED: TBCC domain-containing protein 1-like isoform X1 [Brachypodium 
distachyon]
Length=568

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 93/139 (67%), Gaps = 9/139 (6%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRR  FEHGLL I KLIF +G   QTL  +KDKL   + D   RV++ ++++ LQI P
Sbjct  24   LRPRRVAFEHGLLPIPKLIFPEGALAQTLSQLKDKLAPAAVDG--RVSAAALADALQIPP  81

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            D A L L  +AAV H   DP + A          ++ D+++FLYIQSYKRL+P+ HKDS 
Sbjct  82   DQAALALGMLAAV-HPADDPALGAG----GDGSADLRDVLLFLYIQSYKRLVPRPHKDSP  136

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  137  AVADVWPSTSAFDGYLSAL  155



>ref|XP_001757659.1| predicted protein [Physcomitrella patens]
 gb|EDQ77716.1| predicted protein [Physcomitrella patens]
Length=608

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 103/167 (62%), Gaps = 23/167 (14%)
 Frame = +3

Query  102  GTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLL-----------SLSADSA  248
            G  EP ++H RRE FE+G+L +  L+ +D    L  ++ KLL           S++A+++
Sbjct  11   GAREPPWLHVRREAFEYGMLPLPSLLHSDVVTGLRNLRVKLLQQAPSISTWPLSITANAS  70

Query  249  H---------RVNSKSVSETLQISPDHARLVLETVAAVLHNES---DPLVSANPAEVDSV  392
            H         RV ++ ++  L+++  HA LVL+T+A+VL+ E    DPL      E+DSV
Sbjct  71   HSTPASGGRERVGTEGIAAALEVAEAHAHLVLDTLASVLNEEGAGVDPLAITPVTEIDSV  130

Query  393  GVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            G ++ +L++FLYIQ+Y+R+  + H+ +A VADVWPSTSA DG L AL
Sbjct  131  GADIDELLIFLYIQTYRRVPSRPHRGAADVADVWPSTSAIDGFLPAL  177



>gb|AFW66196.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=499

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 90/142 (63%), Gaps = 8/142 (6%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  290
            + + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + + D   RV + +++E LQI
Sbjct  31   VLLRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAASAPDG--RVRAAALAEALQI  88

Query  291  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHK  467
             P     +     A +    DP +      VD    ++ D+++FLYIQSYKRL+P+  HK
Sbjct  89   -PQEQAALALATLAAVLPAEDPALGD--GAVDGSAADIRDMLLFLYIQSYKRLVPRSAHK  145

Query  468  DSAAVADVWPSTSAFDGXLSAL  533
            DS  VADVWPSTSAFDG LSAL
Sbjct  146  DSPVVADVWPSTSAFDGYLSAL  167



>ref|XP_004965884.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=583

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 92/139 (66%), Gaps = 11/139 (8%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRRE FEHGLL I KL+  +G  +QTL  +K++L    A    RV + +++E LQI  
Sbjct  38   LRPRREAFEHGLLPIPKLVIPEGALSQTLAQMKERL----APGGARVGAAALAEALQIPA  93

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            + A L L T+AAV+  E   L      E D     + DL++FLYIQSYKRL+P+GHKDS 
Sbjct  94   EQAALALGTLAAVIPAEDPALGEDGAGEAD-----LRDLLLFLYIQSYKRLVPRGHKDSP  148

Query  477  AVADVWPSTSAFDGXLSAL  533
            AVADVWPSTSAFDG LSAL
Sbjct  149  AVADVWPSTSAFDGCLSAL  167



>gb|AAB88648.1| hypothetical protein [Arabidopsis thaliana]
Length=551

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 2/92 (2%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + IHPRR PFEHGLL I KL+FTD  QTL PIK KL SL+ +  HRV S ++S+ L IS 
Sbjct  22   LIIHPRRVPFEHGLLPIQKLVFTDPIQTLAPIKQKLASLATN--HRVGSAAISDALSISD  79

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSV  392
            DHARLVLET+++VLH E+DPLV A P EVDS+
Sbjct  80   DHARLVLETLSSVLHCETDPLVLAKPEEVDSL  111



>gb|ACN28202.1| unknown [Zea mays]
 gb|AFW66195.1| hypothetical protein ZEAMMB73_400795 [Zea mays]
Length=579

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 90/142 (63%), Gaps = 8/142 (6%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  290
            + + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + + D   RV + +++E LQI
Sbjct  31   VLLRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAASAPDG--RVRAAALAEALQI  88

Query  291  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHK  467
             P     +     A +    DP +      VD    ++ D+++FLYIQSYKRL+P+  HK
Sbjct  89   -PQEQAALALATLAAVLPAEDPALGD--GAVDGSAADIRDMLLFLYIQSYKRLVPRSAHK  145

Query  468  DSAAVADVWPSTSAFDGXLSAL  533
            DS  VADVWPSTSAFDG LSAL
Sbjct  146  DSPVVADVWPSTSAFDGYLSAL  167



>ref|XP_002453473.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
 gb|EES06449.1| hypothetical protein SORBIDRAFT_04g006490 [Sorghum bicolor]
Length=582

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 90/140 (64%), Gaps = 7/140 (5%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + SA    RV + +++E LQI P
Sbjct  36   LRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAA-SAAPDGRVPAAALAEALQI-P  93

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  473
                 +     A +    DP +      VD    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  94   QEQAALALATLAAVLPAEDPAL--GDGAVDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  151

Query  474  AAVADVWPSTSAFDGXLSAL  533
             AVADVWPSTSAFDG LSAL
Sbjct  152  PAVADVWPSTSAFDGYLSAL  171



>dbj|BAJ90629.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  290
            + + PRRE FEHGLL I KL+F +GT  QTL  +K KL   +A    RV + +++E LQI
Sbjct  40   LVLRPRRESFEHGLLPIPKLVFPEGTLTQTLTQLKAKL---AAPGHGRVGAAALAEALQI  96

Query  291  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKD  470
              D A L L T+AAVL  E D      PA   +   ++ D+++FLYIQSYKRL+P+ HKD
Sbjct  97   PADQAALALGTLAAVLPGEGD-----GPAADGAWEADLRDVLLFLYIQSYKRLVPRAHKD  151

Query  471  SAAVADVWPSTSAFDGXLSAL  533
            S +VADVWPSTSAFDG LSAL
Sbjct  152  SPSVADVWPSTSAFDGYLSAL  172



>gb|EEE66013.1| hypothetical protein OsJ_21970 [Oryza sativa Japonica Group]
Length=581

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 94/146 (64%), Gaps = 18/146 (12%)
 Frame = +3

Query  117  IYIHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLS-----ADSAHRVNSKSVS  275
            + + PR    EHGLL I K +  +GT  QTL   K++L++ +     + +A RV + +++
Sbjct  31   LLLGPRGVALEHGLLAIPKRVSPEGTLTQTLAQTKERLIAAAGGDGDSSAAPRVGAAALA  90

Query  276  ETLQISPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLP  455
            E LQI  + A LVL T+AAVL           PAE ++   ++ D+++FLYIQSYKRL+P
Sbjct  91   EALQIPRELAALVLGTLAAVL-----------PAEEEAEDADLRDVLLFLYIQSYKRLVP  139

Query  456  KGHKDSAAVADVWPSTSAFDGXLSAL  533
            + HKDS AV DVWPSTSAFDG LSAL
Sbjct  140  RAHKDSPAVTDVWPSTSAFDGYLSAL  165



>ref|XP_008643390.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=566

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 89/140 (64%), Gaps = 8/140 (6%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRRE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + +++E LQI P
Sbjct  35   LRPRREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAEALQI-P  91

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  473
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  92   QEQAALALGTLAAVLPAEDPVLGD--GAMDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  149

Query  474  AAVADVWPSTSAFDGXLSAL  533
             AVADVWPSTSAFDG LSAL
Sbjct  150  PAVADVWPSTSAFDGYLSAL  169



>ref|XP_008643389.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN30975.1| unknown [Zea mays]
 gb|AFW70773.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=581

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 89/140 (64%), Gaps = 8/140 (6%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRRE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + +++E LQI P
Sbjct  35   LRPRREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAEALQI-P  91

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  473
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  92   QEQAALALGTLAAVLPAEDPVLGD--GAMDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  149

Query  474  AAVADVWPSTSAFDGXLSAL  533
             AVADVWPSTSAFDG LSAL
Sbjct  150  PAVADVWPSTSAFDGYLSAL  169



>ref|NP_001144767.1| hypothetical protein [Zea mays]
 gb|ACG42825.1| hypothetical protein [Zea mays]
 gb|AFW70774.1| hypothetical protein ZEAMMB73_883749 [Zea mays]
Length=569

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 89/140 (64%), Gaps = 8/140 (6%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRRE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + +++E LQI P
Sbjct  35   LRPRREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAEALQI-P  91

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHKDS  473
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+P+  HKDS
Sbjct  92   QEQAALALGTLAAVLPAEDPVLGD--GAMDGAAADIRDVLLFLYIQSYKRLVPRSAHKDS  149

Query  474  AAVADVWPSTSAFDGXLSAL  533
             AVADVWPSTSAFDG LSAL
Sbjct  150  PAVADVWPSTSAFDGYLSAL  169



>gb|AFN53653.1| putative G-patch domain protein [Linum usitatissimum]
Length=565

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 6/102 (6%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDH  302
            IHPRREPFEHGLL I KLIFTD TQTLG ++ KL      S  RV++ ++++ LQIS DH
Sbjct  32   IHPRREPFEHGLLPIPKLIFTDPTQTLGQLRQKL-----SSQPRVDATALADALQISTDH  86

Query  303  ARLVLETVAAVLHNESDPLVSANPAEVDSV-GVNVFDLVVFL  425
            ARLVL+T+A+VLH+ESDPLV A   E+DSV  +  F+ + FL
Sbjct  87   ARLVLDTLASVLHSESDPLVKAGSGEIDSVLTMEGFEHLGFL  128



>ref|XP_004951581.1| PREDICTED: TBCC domain-containing protein 1-like [Setaria italica]
Length=578

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 96/141 (68%), Gaps = 12/141 (9%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRRE FEHGLL I KLIF +GT  QTL  +K+KL + +     RV + +++E LQI  
Sbjct  34   LRPRREAFEHGLLPIPKLIFPEGTLAQTLAQLKEKLAA-AVPGGGRVGAAALAEALQIPQ  92

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVG-VNVFDLVVFLYIQSYKRLLPK-GHKD  470
            + A L L T+AAVL  E       +PA  D  G  ++ D+++FLY+QSYKRL+P+  HKD
Sbjct  93   EQAALALGTLAAVLPAE-------DPALGDGAGDADIHDVLLFLYVQSYKRLVPRSAHKD  145

Query  471  SAAVADVWPSTSAFDGXLSAL  533
            S AVADVWPSTSAFDG LSAL
Sbjct  146  SPAVADVWPSTSAFDGYLSAL  166



>ref|XP_001778693.1| predicted protein [Physcomitrella patens]
 gb|EDQ56486.1| predicted protein, partial [Physcomitrella patens]
Length=584

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 103/157 (66%), Gaps = 16/157 (10%)
 Frame = +3

Query  99   AGTAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADSAH---------  251
            A   EP  +H RRE FE+G+L +  L+ +D      PI    LS+++++++         
Sbjct  11   ACNTEPC-LHVRREAFEYGILPLPNLLHSDEAP---PISTWALSINSNASYTVPASGDRK  66

Query  252  RVNSKSVSETLQISPDHARLVLETVAAVLHN--ESDPLVSANP-AEVDSVGVNVFDLVVF  422
            RV ++ ++  L+++  HA LVL+T+A+VL++  E+  L++  P  E+DSVG +V DL++F
Sbjct  67   RVGTEGIAAALEVTEAHAHLVLDTLASVLNDGGEAVDLLATTPVTEIDSVGADVDDLLIF  126

Query  423  LYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            LYIQ+Y+R+  + H+D+A VADVWPSTSA DG L AL
Sbjct  127  LYIQTYRRVPSRPHRDAADVADVWPSTSAIDGFLPAL  163



>gb|AFW76295.1| hypothetical protein ZEAMMB73_911559 [Zea mays]
Length=508

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 92/139 (66%), Gaps = 11/139 (8%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRRE FE+GLL I KL+F +G  TQTL  +K++L    A    RV + +++E LQI  
Sbjct  29   LRPRREAFEYGLLPIPKLVFPEGALTQTLSQLKERL----APGGPRVGAAALAEALQIPA  84

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            + A L L T+AAVL  E   L      E  S   ++ DL++FLYIQSYKRL+P+ HKDS 
Sbjct  85   EQAALALGTLAAVLPAEDSAL-----GEDGSGSADLRDLLLFLYIQSYKRLVPRVHKDSP  139

Query  477  AVADVWPSTSAFDGXLSAL  533
            AV DVWPSTSAFDG LSAL
Sbjct  140  AVTDVWPSTSAFDGYLSAL  158



>ref|NP_001168301.1| hypothetical protein [Zea mays]
 gb|ACN27744.1| unknown [Zea mays]
 gb|ACN28930.1| unknown [Zea mays]
 gb|AFW76296.1| hypothetical protein ZEAMMB73_911559 [Zea mays]
Length=574

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 92/139 (66%), Gaps = 11/139 (8%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + PRRE FE+GLL I KL+F +G  TQTL  +K++L    A    RV + +++E LQI  
Sbjct  29   LRPRREAFEYGLLPIPKLVFPEGALTQTLSQLKERL----APGGPRVGAAALAEALQIPA  84

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSA  476
            + A L L T+AAVL  E   L      E  S   ++ DL++FLYIQSYKRL+P+ HKDS 
Sbjct  85   EQAALALGTLAAVLPAEDSAL-----GEDGSGSADLRDLLLFLYIQSYKRLVPRVHKDSP  139

Query  477  AVADVWPSTSAFDGXLSAL  533
            AV DVWPSTSAFDG LSAL
Sbjct  140  AVTDVWPSTSAFDGYLSAL  158



>ref|XP_008657282.1| PREDICTED: spidroin-1-like [Zea mays]
Length=273

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 87/142 (61%), Gaps = 10/142 (7%)
 Frame = +3

Query  123  IHPRREPFEHGLLQ--ITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQI  290
            + PRRE F+HGL +  I KLIF +G   QTL  +K+KL +   D   RV + +++E  QI
Sbjct  134  LRPRREAFKHGLKEKLIPKLIFPEGMLAQTLAQLKEKLSASVPDG--RVRAAALAEAQQI  191

Query  291  SPDHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPK-GHK  467
             P     +     A +    DP++      +D    ++ D+++FLYIQSYKRL+ +  HK
Sbjct  192  -PQEQAALALGTLAAVLPAEDPVLGDG--AIDGAAADIRDVLLFLYIQSYKRLVQRSAHK  248

Query  468  DSAAVADVWPSTSAFDGXLSAL  533
            DS AVADVWPSTSAFDG LSAL
Sbjct  249  DSPAVADVWPSTSAFDGYLSAL  270



>gb|EEC72669.1| hypothetical protein OsI_06222 [Oryza sativa Indica Group]
Length=579

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 85/134 (63%), Gaps = 8/134 (6%)
 Frame = +3

Query  138  EPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDHARL  311
            E FEHGLL I KLIF +GT   TL  +KDKL S +AD   RV + +++E LQI P     
Sbjct  39   EAFEHGLLPIPKLIFPEGTLAHTLAQVKDKLAS-AADGGGRVAAAALAEALQI-PHEQAA  96

Query  312  VLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADV  491
            +     A +    DP + +        G ++ D+++FLYIQSYKRL+P+ HKDS AV DV
Sbjct  97   LALATLAAVLPADDPALDSGGGG----GADLRDVLLFLYIQSYKRLVPRAHKDSPAVTDV  152

Query  492  WPSTSAFDGXLSAL  533
            WPSTSAFDG LSAL
Sbjct  153  WPSTSAFDGYLSAL  166



>ref|XP_001758135.1| predicted protein [Physcomitrella patens]
 gb|EDQ76957.1| predicted protein [Physcomitrella patens]
Length=579

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 100/146 (68%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  TAEPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSADS-AHRVNSKSVSET  281
            T EP ++H RREPFE+G L I  L+ +D   +L  ++ KLLS +  S   RV+   ++  
Sbjct  14   TREPPWLHVRREPFEYGTLPIPSLMHSDVLASLMTLRGKLLSQAPPSLTSRVSITGIAAA  73

Query  282  LQISPDHARLVLETVAAVLHNES---DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  452
            L+++ ++A+L+LET+A+ L++E    D L S+   E++SVG ++ DL+++LY+Q+Y+R  
Sbjct  74   LELTEEYAQLILETLASTLNDEGTIVDRLASSLVNEIESVGADIDDLLLYLYLQTYRRAP  133

Query  453  PKGHKDSAAVADVWPSTSAFDGXLSA  530
             + H+D+++VADVWP TSA DG L A
Sbjct  134  SRPHRDASSVADVWPCTSAIDGILPA  159



>ref|NP_001046181.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAD25242.1| tubulin-specific chaperone C-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF08095.1| Os02g0194800 [Oryza sativa Japonica Group]
 dbj|BAH00408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=579

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 89/134 (66%), Gaps = 8/134 (6%)
 Frame = +3

Query  138  EPFEHGLLQITKLIFTDGT--QTLGPIKDKLLSLSADSAHRVNSKSVSETLQISPDHARL  311
            E FEHGLL I KLIF +GT   TL  +KDKL S +AD   RV + +++E LQI  + A L
Sbjct  39   EAFEHGLLPIPKLIFPEGTLAHTLAQVKDKLAS-AADGGGRVAAAALAEALQIPHEQAAL  97

Query  312  VLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADV  491
             L T+AAVL  +   L S      D     + D+++FLYIQSYKRL+P+ HKDS AV DV
Sbjct  98   ALATLAAVLPADDPALDSGGGGRAD-----LRDVLLFLYIQSYKRLVPRAHKDSPAVTDV  152

Query  492  WPSTSAFDGXLSAL  533
            WPSTSAFDG LSAL
Sbjct  153  WPSTSAFDGYLSAL  166



>emb|CBI30042.3| unnamed protein product [Vitis vinifera]
Length=466

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  375  AEVDSVGVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            +E+D+VG +V+DL++FLYIQSYKRLLP+ HKDSAAVADVWPSTSAFDG LSAL
Sbjct  4    SEIDAVGADVYDLILFLYIQSYKRLLPRTHKDSAAVADVWPSTSAFDGYLSAL  56



>ref|XP_001765734.1| predicted protein [Physcomitrella patens]
 gb|EDQ69325.1| predicted protein [Physcomitrella patens]
Length=559

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +3

Query  111  EPIYIHPRREPFEHGLLQITKLIFTDGTQTLGPIKDKLLSLSA--DSAHRVNSKSVSETL  284
            +P ++H RRE FE+G+L +  L+ +D    L   + KLL  +    +  RV +  ++  L
Sbjct  16   DPPWLHVRREVFEYGILPLPSLVHSDVVTGLRNFRVKLLQQAPPISTWKRVATAGIATAL  75

Query  285  QISPDHARLVLETVAAVLHNES---DPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRL  449
            +++  HA+L+L+T+A+VL+ E    D L  A   E+DSVGV+V DL++FLYIQ+Y+R+
Sbjct  76   EVTEAHAQLMLDTLASVLNEEGGVVDSLAIAPATEIDSVGVDVDDLLIFLYIQTYRRV  133



>gb|EMS61357.1| hypothetical protein TRIUR3_14905 [Triticum urartu]
Length=71

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  393  GVNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            G ++ D+++FLYIQSYKRL+P+ HKDS  VADVWPSTSAFDG LSAL
Sbjct  4    GADLRDVLLFLYIQSYKRLVPRPHKDSPVVADVWPSTSAFDGYLSAL  50



>ref|XP_006657134.1| PREDICTED: TBCC domain-containing protein 1-like, partial [Oryza 
brachyantha]
Length=481

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +3

Query  357  LVSANPAEVDSVG------VNVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDG  518
            L +  PAE  ++G       ++ D+++FLYIQSYKRL+P+ HKDS AVADVWPSTSAFDG
Sbjct  1    LAAVLPAEDPALGEDGTGDADLRDVLLFLYIQSYKRLVPRAHKDSPAVADVWPSTSAFDG  60

Query  519  XLSAL  533
             LSAL
Sbjct  61   YLSAL  65



>ref|XP_006648417.1| PREDICTED: TBCC domain-containing protein 1-like [Oryza brachyantha]
Length=484

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  399  NVFDLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            ++ D+++FLYIQSYKRL+P+ HKDS AV DVWPSTSAFDG LSAL
Sbjct  27   DIRDVLLFLYIQSYKRLVPRAHKDSPAVTDVWPSTSAFDGYLSAL  71



>gb|EEE56495.1| hypothetical protein OsJ_05741 [Oryza sativa Japonica Group]
Length=544

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  408  DLVVFLYIQSYKRLLPKGHKDSAAVADVWPSTSAFDGXLSAL  533
            D+++FLYIQSYKRL+P+ HKDS AV DVWPSTSAFDG LSAL
Sbjct  90   DVLLFLYIQSYKRLVPRAHKDSPAVTDVWPSTSAFDGYLSAL  131



>ref|XP_008656241.1| PREDICTED: uncharacterized protein LOC103635607 [Zea mays]
Length=168

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +3

Query  123  IHPRREPFEHGLLQITKLIFTDG--TQTLGPIKDKLLSLSADSAHRVNSKSVSETLQISP  296
            + P+RE FEHGLL I KLIF +G   QTL  +K+KL +   D   RV + ++++  QI P
Sbjct  33   LRPQREAFEHGLLPIPKLIFPEGMLAQTLAQLKEKLAASVPDG--RVRAAALAKAQQI-P  89

Query  297  DHARLVLETVAAVLHNESDPLVSANPAEVDSVGVNVFDLVVFLYIQSYKRLL  452
                 +     A +    DP++      +D    ++ D+++FLYIQSYKRL+
Sbjct  90   QEQAALALGTLAAMLPAEDPVLGDG--AMDGAAADIRDVLLFLYIQSYKRLV  139



>ref|XP_002505027.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66285.1| predicted protein [Micromonas sp. RCC299]
Length=634

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 14/115 (12%)
 Frame = +3

Query  132  RREPFEHGLLQITKLI-FTDGTQTLGPIKDKLLSLSADSAHR-----VNSKSVSETLQIS  293
            RREPF+ G+L  + L+   +    L PI+ +LL  +  S H      V+    ++ + I+
Sbjct  13   RREPFDFGILPASFLLPRAESVAALVPIQRRLLQCAHPSRHDPTKLVVSVADAAQCMGIA  72

Query  294  PDHARLVLETVAAVLHNESDPLVSANPAEVDSVG----VNVFDLVVFLYIQSYKR  446
            P HA  V++T+ AV   E  P    +PAE D +     V V  L+ FL++Q++ R
Sbjct  73   PQHAEHVIDTMHAVAPAEPTP----HPAEDDGLPNEPEVRVQHLLQFLFVQTFAR  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200