BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004K21

Length=367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622729.1|  PREDICTED: phosphoinositide phospholipase C ...    119   1e-28   Nicotiana tomentosiformis
ref|NP_001234181.1|  PI-phospholipase C PLC4                            117   6e-28   Solanum lycopersicum
emb|CAA65127.1|  phosphoinositide-specific phospholipase C              117   6e-28   Nicotiana rustica [wild tobacco]
ref|XP_006344048.1|  PREDICTED: phosphoinositide phospholipase C ...    117   7e-28   Solanum tuberosum [potatoes]
ref|XP_009790378.1|  PREDICTED: phosphoinositide phospholipase C 4      117   7e-28   Nicotiana sylvestris
emb|CAA72681.1|  1-phosphatidylinositol-4,5-bisphosphate phosphod...    116   1e-27   Nicotiana rustica [wild tobacco]
emb|CDP09195.1|  unnamed protein product                                111   1e-25   Coffea canephora [robusta coffee]
ref|XP_002278527.1|  PREDICTED: phosphoinositide phospholipase C ...    107   2e-24   Vitis vinifera
gb|KCW85436.1|  hypothetical protein EUGRSUZ_B02250                     106   3e-24   Eucalyptus grandis [rose gum]
ref|XP_010043428.1|  PREDICTED: phosphoinositide phospholipase C ...    106   6e-24   Eucalyptus grandis [rose gum]
ref|XP_007016097.1|  Phosphatidylinositol-speciwc phospholipase C4      105   1e-23   
gb|KHG04158.1|  Phosphoinositide phospholipase C 4 -like protein        105   2e-23   Gossypium arboreum [tree cotton]
gb|KJB35246.1|  hypothetical protein B456_006G106400                    103   2e-23   Gossypium raimondii
gb|KJB35245.1|  hypothetical protein B456_006G106400                    103   2e-23   Gossypium raimondii
gb|KDP46490.1|  hypothetical protein JCGZ_08462                         104   3e-23   Jatropha curcas
gb|KJB35242.1|  hypothetical protein B456_006G106400                    103   4e-23   Gossypium raimondii
gb|EPS61000.1|  hypothetical protein M569_13801                         103   4e-23   Genlisea aurea
ref|XP_010650899.1|  PREDICTED: phosphoinositide phospholipase C ...    101   2e-22   Vitis vinifera
gb|ABU53666.1|  phospholipase C                                         101   2e-22   Torenia fournieri [bluewings]
gb|KDO66895.1|  hypothetical protein CISIN_1g007887mg                   100   3e-22   Citrus sinensis [apfelsine]
ref|XP_002278839.2|  PREDICTED: phosphoinositide phospholipase C ...    100   4e-22   Vitis vinifera
ref|XP_006488531.1|  PREDICTED: phosphoinositide phospholipase C ...    100   4e-22   Citrus sinensis [apfelsine]
ref|XP_006425071.1|  hypothetical protein CICLE_v10028080mg             100   6e-22   Citrus clementina [clementine]
gb|KDO66894.1|  hypothetical protein CISIN_1g007887mg                   100   7e-22   Citrus sinensis [apfelsine]
gb|KJB55735.1|  hypothetical protein B456_009G091900                  97.8    1e-21   Gossypium raimondii
ref|XP_009347256.1|  PREDICTED: phosphoinositide phospholipase C ...  99.4    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_008220865.1|  PREDICTED: phosphoinositide phospholipase C ...  98.6    3e-21   Prunus mume [ume]
ref|XP_002299806.2|  hypothetical protein POPTR_0001s25910g           97.4    8e-21   
gb|AFO54605.1|  phospholipase C                                       96.7    1e-20   Populus tomentosa [Chinese white poplar]
ref|XP_007206576.1|  hypothetical protein PRUPE_ppa020283mg           96.3    2e-20   Prunus persica
ref|XP_004294231.1|  PREDICTED: phosphoinositide phospholipase C ...  96.3    2e-20   Fragaria vesca subsp. vesca
ref|XP_008355042.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...  96.3    2e-20   
ref|XP_011460953.1|  PREDICTED: phosphoinositide phospholipase C ...  96.3    2e-20   Fragaria vesca subsp. vesca
ref|XP_010937845.1|  PREDICTED: phosphoinositide phospholipase C ...  95.9    3e-20   Elaeis guineensis
ref|XP_010937844.1|  PREDICTED: phosphoinositide phospholipase C ...  95.9    3e-20   Elaeis guineensis
ref|XP_008220858.1|  PREDICTED: phosphoinositide phospholipase C ...  95.5    4e-20   Prunus mume [ume]
ref|XP_007208015.1|  hypothetical protein PRUPE_ppa003249mg           95.1    5e-20   Prunus persica
gb|EYU45716.1|  hypothetical protein MIMGU_mgv1a003401mg              95.1    5e-20   Erythranthe guttata [common monkey flower]
gb|KJB82225.1|  hypothetical protein B456_013G182800                  89.4    6e-20   Gossypium raimondii
gb|KJB55731.1|  hypothetical protein B456_009G091900                  94.4    6e-20   Gossypium raimondii
gb|KHG10596.1|  Phosphoinositide phospholipase C 4                    94.7    7e-20   Gossypium arboreum [tree cotton]
gb|KJB55734.1|  hypothetical protein B456_009G091900                  94.7    7e-20   Gossypium raimondii
ref|XP_011043776.1|  PREDICTED: phosphoinositide phospholipase C ...  94.0    1e-19   Populus euphratica
ref|XP_010520201.1|  PREDICTED: phosphoinositide phospholipase C 4    92.4    5e-19   Tarenaya hassleriana [spider flower]
gb|KJB81975.1|  hypothetical protein B456_013G170100                  87.4    5e-19   Gossypium raimondii
gb|KHG10595.1|  Phosphoinositide phospholipase C 4                    92.0    6e-19   Gossypium arboreum [tree cotton]
ref|XP_008805482.1|  PREDICTED: phosphoinositide phospholipase C ...  91.7    9e-19   Phoenix dactylifera
ref|XP_010685546.1|  PREDICTED: phosphoinositide phospholipase C ...  90.9    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006488534.1|  PREDICTED: phosphoinositide phospholipase C ...  88.6    3e-18   
gb|KDO66899.1|  hypothetical protein CISIN_1g007473mg                 88.6    3e-18   Citrus sinensis [apfelsine]
gb|KDO66898.1|  hypothetical protein CISIN_1g007473mg                 89.0    4e-18   Citrus sinensis [apfelsine]
gb|KDO66897.1|  hypothetical protein CISIN_1g007473mg                 89.0    6e-18   Citrus sinensis [apfelsine]
ref|XP_006488533.1|  PREDICTED: phosphoinositide phospholipase C ...  88.6    6e-18   Citrus sinensis [apfelsine]
gb|KDO66896.1|  hypothetical protein CISIN_1g007473mg                 89.0    9e-18   Citrus sinensis [apfelsine]
ref|XP_006488532.1|  PREDICTED: phosphoinositide phospholipase C ...  88.6    9e-18   Citrus sinensis [apfelsine]
ref|XP_006425073.1|  hypothetical protein CICLE_v10028054mg           87.8    1e-17   
ref|XP_009402378.1|  PREDICTED: phosphoinositide phospholipase C ...  87.8    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16299.1|  unknown                                               87.4    3e-17   Picea sitchensis
ref|XP_009794867.1|  PREDICTED: phosphoinositide phospholipase C ...  87.0    3e-17   Nicotiana sylvestris
gb|AAL23439.1|  phosphoinositide-specific phospholipase C4            86.7    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385549.1|  PREDICTED: phosphoinositide phospholipase C ...  86.3    7e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_200678.2|  phosphoinositide phospholipase C 4                  86.3    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008457371.1|  PREDICTED: phosphoinositide phospholipase C ...  86.3    7e-17   Cucumis melo [Oriental melon]
ref|XP_009385550.1|  PREDICTED: phosphoinositide phospholipase C ...  86.3    7e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB55726.1|  hypothetical protein B456_009G091700                  86.3    7e-17   Gossypium raimondii
ref|XP_009385551.1|  PREDICTED: phosphoinositide phospholipase C ...  85.9    7e-17   
ref|XP_007016095.1|  Phosphatidylinositol-speciwc phospholipase C...  86.3    8e-17   
ref|XP_007016094.1|  Phosphatidylinositol-speciwc phospholipase C...  85.9    8e-17   
ref|XP_010922549.1|  PREDICTED: phosphoinositide phospholipase C ...  85.9    9e-17   Elaeis guineensis
ref|XP_008457370.1|  PREDICTED: phosphoinositide phospholipase C ...  85.9    9e-17   Cucumis melo [Oriental melon]
ref|XP_006425074.1|  hypothetical protein CICLE_v10028054mg           85.9    1e-16   Citrus clementina [clementine]
ref|XP_009783760.1|  PREDICTED: phosphoinositide phospholipase C ...  85.9    1e-16   Nicotiana sylvestris
ref|XP_009783759.1|  PREDICTED: phosphoinositide phospholipase C ...  85.9    1e-16   Nicotiana sylvestris
ref|XP_011076690.1|  PREDICTED: phosphoinositide phospholipase C ...  84.7    3e-16   Sesamum indicum [beniseed]
ref|XP_004490600.1|  PREDICTED: phosphoinositide phospholipase C ...  84.7    3e-16   Cicer arietinum [garbanzo]
ref|XP_010253909.1|  PREDICTED: phosphoinositide phospholipase C ...  84.3    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010253908.1|  PREDICTED: phosphoinositide phospholipase C ...  84.3    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_004153207.1|  PREDICTED: phosphoinositide phospholipase C ...  84.0    5e-16   
ref|XP_004145255.1|  PREDICTED: phosphoinositide phospholipase C ...  84.0    5e-16   
gb|EYU20014.1|  hypothetical protein MIMGU_mgv1a0236391mg             79.0    5e-16   Erythranthe guttata [common monkey flower]
ref|XP_009586599.1|  PREDICTED: phosphoinositide phospholipase C ...  83.6    5e-16   Nicotiana tomentosiformis
gb|KGN65808.1|  hypothetical protein Csa_1G531180                     83.6    6e-16   Cucumis sativus [cucumbers]
ref|XP_010483472.1|  PREDICTED: phosphoinositide phospholipase C ...  83.2    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_003615683.1|  Phosphoinositide phospholipase C                 79.7    8e-16   
ref|XP_010483471.1|  PREDICTED: phosphoinositide phospholipase C ...  83.2    8e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010685545.1|  PREDICTED: phosphoinositide phospholipase C ...  82.8    1e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010920867.1|  PREDICTED: phosphoinositide phospholipase C ...  82.8    1e-15   Elaeis guineensis
ref|XP_010920866.1|  PREDICTED: phosphoinositide phospholipase C ...  82.4    1e-15   Elaeis guineensis
ref|XP_002525651.1|  1-phosphatidylinositol-4,5-bisphosphate phos...  82.0    2e-15   Ricinus communis
gb|AIU41540.1|  phosphatidylinositol phospholipase C 7                81.3    3e-15   Solanum lycopersicum
ref|XP_010443621.1|  PREDICTED: phosphoinositide phospholipase C ...  81.3    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010443620.1|  PREDICTED: phosphoinositide phospholipase C ...  81.3    4e-15   Camelina sativa [gold-of-pleasure]
gb|ABR16641.1|  unknown                                               80.9    5e-15   Picea sitchensis
ref|XP_006843548.1|  hypothetical protein AMTR_s00007p00065880        80.9    5e-15   Amborella trichopoda
gb|EYU22354.1|  hypothetical protein MIMGU_mgv1a001900mg              80.9    6e-15   Erythranthe guttata [common monkey flower]
ref|XP_009380683.1|  PREDICTED: phosphoinositide phospholipase C ...  79.7    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010535374.1|  PREDICTED: phosphoinositide phospholipase C ...  79.3    1e-14   
ref|XP_006279487.1|  hypothetical protein CARUB_v10026125mg           79.3    2e-14   Capsella rubella
ref|XP_010318244.1|  PREDICTED: phosphoinositide phospholipase C ...  79.7    2e-14   
gb|AES98642.2|  phosphatidylinositol-specific phospholipase C         79.0    2e-14   Medicago truncatula
emb|CDY32691.1|  BnaA02g07530D                                        79.0    3e-14   Brassica napus [oilseed rape]
gb|KFK27404.1|  hypothetical protein AALP_AA8G378600                  78.6    3e-14   Arabis alpina [alpine rockcress]
ref|XP_008789096.1|  PREDICTED: phosphoinositide phospholipase C ...  76.3    3e-14   Phoenix dactylifera
ref|XP_002311222.1|  phosphoinositide-specific phospholipase C fa...  78.6    3e-14   
ref|XP_004166852.1|  PREDICTED: phosphoinositide phospholipase C ...  77.8    4e-14   
ref|XP_011045853.1|  PREDICTED: phosphoinositide phospholipase C ...  78.2    4e-14   Populus euphratica
ref|XP_004138421.1|  PREDICTED: phosphoinositide phospholipase C ...  78.2    5e-14   Cucumis sativus [cucumbers]
ref|XP_006356459.1|  PREDICTED: phosphoinositide phospholipase C ...  78.2    7e-14   Solanum tuberosum [potatoes]
ref|XP_011084908.1|  PREDICTED: phosphoinositide phospholipase C 6    77.4    9e-14   Sesamum indicum [beniseed]
ref|XP_009126743.1|  PREDICTED: phosphoinositide phospholipase C 4    77.0    1e-13   Brassica rapa
ref|XP_011045930.1|  PREDICTED: phosphoinositide phospholipase C ...  77.0    1e-13   Populus euphratica
emb|CDP14022.1|  unnamed protein product                              77.0    1e-13   Coffea canephora [robusta coffee]
gb|AFN53674.1|  hypothetical protein                                  76.6    1e-13   Linum usitatissimum
ref|XP_002316213.2|  phosphoinositide-specific phospholipase C fa...  76.6    2e-13   
ref|XP_009399994.1|  PREDICTED: phosphoinositide phospholipase C ...  76.6    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006338847.1|  PREDICTED: phosphoinositide phospholipase C ...  76.3    2e-13   
ref|XP_008806127.1|  PREDICTED: phosphoinositide phospholipase C ...  75.9    2e-13   
ref|XP_008789094.1|  PREDICTED: phosphoinositide phospholipase C ...  75.9    3e-13   Phoenix dactylifera
ref|XP_008789093.1|  PREDICTED: phosphoinositide phospholipase C ...  75.9    3e-13   Phoenix dactylifera
gb|EPS71356.1|  hypothetical protein M569_03403                       75.1    5e-13   Genlisea aurea
gb|AJA33385.1|  phosphatidylinositol phospholipase C 5                74.7    8e-13   Solanum lycopersicum
gb|AAW22879.1|  putative phospholipase C                              74.3    1e-12   Solanum lycopersicum
ref|XP_010922548.1|  PREDICTED: phosphoinositide phospholipase C ...  73.6    2e-12   Elaeis guineensis
ref|XP_009387519.1|  PREDICTED: phosphoinositide phospholipase C ...  73.6    2e-12   
ref|XP_009387536.1|  PREDICTED: phosphoinositide phospholipase C ...  73.6    2e-12   
ref|XP_009387528.1|  PREDICTED: phosphoinositide phospholipase C ...  73.6    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX80341.1|  BnaC09g34010D                                        73.6    2e-12   
ref|XP_009120385.1|  PREDICTED: phosphoinositide phospholipase C 4    73.6    2e-12   Brassica rapa
emb|CDY52122.1|  BnaA10g29510D                                        73.2    2e-12   Brassica napus [oilseed rape]
ref|XP_008441466.1|  PREDICTED: phosphoinositide phospholipase C 6    73.2    2e-12   Cucumis melo [Oriental melon]
ref|XP_010937846.1|  PREDICTED: phosphoinositide phospholipase C ...  72.4    5e-12   
ref|XP_010106260.1|  Phosphoinositide phospholipase C 6               72.4    5e-12   Morus notabilis
gb|AAB41107.1|  phosphoinositide-specific phospholipase C             71.6    7e-12   Vigna unguiculata
ref|NP_001234176.1|  PI-phospholipase C PLC5                          71.2    1e-11   
ref|XP_011076692.1|  PREDICTED: phosphoinositide phospholipase C ...  70.5    2e-11   Sesamum indicum [beniseed]
ref|XP_007008969.1|  Phosphoinositide-specific phospholipase C fa...  70.1    3e-11   
ref|XP_002866286.1|  phosphoinositide-specific phospholipase C fa...  69.7    3e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_002533649.1|  1-phosphatidylinositol-4,5-bisphosphate phos...  69.7    4e-11   Ricinus communis
ref|XP_010454096.1|  PREDICTED: phosphoinositide phospholipase C ...  69.3    5e-11   
ref|NP_001275400.1|  phosphoinositide phospholipase C 2-like          69.3    5e-11   Solanum tuberosum [potatoes]
ref|XP_010454105.1|  PREDICTED: phosphoinositide phospholipase C ...  69.3    6e-11   
ref|XP_006435738.1|  hypothetical protein CICLE_v10031019mg           68.6    7e-11   
ref|XP_006435739.1|  hypothetical protein CICLE_v10031019mg           68.9    7e-11   Citrus clementina [clementine]
ref|XP_009120384.1|  PREDICTED: phosphoinositide phospholipase C 5    68.9    8e-11   Brassica rapa
emb|CDY52121.1|  BnaA10g29500D                                        68.6    8e-11   Brassica napus [oilseed rape]
ref|XP_009344925.1|  PREDICTED: phosphoinositide phospholipase C ...  68.2    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_010483470.1|  PREDICTED: phosphoinositide phospholipase C ...  67.8    2e-10   Camelina sativa [gold-of-pleasure]
gb|KDO68976.1|  hypothetical protein CISIN_1g043888mg                 67.0    2e-10   Citrus sinensis [apfelsine]
ref|XP_010454117.1|  PREDICTED: phosphoinositide phospholipase C ...  67.8    2e-10   Camelina sativa [gold-of-pleasure]
gb|EYU22355.1|  hypothetical protein MIMGU_mgv1a003318mg              67.4    2e-10   Erythranthe guttata [common monkey flower]
gb|EYU20012.1|  hypothetical protein MIMGU_mgv1a003407mg              67.4    2e-10   Erythranthe guttata [common monkey flower]
emb|CDX80342.1|  BnaC09g34000D                                        67.0    3e-10   
ref|XP_002866285.1|  predicted protein                                67.0    3e-10   
ref|NP_001234190.1|  PI-phospholipase C PLC3                          67.0    3e-10   
ref|XP_010443613.1|  PREDICTED: phosphoinositide phospholipase C ...  67.0    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006401052.1|  hypothetical protein EUTSA_v10013042mg           67.0    3e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010920865.1|  PREDICTED: phosphoinositide phospholipase C ...  66.6    4e-10   Elaeis guineensis
ref|XP_010658272.1|  PREDICTED: phosphoinositide phospholipase C 6    66.6    5e-10   Vitis vinifera
gb|KHN36374.1|  Phosphoinositide phospholipase C 6                    66.6    5e-10   Glycine soja [wild soybean]
ref|XP_003616632.1|  Phosphoinositide phospholipase C                 66.6    5e-10   Medicago truncatula
ref|XP_010031224.1|  PREDICTED: phosphoinositide phospholipase C 6    66.6    5e-10   Eucalyptus grandis [rose gum]
gb|KDP46487.1|  hypothetical protein JCGZ_08459                       66.2    5e-10   Jatropha curcas
ref|XP_003538468.2|  PREDICTED: phosphoinositide phospholipase C ...  66.2    6e-10   
ref|XP_011035945.1|  PREDICTED: phosphoinositide phospholipase C ...  66.2    6e-10   Populus euphratica
ref|NP_200677.2|  phosphoinositide phospholipase C 5                  65.9    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077556.1|  PREDICTED: phosphoinositide phospholipase C ...  65.9    7e-10   Sesamum indicum [beniseed]
gb|KHN20847.1|  Phosphoinositide phospholipase C 6                    65.9    7e-10   Glycine soja [wild soybean]
ref|XP_009772725.1|  PREDICTED: phosphoinositide phospholipase C ...  65.9    8e-10   Nicotiana sylvestris
ref|XP_002525652.1|  1-phosphatidylinositol-4,5-bisphosphate phos...  65.9    8e-10   
gb|AAF33824.1|AF223573_1  phospholipase C2                            65.9    8e-10   Nicotiana tabacum [American tobacco]
ref|XP_007163545.1|  hypothetical protein PHAVU_001G243200g           65.9    8e-10   Phaseolus vulgaris [French bean]
ref|XP_007163544.1|  hypothetical protein PHAVU_001G243200g           65.5    9e-10   Phaseolus vulgaris [French bean]
ref|XP_009772724.1|  PREDICTED: phosphoinositide phospholipase C ...  65.5    9e-10   Nicotiana sylvestris
gb|AAF33823.1|AF223351_1  phospholipase C1                            65.5    9e-10   Nicotiana tabacum [American tobacco]
dbj|BAA97337.1|  phosphoinositide-specific phospholipase C-line       65.9    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253735.1|  PREDICTED: phosphoinositide phospholipase C ...  65.5    1e-09   Nelumbo nucifera [Indian lotus]
dbj|BAO02533.1|  predicted phospholipase C ortholog                   65.5    1e-09   Nicotiana alata [flowering tobacco]
ref|XP_002316212.1|  phosphoinositide-specific phospholipase C fa...  65.5    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010253733.1|  PREDICTED: phosphoinositide phospholipase C ...  65.5    1e-09   Nelumbo nucifera [Indian lotus]
gb|KCW50479.1|  hypothetical protein EUGRSUZ_J00208                   64.7    1e-09   Eucalyptus grandis [rose gum]
ref|XP_009605158.1|  PREDICTED: phosphoinositide phospholipase C ...  65.1    1e-09   Nicotiana tomentosiformis
gb|ABJ99758.1|  phospholipase C                                       65.1    1e-09   Nicotiana tabacum [American tobacco]
gb|KHN34718.1|  Phosphoinositide phospholipase C 6                    65.1    1e-09   Glycine soja [wild soybean]
ref|XP_010031217.1|  PREDICTED: phosphoinositide phospholipase C ...  65.1    2e-09   Eucalyptus grandis [rose gum]
ref|XP_010031216.1|  PREDICTED: phosphoinositide phospholipase C ...  65.1    2e-09   Eucalyptus grandis [rose gum]
gb|KCW50478.1|  hypothetical protein EUGRSUZ_J00208                   64.7    2e-09   Eucalyptus grandis [rose gum]
ref|XP_011042811.1|  PREDICTED: phosphoinositide phospholipase C ...  64.7    2e-09   Populus euphratica
ref|XP_011046045.1|  PREDICTED: phosphoinositide phospholipase C ...  64.7    2e-09   Populus euphratica
ref|XP_007141768.1|  hypothetical protein PHAVU_008G224200g           64.7    2e-09   Phaseolus vulgaris [French bean]
ref|XP_009605157.1|  PREDICTED: phosphoinositide phospholipase C ...  64.7    2e-09   Nicotiana tomentosiformis
ref|XP_007141769.1|  hypothetical protein PHAVU_008G224200g           64.7    2e-09   Phaseolus vulgaris [French bean]
ref|XP_004490993.1|  PREDICTED: phosphoinositide phospholipase C ...  64.7    2e-09   Cicer arietinum [garbanzo]
gb|ABC50164.1|  phospholipase C                                       64.7    2e-09   Petunia integrifolia subsp. inflata
ref|XP_003552358.1|  PREDICTED: phosphoinositide phospholipase C ...  64.7    2e-09   Glycine max [soybeans]
ref|XP_006601952.1|  PREDICTED: phosphoinositide phospholipase C ...  64.3    2e-09   Glycine max [soybeans]
emb|CDP14020.1|  unnamed protein product                              64.3    2e-09   Coffea canephora [robusta coffee]
ref|XP_006280227.1|  hypothetical protein CARUB_v10026144mg           64.3    3e-09   Capsella rubella
ref|XP_010689668.1|  PREDICTED: phosphoinositide phospholipase C 6    63.9    3e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008793309.1|  PREDICTED: phosphoinositide phospholipase C ...  63.9    4e-09   
ref|XP_002269949.1|  PREDICTED: phosphoinositide phospholipase C 2    63.9    4e-09   Vitis vinifera
gb|KHG08567.1|  Phosphoinositide phospholipase C 6 -like protein      63.5    5e-09   Gossypium arboreum [tree cotton]
emb|CDY07057.1|  BnaA04g22580D                                        63.5    5e-09   
gb|ABM90640.1|  phospholipase C                                       63.2    6e-09   Torenia fournieri [bluewings]
gb|KJB67581.1|  hypothetical protein B456_010G198000                  63.2    6e-09   Gossypium raimondii
gb|KJB67580.1|  hypothetical protein B456_010G198000                  63.2    7e-09   Gossypium raimondii
ref|XP_006401053.1|  hypothetical protein EUTSA_v10013061mg           63.2    7e-09   Eutrema salsugineum [saltwater cress]
gb|KDP46489.1|  hypothetical protein JCGZ_08461                       62.8    9e-09   Jatropha curcas
ref|XP_002533650.1|  1-phosphatidylinositol-4,5-bisphosphate phos...  62.4    1e-08   Ricinus communis
ref|XP_010534598.1|  PREDICTED: phosphoinositide phospholipase C 6    62.4    1e-08   Tarenaya hassleriana [spider flower]
gb|KHG11557.1|  Phosphoinositide phospholipase C 2 -like protein      62.4    1e-08   Gossypium arboreum [tree cotton]
emb|CAN62452.1|  hypothetical protein VITISV_032539                   62.4    1e-08   Vitis vinifera
ref|XP_009347255.1|  PREDICTED: phosphoinositide phospholipase C ...  62.0    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_009142132.1|  PREDICTED: phosphoinositide phospholipase C ...  62.0    1e-08   
gb|KDP44771.1|  hypothetical protein JCGZ_01271                       62.0    2e-08   Jatropha curcas
ref|XP_007016093.1|  Phospholipase C 2, putative                      62.0    2e-08   
emb|CBI30388.3|  unnamed protein product                              61.6    2e-08   Vitis vinifera
gb|KDP46488.1|  hypothetical protein JCGZ_08460                       61.6    2e-08   Jatropha curcas
ref|XP_010446364.1|  PREDICTED: phosphoinositide phospholipase C ...  61.2    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_007008968.1|  Phospholipase C 2                                61.2    2e-08   
ref|XP_008384797.1|  PREDICTED: phosphoinositide phospholipase C ...  61.2    2e-08   
ref|XP_010541457.1|  PREDICTED: phosphoinositide phospholipase C ...  61.2    3e-08   Tarenaya hassleriana [spider flower]
emb|CDY22153.1|  BnaC01g39480D                                        61.2    3e-08   Brassica napus [oilseed rape]
ref|XP_010541455.1|  PREDICTED: phosphoinositide phospholipase C ...  61.2    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_006297293.1|  hypothetical protein CARUB_v10013310mg           61.2    3e-08   Capsella rubella
ref|XP_011460955.1|  PREDICTED: phosphoinositide phospholipase C 2    61.2    3e-08   Fragaria vesca subsp. vesca
ref|XP_009123935.1|  PREDICTED: phosphoinositide phospholipase C 2    61.2    3e-08   Brassica rapa
ref|XP_006297294.1|  hypothetical protein CARUB_v10013310mg           60.8    3e-08   
ref|XP_010654153.1|  PREDICTED: phosphoinositide phospholipase C ...  61.2    3e-08   Vitis vinifera
ref|XP_010541458.1|  PREDICTED: phosphoinositide phospholipase C ...  60.8    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_007205014.1|  hypothetical protein PRUPE_ppa003685mg           60.8    3e-08   Prunus persica
ref|XP_009143251.1|  PREDICTED: phosphoinositide phospholipase C 6    60.8    4e-08   Brassica rapa
gb|AFW90632.1|  phosphoinositide-specific phospholipase C             58.9    4e-08   Solanum tuberosum [potatoes]
ref|XP_010541456.1|  PREDICTED: phosphoinositide phospholipase C ...  60.8    4e-08   Tarenaya hassleriana [spider flower]
gb|EYU26667.1|  hypothetical protein MIMGU_mgv1a003464mg              60.8    4e-08   Erythranthe guttata [common monkey flower]
gb|KJB74323.1|  hypothetical protein B456_011G288000                  60.5    5e-08   Gossypium raimondii
ref|XP_002311223.1|  phosphoinositide-specific phospholipase C fa...  60.5    5e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010689655.1|  PREDICTED: phosphoinositide phospholipase C 2    60.5    6e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB55725.1|  hypothetical protein B456_009G091600                  60.1    6e-08   Gossypium raimondii
ref|XP_004490992.1|  PREDICTED: phosphoinositide phospholipase C ...  60.1    7e-08   
emb|CDY70294.1|  BnaCnng67650D                                        59.7    8e-08   Brassica napus [oilseed rape]
ref|NP_001234203.1|  PI-phospholipase C PLC1                          60.1    8e-08   Solanum lycopersicum
ref|XP_009344939.1|  PREDICTED: phosphoinositide phospholipase C ...  60.1    8e-08   Pyrus x bretschneideri [bai li]
gb|AIG51130.1|  phospholipase C                                       59.7    8e-08   Gossypium hirsutum [American cotton]
ref|XP_007218974.1|  hypothetical protein PRUPE_ppa003890mg           59.7    8e-08   
ref|XP_009116286.1|  PREDICTED: phosphoinositide phospholipase C 7    59.7    9e-08   Brassica rapa
ref|XP_009612249.1|  PREDICTED: phosphoinositide phospholipase C ...  59.7    9e-08   Nicotiana tomentosiformis
ref|XP_010446184.1|  PREDICTED: phosphoinositide phospholipase C ...  57.0    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008220880.1|  PREDICTED: phosphoinositide phospholipase C ...  59.7    9e-08   Prunus mume [ume]
ref|XP_008220872.1|  PREDICTED: phosphoinositide phospholipase C ...  59.7    9e-08   
ref|XP_004490991.1|  PREDICTED: phosphoinositide phospholipase C ...  59.7    9e-08   Cicer arietinum [garbanzo]
ref|XP_010431793.1|  PREDICTED: phosphoinositide phospholipase C ...  59.7    1e-07   Camelina sativa [gold-of-pleasure]
emb|CDY07623.1|  BnaA03g18880D                                        59.7    1e-07   Brassica napus [oilseed rape]
ref|XP_010104623.1|  Phosphoinositide phospholipase C 2               59.7    1e-07   
emb|CDX72188.1|  BnaC08g26860D                                        59.7    1e-07   
emb|CDY27254.1|  BnaA09g35480D                                        59.7    1e-07   Brassica napus [oilseed rape]
emb|CDY60344.1|  BnaC03g72360D                                        59.3    1e-07   Brassica napus [oilseed rape]
ref|XP_002884682.1|  predicted protein                                59.3    1e-07   
gb|KHG13942.1|  Phosphoinositide phospholipase C 2 -like protein      59.3    1e-07   Gossypium arboreum [tree cotton]
gb|ACF93733.1|  phospholipase C                                       59.3    1e-07   Spinacia oleracea
ref|XP_004490990.1|  PREDICTED: phosphoinositide phospholipase C ...  59.3    1e-07   Cicer arietinum [garbanzo]
ref|XP_010436950.1|  PREDICTED: phosphoinositide phospholipase C ...  59.3    1e-07   Camelina sativa [gold-of-pleasure]
emb|CDY61706.1|  BnaC04g56690D                                        58.9    1e-07   Brassica napus [oilseed rape]
ref|XP_010106259.1|  Phosphoinositide phospholipase C 2               58.9    2e-07   Morus notabilis
ref|XP_010464460.1|  PREDICTED: phosphoinositide phospholipase C ...  58.9    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010436951.1|  PREDICTED: phosphoinositide phospholipase C ...  58.9    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010461812.1|  PREDICTED: phosphoinositide phospholipase C 2    58.9    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_003600903.1|  Phosphoinositide phospholipase C                 58.9    2e-07   Medicago truncatula
gb|KDO68974.1|  hypothetical protein CISIN_1g007399mg                 58.5    2e-07   Citrus sinensis [apfelsine]
gb|AAD26119.1|AF108123_1  phosphoinositide-specific phospholipase C   58.5    2e-07   Brassica napus [oilseed rape]
ref|XP_006411261.1|  hypothetical protein EUTSA_v10016400mg           58.5    2e-07   
gb|KHG14938.1|  Phosphoinositide phospholipase C 2 -like protein      58.5    2e-07   Gossypium arboreum [tree cotton]
emb|CDY35983.1|  BnaA05g29670D                                        58.5    2e-07   Brassica napus [oilseed rape]
ref|XP_006407765.1|  hypothetical protein EUTSA_v10020359mg           58.5    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_009147001.1|  PREDICTED: phosphoinositide phospholipase C 2    58.5    2e-07   Brassica rapa
ref|NP_001275298.1|  phosphoinositide phospholipase C 2-like          58.5    2e-07   Solanum tuberosum [potatoes]
ref|XP_010067519.1|  PREDICTED: phosphoinositide phospholipase C ...  58.5    2e-07   Eucalyptus grandis [rose gum]
gb|KJB76190.1|  hypothetical protein B456_012G076900                  58.2    2e-07   Gossypium raimondii
ref|XP_006295484.1|  hypothetical protein CARUB_v10024587mg           58.5    3e-07   Capsella rubella
gb|KJB67578.1|  hypothetical protein B456_010G197900                  58.2    3e-07   Gossypium raimondii
gb|KJB76187.1|  hypothetical protein B456_012G076900                  58.2    3e-07   
gb|KJB67579.1|  hypothetical protein B456_010G197900                  58.2    3e-07   
emb|CDY68902.1|  BnaCnng61000D                                        57.4    3e-07   
ref|XP_003600894.1|  Phosphoinositide phospholipase C                 58.2    3e-07   
ref|XP_006435740.1|  hypothetical protein CICLE_v10031029mg           58.2    3e-07   
gb|KDO68971.1|  hypothetical protein CISIN_1g007399mg                 58.2    3e-07   
ref|XP_010508911.1|  PREDICTED: phosphoinositide phospholipase C ...  58.2    3e-07   
gb|KDO68972.1|  hypothetical protein CISIN_1g007399mg                 58.2    3e-07   
ref|XP_002879846.1|  phosphoinositide-specific phospholipase C fa...  58.2    3e-07   
ref|XP_010486390.1|  PREDICTED: phosphoinositide phospholipase C ...  58.2    3e-07   
gb|KHG10597.1|  Phosphoinositide phospholipase C 2 -like protein      57.8    3e-07   
ref|XP_010486391.1|  PREDICTED: phosphoinositide phospholipase C ...  58.2    3e-07   
gb|KJB76188.1|  hypothetical protein B456_012G076900                  57.8    3e-07   
ref|XP_006285579.1|  hypothetical protein CARUB_v10007023mg           57.8    4e-07   
ref|XP_010517422.1|  PREDICTED: phosphoinositide phospholipase C 6    57.8    4e-07   
ref|XP_010535516.1|  PREDICTED: phosphoinositide phospholipase C ...  57.8    4e-07   
gb|KDO68975.1|  hypothetical protein CISIN_1g007399mg                 57.4    4e-07   
ref|XP_004307643.1|  PREDICTED: phosphoinositide phospholipase C 6    57.8    4e-07   
ref|XP_010031214.1|  PREDICTED: phosphoinositide phospholipase C ...  57.8    4e-07   
gb|KCW50476.1|  hypothetical protein EUGRSUZ_J00207                   57.8    4e-07   
emb|CDP06481.1|  unnamed protein product                              57.8    4e-07   
ref|XP_007220552.1|  hypothetical protein PRUPE_ppa003223mg           57.4    4e-07   
ref|XP_007220553.1|  hypothetical protein PRUPE_ppa003223mg           57.8    4e-07   
gb|KDO68970.1|  hypothetical protein CISIN_1g007399mg                 57.8    4e-07   
ref|XP_010505719.1|  PREDICTED: phosphoinositide phospholipase C ...  57.8    4e-07   
ref|XP_009133410.1|  PREDICTED: phosphoinositide phospholipase C ...  57.8    5e-07   
ref|NP_187464.1|  phosphoinositide phospholipase C 2                  57.4    5e-07   
gb|KJB67576.1|  hypothetical protein B456_010G197900                  57.0    5e-07   
ref|NP_001154596.1|  phosphoinositide phospholipase C 2               57.4    6e-07   
ref|XP_010454072.1|  PREDICTED: phosphoinositide phospholipase C ...  57.4    6e-07   
ref|XP_011043779.1|  PREDICTED: phosphoinositide phospholipase C ...  57.4    6e-07   
ref|XP_006338846.1|  PREDICTED: phosphoinositide phospholipase C ...  57.0    6e-07   
ref|NP_001275075.1|  phosphoinositide phospholipase C 2-like          57.0    6e-07   
ref|XP_011469919.1|  PREDICTED: phosphoinositide phospholipase C ...  57.4    6e-07   
ref|XP_002960627.1|  hypothetical protein SELMODRAFT_75628            57.4    6e-07   
ref|XP_008374888.1|  PREDICTED: phosphoinositide phospholipase C ...  56.6    6e-07   
ref|XP_011469918.1|  PREDICTED: phosphoinositide phospholipase C ...  57.0    7e-07   
ref|XP_002983412.1|  hypothetical protein SELMODRAFT_180165           57.0    7e-07   
ref|XP_009101938.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...  57.0    7e-07   
ref|XP_011043778.1|  PREDICTED: phosphoinositide phospholipase C ...  57.0    7e-07   
ref|XP_010443612.1|  PREDICTED: phosphoinositide phospholipase C ...  57.0    8e-07   
ref|XP_011043777.1|  PREDICTED: phosphoinositide phospholipase C ...  57.0    8e-07   
ref|XP_010427395.1|  PREDICTED: phosphoinositide phospholipase C 7    57.0    8e-07   
ref|XP_010264635.1|  PREDICTED: phosphoinositide phospholipase C ...  57.0    8e-07   
ref|XP_010264634.1|  PREDICTED: phosphoinositide phospholipase C ...  57.0    8e-07   
emb|CDY70829.1|  BnaA06g40820D                                        56.6    9e-07   
ref|XP_009120383.1|  PREDICTED: phosphoinositide phospholipase C 1    56.6    9e-07   
ref|XP_008343623.1|  PREDICTED: phosphoinositide phospholipase C ...  56.6    9e-07   
ref|NP_195565.2|  putative phosphoinositide phospholipase C 3         56.6    1e-06   
ref|XP_010507470.1|  PREDICTED: phosphoinositide phospholipase C ...  56.2    1e-06   
emb|CDX80344.1|  BnaC09g33980D                                        56.2    1e-06   
ref|XP_006411645.1|  hypothetical protein EUTSA_v10024782mg           56.2    1e-06   
ref|XP_010483467.1|  PREDICTED: phosphoinositide phospholipase C 1    56.2    1e-06   
emb|CBI22792.3|  unnamed protein product                              55.8    2e-06   
gb|AFY98823.1|  phospholipase C                                       55.8    2e-06   
ref|XP_010653296.1|  PREDICTED: phosphoinositide phospholipase C ...  55.8    2e-06   
ref|XP_006575538.1|  PREDICTED: phosphoinositide phospholipase C ...  55.8    2e-06   
ref|XP_006290813.1|  hypothetical protein CARUB_v10016918mg           55.8    2e-06   
gb|KFK38259.1|  phosphoinositide phospholipase c 2                    55.8    2e-06   
ref|XP_008369253.1|  PREDICTED: phosphoinositide phospholipase C ...  55.8    2e-06   
emb|CDY71238.1|  BnaAnng36640D                                        55.1    2e-06   
ref|XP_006401054.1|  hypothetical protein EUTSA_v10013134mg           55.5    2e-06   
ref|XP_002525653.1|  1-phosphatidylinositol-4,5-bisphosphate phos...  55.5    2e-06   
emb|CBI15948.3|  unnamed protein product                              55.5    2e-06   
ref|NP_191153.1|  phosphoinositide phospholipase C 7                  55.5    2e-06   
ref|XP_006649906.1|  PREDICTED: phosphoinositide phospholipase C ...  55.5    2e-06   
ref|XP_002876343.1|  hypothetical protein ARALYDRAFT_486035           55.5    3e-06   
gb|KFK34832.1|  hypothetical protein AALP_AA5G198900                  55.5    3e-06   
ref|XP_010534599.1|  PREDICTED: phosphoinositide phospholipase C 2    55.1    3e-06   
gb|KFK30454.1|  hypothetical protein AALP_AA7G263300                  55.1    3e-06   
ref|XP_010650898.1|  PREDICTED: phosphoinositide phospholipase C 2    55.1    3e-06   
ref|XP_008233757.1|  PREDICTED: phosphoinositide phospholipase C ...  55.1    3e-06   
ref|XP_006601953.1|  PREDICTED: phosphoinositide phospholipase C ...  55.1    3e-06   
ref|XP_008233758.1|  PREDICTED: phosphoinositide phospholipase C ...  55.1    3e-06   
ref|XP_009369165.1|  PREDICTED: phosphoinositide phospholipase C ...  55.1    3e-06   
ref|XP_006437477.1|  hypothetical protein CICLE_v10030935mg           55.1    3e-06   
gb|KHN35903.1|  Phosphoinositide phospholipase C 2                    52.4    4e-06   
ref|XP_002866805.1|  ATPLC1                                           54.7    4e-06   
ref|XP_010516186.1|  PREDICTED: phosphoinositide phospholipase C ...  54.7    4e-06   
ref|XP_010516185.1|  PREDICTED: phosphoinositide phospholipase C ...  54.7    4e-06   
gb|AEK84223.1|  phosphoinositide-specific phospholipase-like protein  54.3    5e-06   
ref|XP_003616636.1|  Phosphoinositide phospholipase C                 54.3    5e-06   
ref|XP_006280254.1|  hypothetical protein CARUB_v10026170mg           54.3    5e-06   
ref|XP_007141766.1|  hypothetical protein PHAVU_008G224000g           54.3    6e-06   
ref|XP_004500491.1|  PREDICTED: phosphoinositide phospholipase C ...  54.3    6e-06   
ref|XP_004500490.1|  PREDICTED: phosphoinositide phospholipase C ...  53.9    7e-06   
gb|AAC05023.1|  phosphoinositol-specific phospholipase C delta        53.9    7e-06   
ref|XP_009783482.1|  PREDICTED: phosphoinositide phospholipase C ...  53.9    7e-06   
ref|NP_568881.1|  phosphoinositide phospholipase C 1                  53.9    7e-06   
gb|KFK27408.1|  hypothetical protein AALP_AA8G379100                  53.9    7e-06   
ref|NP_001236167.1|  phosphatidylinositol-specific phospholipase C    53.9    7e-06   
gb|KHN48566.1|  Phosphoinositide phospholipase C 2                    53.9    8e-06   
gb|AAM90315.1|  phospholipase C                                       53.9    8e-06   
ref|XP_009783481.1|  PREDICTED: phosphoinositide phospholipase C ...  53.9    8e-06   
emb|CAA75546.2|  phospholipase C                                      53.9    8e-06   
emb|CDY32694.1|  BnaA02g07560D                                        53.9    8e-06   
ref|XP_002299804.2|  hypothetical protein POPTR_0001s25930g           53.9    9e-06   
ref|XP_002866283.1|  ATPLC1                                           53.5    9e-06   
ref|XP_009783480.1|  PREDICTED: phosphoinositide phospholipase C ...  53.5    9e-06   
gb|KHN34719.1|  Phosphoinositide phospholipase C 6                    53.5    1e-05   
gb|KFK36899.1|  hypothetical protein AALP_AA4G187200                  53.5    1e-05   
ref|XP_010322097.1|  PREDICTED: PI-phospholipase C PLC2 isoform X1    53.5    1e-05   
ref|XP_009586601.1|  PREDICTED: phosphoinositide phospholipase C ...  53.5    1e-05   
ref|XP_007141767.1|  hypothetical protein PHAVU_008G224100g           53.5    1e-05   
ref|XP_008369255.1|  PREDICTED: phosphoinositide phospholipase C ...  53.5    1e-05   
ref|XP_008369254.1|  PREDICTED: phosphoinositide phospholipase C ...  53.5    1e-05   
ref|XP_009586600.1|  PREDICTED: phosphoinositide phospholipase C ...  53.1    1e-05   
ref|XP_006484628.1|  PREDICTED: phosphoinositide phospholipase C ...  53.5    1e-05   
ref|NP_001234197.1|  PI-phospholipase C PLC2                          53.1    1e-05   
gb|KDO53055.1|  hypothetical protein CISIN_1g042071mg                 53.1    1e-05   
gb|AAW22878.1|  putative phospholipase C                              53.1    1e-05   
gb|EPS72762.1|  hypothetical protein M569_01992                       53.1    1e-05   
emb|CDY61028.1|  BnaAnng17370D                                        53.1    1e-05   
ref|XP_011462089.1|  PREDICTED: phosphoinositide phospholipase C ...  52.8    2e-05   
gb|ABF95388.1|  phosphoinositide-specific phospholipase C, putative   50.1    2e-05   
ref|NP_001235310.1|  phosphoinositide-specific phospholipase C P13    52.8    2e-05   
ref|XP_009132032.1|  PREDICTED: phosphoinositide phospholipase C ...  52.4    2e-05   
ref|XP_004490994.1|  PREDICTED: phosphoinositide phospholipase C ...  52.4    3e-05   
gb|KJB55723.1|  hypothetical protein B456_009G091400                  52.0    3e-05   
ref|XP_009369166.1|  PREDICTED: phosphoinositide phospholipase C ...  52.0    3e-05   
ref|XP_009369167.1|  PREDICTED: phosphoinositide phospholipase C ...  52.0    3e-05   
ref|XP_004149233.1|  PREDICTED: phosphoinositide phospholipase C ...  52.0    3e-05   
emb|CDY52120.1|  BnaA10g29490D                                        52.0    3e-05   
ref|XP_008463239.1|  PREDICTED: phosphoinositide phospholipase C ...  52.0    3e-05   
ref|XP_003518408.1|  PREDICTED: phosphoinositide phospholipase C ...  51.6    4e-05   
tpg|DAA41847.1|  TPA: hypothetical protein ZEAMMB73_100644            49.3    5e-05   
emb|CDX71156.1|  BnaC03g12400D                                        51.2    6e-05   
ref|XP_002439212.1|  hypothetical protein SORBIDRAFT_09g002320        51.2    7e-05   
ref|XP_004500489.1|  PREDICTED: phosphoinositide phospholipase C ...  50.4    9e-05   
ref|XP_003615686.1|  Phosphoinositide phospholipase C                 50.4    1e-04   
ref|XP_007142207.1|  hypothetical protein PHAVU_008G261100g           50.1    1e-04   
ref|XP_004960369.1|  PREDICTED: phosphoinositide phospholipase C ...  49.7    2e-04   
ref|XP_003562396.1|  PREDICTED: phosphoinositide phospholipase C ...  49.7    2e-04   
ref|XP_010233537.1|  PREDICTED: phosphoinositide phospholipase C ...  49.7    2e-04   
ref|XP_010685543.1|  PREDICTED: phosphoinositide phospholipase C ...  49.7    2e-04   
emb|CDY02827.1|  BnaC02g10620D                                        48.9    3e-04   
ref|XP_004978423.1|  PREDICTED: phosphoinositide phospholipase C ...  48.9    3e-04   
gb|AAQ95730.1|  phospholipase C                                       48.9    3e-04   
ref|XP_002314099.2|  hypothetical protein POPTR_0009s05130g           48.9    4e-04   
ref|NP_001049792.2|  Os03g0289300                                     48.5    4e-04   
emb|CDY20520.1|  BnaC04g05240D                                        48.5    4e-04   
gb|EEE58849.1|  hypothetical protein OsJ_10440                        48.5    5e-04   
gb|EEC75018.1|  hypothetical protein OsI_11098                        48.1    5e-04   
dbj|BAE71237.1|  putative phosphoinositide specific phospholipase C   48.1    6e-04   
gb|ACF87010.1|  unknown                                               47.8    6e-04   
gb|ACG25330.1|  phospholipase C                                       48.1    7e-04   
gb|AFW69669.1|  phospholipase                                         48.1    7e-04   
ref|XP_008457368.1|  PREDICTED: phosphoinositide phospholipase C ...  47.8    7e-04   
ref|XP_010454132.1|  PREDICTED: phosphoinositide phospholipase C ...  47.8    7e-04   
emb|CDX74806.1|  BnaA05g05520D                                        47.8    7e-04   
ref|XP_011032115.1|  PREDICTED: phosphoinositide phospholipase C ...  47.8    7e-04   
ref|XP_011032113.1|  PREDICTED: phosphoinositide phospholipase C ...  47.8    7e-04   
ref|XP_008645133.1|  PREDICTED: phosphoinositide phospholipase C ...  47.8    7e-04   
ref|NP_001105254.1|  phospholipase C                                  47.8    8e-04   
ref|XP_011032114.1|  PREDICTED: phosphoinositide phospholipase C ...  47.8    8e-04   
gb|EEC78444.1|  hypothetical protein OsI_18294                        47.8    8e-04   
ref|NP_001054531.1|  Os05g0127200                                     47.8    9e-04   
ref|XP_006425075.1|  hypothetical protein CICLE_v10028087mg           47.8    9e-04   
gb|KDO66900.1|  hypothetical protein CISIN_1g013767mg                 47.4    9e-04   
ref|XP_007163543.1|  hypothetical protein PHAVU_001G243100g           47.8    9e-04   



>ref|XP_009622729.1| PREDICTED: phosphoinositide phospholipase C 4-like [Nicotiana 
tomentosiformis]
 gb|ABP57375.1| phosphoinositide-specific phospholipase C [Nicotiana tabacum]
Length=588

 Score =   119 bits (297),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYRVC+CFTRKF+VTEA+P +DVKEAFKKYAE G+QM+SEQLL+FL E QG+   T+ 
Sbjct  1    MGSYRVCVCFTRKFRVTEAEPPSDVKEAFKKYAENGNQMNSEQLLKFLIEVQGETLLTVG  60

Query  316  EAEAIVXQILHKRHPIS  366
            +A+AIV QIL KRHPI+
Sbjct  61   DADAIVRQILQKRHPIT  77



>ref|NP_001234181.1| PI-phospholipase C PLC4 [Solanum lycopersicum]
 gb|ABW81000.1| PI-phospholipase C PLC4 [Solanum lycopersicum]
Length=587

 Score =   117 bits (292),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YRVC+CF+RKFKVTEA+P  DVKEAFKKY + G+QMS+EQLL+FL E QG+ + T+A
Sbjct  1    MGNYRVCVCFSRKFKVTEAEPPTDVKEAFKKYGDGGNQMSAEQLLKFLIEVQGETQLTVA  60

Query  316  EAEAIVXQILHKRHPIS  366
            +A+A+V QIL KRHPI+
Sbjct  61   DADAVVRQILQKRHPIT  77



>emb|CAA65127.1| phosphoinositide-specific phospholipase C [Nicotiana rustica]
Length=588

 Score =   117 bits (292),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYRVC+CFTRKF+VTEA+P +DVKEAFKKYAE G+QM+SEQLL+FL E QG+   T+ 
Sbjct  1    MGSYRVCVCFTRKFRVTEAEPPSDVKEAFKKYAENGNQMNSEQLLKFLIEVQGETLFTVG  60

Query  316  EAEAIVXQILHKRHPIS  366
            +A+ IV QIL KRHPI+
Sbjct  61   DADVIVRQILQKRHPIT  77



>ref|XP_006344048.1| PREDICTED: phosphoinositide phospholipase C 4-like [Solanum tuberosum]
Length=587

 Score =   117 bits (292),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YRVC+CF+RKFKVTEA+P  DVKEAFKKY + G+QMS+EQLL+FL E QG+ + T+A
Sbjct  1    MGNYRVCVCFSRKFKVTEAEPPTDVKEAFKKYGDGGNQMSAEQLLKFLIEVQGETQLTVA  60

Query  316  EAEAIVXQILHKRHPIS  366
            +A+A+V QIL KRHPI+
Sbjct  61   DADAVVRQILQKRHPIT  77



>ref|XP_009790378.1| PREDICTED: phosphoinositide phospholipase C 4 [Nicotiana sylvestris]
Length=588

 Score =   117 bits (292),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYRVC+CFTRKF+VTEA+P +DVKEAFKKY E G+QM+SEQLL+FL E QG+   T+ 
Sbjct  1    MGSYRVCVCFTRKFRVTEAEPPSDVKEAFKKYTENGNQMNSEQLLKFLIEVQGETLLTVG  60

Query  316  EAEAIVXQILHKRHPIS  366
            +A+AI+ QIL KRHPI+
Sbjct  61   DADAIIRQILQKRHPIT  77



>emb|CAA72681.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase [Nicotiana 
rustica]
Length=588

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYRVC+CFTRKF+VTEA+P +DVKEAFKKYAE G+QM+SEQLL+FL E QG+   T+ 
Sbjct  1    MGSYRVCVCFTRKFRVTEAEPPSDVKEAFKKYAENGNQMNSEQLLKFLIEVQGETLFTVG  60

Query  316  EAEAIVXQILHKRHPIS  366
            +++ IV QIL KRHPI+
Sbjct  61   DSDVIVRQILQKRHPIT  77



>emb|CDP09195.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATL  312
            G  SYRVC+CFTRKFKV E QP +DVKEAFK+YA  G+ M++EQL RFL E QG+ EATL
Sbjct  2    GSSSYRVCVCFTRKFKVAEVQPPSDVKEAFKEYAGGGTHMNAEQLRRFLVEVQGETEATL  61

Query  313  AEAEAIVXQILHKRHPIS  366
            A+AEA++ QIL KRH I+
Sbjct  62   AQAEAVLQQILQKRHHIT  79



>ref|XP_002278527.1| PREDICTED: phosphoinositide phospholipase C 4-like [Vitis vinifera]
Length=588

 Score =   107 bits (268),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYRVCMCF RKF+V EA+P  DVKEAFKKYAE G+ M++EQL RFL E Q     TL+
Sbjct  1    MGSYRVCMCFRRKFRVVEAEPPEDVKEAFKKYAEGGTHMTAEQLRRFLLESQSDGSVTLS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE IV Q+L KRH I+
Sbjct  61   DAERIVEQVLQKRHHIA  77



>gb|KCW85436.1| hypothetical protein EUGRSUZ_B02250 [Eucalyptus grandis]
Length=498

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+C+TRKFKV EA+P  DV++AFKKYA+ G+ MS+EQ  RFL E QG+  A++A
Sbjct  1    MGSYRLCLCYTRKFKVKEAEPPEDVRQAFKKYADGGATMSAEQFRRFLVESQGEAVASVA  60

Query  316  EAEAIVXQILHKRHPIS  366
            +A+ +V Q++HKRH I+
Sbjct  61   DAQRVVDQVIHKRHHIA  77



>ref|XP_010043428.1| PREDICTED: phosphoinositide phospholipase C 4-like [Eucalyptus 
grandis]
 gb|KCW85434.1| hypothetical protein EUGRSUZ_B02250 [Eucalyptus grandis]
Length=588

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+C+TRKFKV EA+P  DV++AFKKYA+ G+ MS+EQ  RFL E QG+  A++A
Sbjct  1    MGSYRLCLCYTRKFKVKEAEPPEDVRQAFKKYADGGATMSAEQFRRFLVESQGEAVASVA  60

Query  316  EAEAIVXQILHKRHPIS  366
            +A+ +V Q++HKRH I+
Sbjct  61   DAQRVVDQVIHKRHHIA  77



>ref|XP_007016097.1| Phosphatidylinositol-speciwc phospholipase C4 [Theobroma cacao]
 gb|EOY33716.1| Phosphatidylinositol-speciwc phospholipase C4 [Theobroma cacao]
Length=591

 Score =   105 bits (262),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKFKVTEA P  DVK+AF KYAE G  M++EQL RFL + QGQ  AT+ 
Sbjct  1    MGSYRMCVCFTRKFKVTEAAPPTDVKDAFNKYAEGGLHMTAEQLHRFLIDVQGQGGATVE  60

Query  316  EAEAIVXQILHKRHPIS  366
            EAE IV Q+L KRH ++
Sbjct  61   EAEVIVQQVLQKRHHMA  77



>gb|KHG04158.1| Phosphoinositide phospholipase C 4 -like protein [Gossypium arboreum]
Length=591

 Score =   105 bits (261),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKFKVTEA P  D+K AF +YAE G  M++EQL RFL + QGQ  AT  
Sbjct  1    MGSYRMCVCFTRKFKVTEAAPPLDIKAAFNRYAEGGPHMTAEQLHRFLVDVQGQGLATKG  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE IV Q+LHKRH ++
Sbjct  61   DAEGIVQQLLHKRHHMA  77



>gb|KJB35246.1| hypothetical protein B456_006G106400 [Gossypium raimondii]
Length=471

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKFKVTEA P  DVK+AF +YAE G  M++EQL RFL + QGQ  AT  
Sbjct  1    MGSYRMCVCFTRKFKVTEAAPPTDVKDAFNRYAEGGPHMTAEQLHRFLVDVQGQGFATKG  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE IV Q+L KRH ++
Sbjct  61   DAEGIVQQLLQKRHHMA  77



>gb|KJB35245.1| hypothetical protein B456_006G106400 [Gossypium raimondii]
Length=465

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKFKVTEA P  DVK+AF +YAE G  M++EQL RFL + QGQ  AT  
Sbjct  1    MGSYRMCVCFTRKFKVTEAAPPTDVKDAFNRYAEGGPHMTAEQLHRFLVDVQGQGFATKG  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE IV Q+L KRH ++
Sbjct  61   DAEGIVQQLLQKRHHMA  77



>gb|KDP46490.1| hypothetical protein JCGZ_08462 [Jatropha curcas]
Length=588

 Score =   104 bits (259),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+CMCF RKFK+TEA P  DVK+AFKKY+  G+ M++EQ LRFL + QG   A+++
Sbjct  1    MGNYRMCMCFIRKFKITEAGPPTDVKDAFKKYSGGGTHMTAEQFLRFLGDVQGDSSASIS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE IV QIL KRH I+
Sbjct  61   DAEKIVQQILQKRHHIT  77



>gb|KJB35242.1| hypothetical protein B456_006G106400 [Gossypium raimondii]
Length=591

 Score =   103 bits (258),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKFKVTEA P  DVK+AF +YAE G  M++EQL RFL + QGQ  AT  
Sbjct  1    MGSYRMCVCFTRKFKVTEAAPPTDVKDAFNRYAEGGPHMTAEQLHRFLVDVQGQGFATKG  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE IV Q+L KRH ++
Sbjct  61   DAEGIVQQLLQKRHHMA  77



>gb|EPS61000.1| hypothetical protein M569_13801, partial [Genlisea aurea]
Length=587

 Score =   103 bits (257),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATL-  312
            MGSYR+CMCFTRKF+VTEA+P  DV+EAF+KYA+  S MSSE L RFL E QG+ E  L 
Sbjct  1    MGSYRICMCFTRKFRVTEAEPPEDVREAFRKYADGNSHMSSEGLRRFLVEVQGEPEDALS  60

Query  313  -AEAEAIVXQILHKRHPIS  366
             A+++A++ QIL KRH I+
Sbjct  61   AADSDAVLQQILQKRHHIT  79



>ref|XP_010650899.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Vitis vinifera]
Length=509

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY VC+CF RKF++TEA+P  DVKEAF++Y E G+ M++EQLLRFL E Q    AT++
Sbjct  1    MGSYSVCICFKRKFRLTEAEPPTDVKEAFRRYTEGGTHMTAEQLLRFLVEGQNDVAATIS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+  +LH+RH ++
Sbjct  61   DAERILELVLHRRHHVT  77



>gb|ABU53666.1| phospholipase C [Torenia fournieri]
Length=583

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYA-EEGSQMSSEQLLRFLTEEQGQKEATL  312
            MGSYRVCMCFTRKF+VTEA+P  DVKE FK+YA + G+ M++EQL RFL E QG+   + 
Sbjct  1    MGSYRVCMCFTRKFRVTEAEPTQDVKEVFKRYAGDGGTHMNAEQLRRFLVEVQGEPADSA  60

Query  313  AE-AEAIVXQILHKRHPIS  366
             E AEAIV QIL KRH I+
Sbjct  61   GEAAEAIVRQILQKRHHIA  79



>gb|KDO66895.1| hypothetical protein CISIN_1g007887mg [Citrus sinensis]
Length=495

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKF+VTEA P  DVKEAF KYAE G+ M++EQL RFL E QG    +++
Sbjct  1    MGSYRMCVCFTRKFRVTEAGPPEDVKEAFNKYAEGGTHMTAEQLRRFLLEVQGDDGGSIS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE +V Q+L  RH ++
Sbjct  61   DAEKVVDQVLKTRHHLA  77



>ref|XP_002278839.2| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Vitis vinifera]
Length=590

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY VC+CF RKF++TEA+P  DVKEAF++Y E G+ M++EQLLRFL E Q    AT++
Sbjct  1    MGSYSVCICFKRKFRLTEAEPPTDVKEAFRRYTEGGTHMTAEQLLRFLVEGQNDVAATIS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+  +LH+RH ++
Sbjct  61   DAERILELVLHRRHHVT  77



>ref|XP_006488531.1| PREDICTED: phosphoinositide phospholipase C 4-like [Citrus sinensis]
Length=586

 Score =   100 bits (250),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKF+VTEA P  DVKEAF KYAE G+ M++EQL RFL E QG    +++
Sbjct  1    MGSYRMCVCFTRKFRVTEAGPPGDVKEAFNKYAEGGTHMTAEQLRRFLLEVQGDDGGSIS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE +V Q+L  RH ++
Sbjct  61   DAEKVVDQVLKTRHHLA  77



>ref|XP_006425071.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
 ref|XP_006425072.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
 gb|ESR38311.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
 gb|ESR38312.1| hypothetical protein CICLE_v10028080mg [Citrus clementina]
Length=586

 Score =   100 bits (249),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKF+VTEA P  DVKEAF KYAE G+ M++EQL RFL E QG    +++
Sbjct  1    MGSYRMCVCFTRKFRVTEAGPPEDVKEAFNKYAEGGTHMTAEQLRRFLLEVQGDDGGSIS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE +V Q+L  RH ++
Sbjct  61   DAEKVVDQVLKTRHHLA  77



>gb|KDO66894.1| hypothetical protein CISIN_1g007887mg [Citrus sinensis]
Length=586

 Score =   100 bits (249),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKF+VTEA P  DVKEAF KYAE G+ M++EQL RFL E QG    +++
Sbjct  1    MGSYRMCVCFTRKFRVTEAGPPEDVKEAFNKYAEGGTHMTAEQLRRFLLEVQGDDGGSIS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE +V Q+L  RH ++
Sbjct  61   DAEKVVDQVLKTRHHLA  77



>gb|KJB55735.1| hypothetical protein B456_009G091900 [Gossypium raimondii]
Length=371

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+C CFTRKFK+ EA P  DV  AF+KYAE G QM++EQL RFL + QGQ  A ++
Sbjct  1    MGTYRMCGCFTRKFKIIEAAPPPDVIAAFEKYAEGGPQMTAEQLHRFLVDVQGQGGAKVS  60

Query  316  EAEAIVXQILHKRH  357
            +AE I+ Q+L KRH
Sbjct  61   DAEEILLQVLQKRH  74



>ref|XP_009347256.1| PREDICTED: phosphoinositide phospholipase C 4-like [Pyrus x bretschneideri]
Length=588

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+CMCFTRKF+V E +P  DVKEAF+KYAE G+QM++EQL RFL E QG+K+   A
Sbjct  1    MGSYRMCMCFTRKFRVKEEEPPRDVKEAFEKYAEGGTQMTAEQLRRFLAELQGEKDGGGA  60

Query  316  ----EAEAIVXQILHKRHPIS  366
                +AE IV ++L KRH I+
Sbjct  61   SVSDDAERIVEKVLQKRHHIA  81



>ref|XP_008220865.1| PREDICTED: phosphoinositide phospholipase C 4-like [Prunus mume]
Length=587

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 4/81 (5%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQK----E  303
            MGSYR+CMCFTRKF+VTEA+P  DVKEAF KYAE G+ M++EQL RFL E Q        
Sbjct  1    MGSYRMCMCFTRKFRVTEAEPPRDVKEAFNKYAEGGTHMTAEQLQRFLLEFQADGGVGCG  60

Query  304  ATLAEAEAIVXQILHKRHPIS  366
            A  ++AE IV Q+L KRH I+
Sbjct  61   AAASDAERIVEQVLQKRHHIA  81



>ref|XP_002299806.2| hypothetical protein POPTR_0001s25910g [Populus trichocarpa]
 gb|EEE84611.2| hypothetical protein POPTR_0001s25910g [Populus trichocarpa]
Length=586

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  139  GSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAE  318
            GSYR+C+CFTRKFKVTEA P  DV EAF KY + G+ MS+EQL RFL E QG    ++A+
Sbjct  3    GSYRMCVCFTRKFKVTEAGPPPDVNEAFFKYTDGGTHMSAEQLRRFLMEVQGDGGVSIAD  62

Query  319  AEAIVXQILHKRHPIS  366
            AE IV Q+L K H I+
Sbjct  63   AEKIVDQVLQKLHHIA  78



>gb|AFO54605.1| phospholipase C [Populus tomentosa]
Length=586

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  139  GSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAE  318
            GSYR+CMCFTRKFKVT+A P  DV EAF KY + G+ MS+EQL RFL E QG    + A+
Sbjct  3    GSYRMCMCFTRKFKVTKAGPPHDVNEAFFKYTDGGTHMSAEQLRRFLVEVQGDGGVSTAD  62

Query  319  AEAIVXQILHKRHPIS  366
            AE IV Q+L K H I+
Sbjct  63   AEKIVDQVLQKMHHIA  78



>ref|XP_007206576.1| hypothetical protein PRUPE_ppa020283mg [Prunus persica]
 gb|EMJ07775.1| hypothetical protein PRUPE_ppa020283mg [Prunus persica]
Length=587

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 8/83 (10%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQ------GQ  297
            MGSYR+CMCFTRKF+VTEA+P  DVKEAF KYAE G+ M++EQL  FL E Q      G 
Sbjct  1    MGSYRMCMCFTRKFRVTEAEPPLDVKEAFNKYAEGGTHMTAEQLQNFLLEFQADGGVGGG  60

Query  298  KEATLAEAEAIVXQILHKRHPIS  366
             EA  ++AE IV Q+L KRH I+
Sbjct  61   AEA--SDAERIVEQVLQKRHHIA  81



>ref|XP_004294231.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=588

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKF++TEA+P +DV E F KYAE G+ M++EQL  FL + QG   A+++
Sbjct  1    MGSYRMCVCFTRKFRITEAEPPSDVTEYFAKYAEGGTHMTAEQLRNFLEDVQGYGGASIS  60

Query  316  EAEAIVXQILHKRH  357
            EAE IV Q+L KRH
Sbjct  61   EAEQIVEQMLQKRH  74



>ref|XP_008355042.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide phospholipase 
C 4-like [Malus domestica]
Length=588

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKF+V E +P  DVKEAF+KYAE G+QM++EQL RFL E Q +K+   A
Sbjct  1    MGSYRMCVCFTRKFRVKEEEPPRDVKEAFEKYAEGGTQMTAEQLRRFLAELQVEKDGGGA  60

Query  316  ----EAEAIVXQILHKRHPIS  366
                +AE IV Q+L KRH I+
Sbjct  61   SVSDDAERIVEQVLQKRHHIT  81



>ref|XP_011460953.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=585

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+CFTRKF++TEA+P +DV E F KYAE G+ M++EQL  FL + QG   A+++
Sbjct  1    MGSYRMCVCFTRKFRITEAEPPSDVTEYFAKYAEGGTHMTAEQLRNFLEDVQGYGGASIS  60

Query  316  EAEAIVXQILHKRH  357
            EAE IV Q+L KRH
Sbjct  61   EAEQIVEQMLQKRH  74



>ref|XP_010937845.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Elaeis guineensis]
Length=598

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+CF+RKF+  EAQP ADVKEAF  YAE G+QM++EQL RFL + QG   AT+A
Sbjct  1    MGSYKYCLCFSRKFRWVEAQPPADVKEAFAAYAEGGTQMNAEQLQRFLVDAQGDTGATVA  60

Query  316  EAEAIVXQILHKRH  357
            +AE ++ Q+   RH
Sbjct  61   DAERVLEQVHQLRH  74



>ref|XP_010937844.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Elaeis guineensis]
Length=599

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+CF+RKF+  EAQP ADVKEAF  YAE G+QM++EQL RFL + QG   AT+A
Sbjct  1    MGSYKYCLCFSRKFRWVEAQPPADVKEAFAAYAEGGTQMNAEQLQRFLVDAQGDTGATVA  60

Query  316  EAEAIVXQILHKRH  357
            +AE ++ Q+   RH
Sbjct  61   DAERVLEQVHQLRH  74



>ref|XP_008220858.1| PREDICTED: phosphoinositide phospholipase C 4-like [Prunus mume]
Length=589

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+C+CFTRKF+VTEA+P +DVKEAF KY E+ + M++EQL  FL E Q +   T A
Sbjct  1    MGNYRMCLCFTRKFRVTEAEPPSDVKEAFNKYTEDATHMTAEQLRHFLVELQAEGGGTSA  60

Query  316  -EAEAIVXQILHKRHPIS  366
             EAE I+ Q+L KRH I+
Sbjct  61   FEAERILEQVLQKRHNIA  78



>ref|XP_007208015.1| hypothetical protein PRUPE_ppa003249mg [Prunus persica]
 gb|EMJ09214.1| hypothetical protein PRUPE_ppa003249mg [Prunus persica]
Length=589

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+C+CFTRKF+V EA+P +DVKE F KYA +G+ M++EQL  FL E Q +  +T A
Sbjct  1    MGNYRMCLCFTRKFRVMEAEPPSDVKETFNKYAGDGTHMTAEQLRHFLVELQAEGGSTSA  60

Query  316  -EAEAIVXQILHKRHPIS  366
             EAE IV Q+L KRH I+
Sbjct  61   SEAERIVEQVLQKRHNIA  78



>gb|EYU45716.1| hypothetical protein MIMGU_mgv1a003401mg [Erythranthe guttata]
Length=587

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQK-EATL  312
            MGSYRVCMCFTRKF+VTEA+P  DVKEAF KYA+ G+ M+++ L RFL E QG+  +A  
Sbjct  1    MGSYRVCMCFTRKFRVTEAEPPDDVKEAFGKYADGGTHMTADHLRRFLVEAQGESDDAAA  60

Query  313  AEAEAIVXQILHKRHPIS  366
            A AE ++ QIL KRH I+
Sbjct  61   AAAEDVLQQILQKRHHIT  78



>gb|KJB82225.1| hypothetical protein B456_013G182800 [Gossypium raimondii]
Length=122

 Score = 89.4 bits (220),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+C CFTRKFK+ EA P  DV  AF+K AE G QM++EQL RFL + QGQ  A ++
Sbjct  1    MGTYRMCGCFTRKFKIIEAAPPPDVIAAFEKCAEGGPQMTAEQLHRFLVDAQGQGGAKVS  60

Query  316  EAEAIVXQILHKRH  357
            + E I+ Q L KRH
Sbjct  61   DTEEILLQGLQKRH  74



>gb|KJB55731.1| hypothetical protein B456_009G091900 [Gossypium raimondii]
Length=488

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+C CFTRKFK+ EA P  DV  AF+KYAE G QM++EQL RFL + QGQ  A ++
Sbjct  1    MGTYRMCGCFTRKFKIIEAAPPPDVIAAFEKYAEGGPQMTAEQLHRFLVDVQGQGGAKVS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ Q+L KRH ++
Sbjct  61   DAEEILLQVLQKRHHMA  77



>gb|KHG10596.1| Phosphoinositide phospholipase C 4 [Gossypium arboreum]
Length=630

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+C CFTRKFK+ EA P  DV  AF+KYAE G QM++E L RFL + QGQ  A ++
Sbjct  1    MGTYRMCGCFTRKFKIIEAAPPPDVIAAFEKYAEGGPQMTAELLHRFLVDVQGQGGAKVS  60

Query  316  EAEAIVXQILHKRH  357
            +AE I+ Q+L KRH
Sbjct  61   DAEEILLQVLQKRH  74



>gb|KJB55734.1| hypothetical protein B456_009G091900 [Gossypium raimondii]
Length=583

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+C CFTRKFK+ EA P  DV  AF+KYAE G QM++EQL RFL + QGQ  A ++
Sbjct  1    MGTYRMCGCFTRKFKIIEAAPPPDVIAAFEKYAEGGPQMTAEQLHRFLVDVQGQGGAKVS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ Q+L KRH ++
Sbjct  61   DAEEILLQVLQKRHHMA  77



>ref|XP_011043776.1| PREDICTED: phosphoinositide phospholipase C 4-like [Populus euphratica]
Length=586

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  139  GSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAE  318
            GSYR+C+CFTRKFKVTEA P  DV EAF KY + G+ MS+EQL  FL E QG    ++A+
Sbjct  3    GSYRMCVCFTRKFKVTEAGPPPDVNEAFFKYTDGGTHMSAEQLRLFLVEVQGDDGVSIAD  62

Query  319  AEAIVXQILHKRHPIS  366
            AE I+ Q+L K H I+
Sbjct  63   AEKILDQVLQKMHHIA  78



>ref|XP_010520201.1| PREDICTED: phosphoinositide phospholipase C 4 [Tarenaya hassleriana]
Length=586

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+C+ FTRKF+VTEA PA DV+EAF KYAE G+ MS EQL RFL+E QG+     A
Sbjct  1    MGSYRMCLFFTRKFRVTEAGPADDVREAFDKYAEGGAYMSPEQLRRFLSEGQGESCGG-A  59

Query  316  EAEAIVXQILHKRHPIS  366
            E E IV ++L +RH I+
Sbjct  60   EEEKIVDEVLRRRHHIA  76



>gb|KJB81975.1| hypothetical protein B456_013G170100 [Gossypium raimondii]
Length=130

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+  CF RKFK+ EA P  DV  AF+KYAE G QM++EQL RFL + QGQ    ++
Sbjct  1    MGTYRMYGCFARKFKIIEAAPPPDVIVAFEKYAEGGPQMTTEQLHRFLVDAQGQGGVKVS  60

Query  316  EAEAIVXQILHKRH  357
            +AE I+ Q L KRH
Sbjct  61   DAEEILLQGLQKRH  74



>gb|KHG10595.1| Phosphoinositide phospholipase C 4 [Gossypium arboreum]
Length=583

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+YR+C CFTRKFK+ EA P  DV  AF+KYAE G QM++E L RFL + QGQ  A ++
Sbjct  1    MGTYRMCGCFTRKFKIIEAAPPPDVIAAFEKYAEGGPQMTAELLHRFLVDVQGQGGAKVS  60

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ Q+L KRH ++
Sbjct  61   DAEEILLQVLQKRHHMA  77



>ref|XP_008805482.1| PREDICTED: phosphoinositide phospholipase C 6-like [Phoenix dactylifera]
Length=597

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+CFTRKF+ +EA P  DV  AF  YAE G+ M  EQL RFL E QG+  ATLA
Sbjct  1    MGSYKCCLCFTRKFRWSEAAPPPDVVAAFAAYAEGGAHMGPEQLRRFLAEAQGESGATLA  60

Query  316  EAEAIVXQILHKRH  357
            +AE I+ Q+   RH
Sbjct  61   DAERIIYQVRQLRH  74



>ref|XP_010685546.1| PREDICTED: phosphoinositide phospholipase C 4-like [Beta vulgaris 
subsp. vulgaris]
Length=578

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYRVC+CFTR+F +TE +P  +V+E FK Y   GS M+SEQL RFL E QG  + T+A
Sbjct  1    MGSYRVCLCFTRRFGLTELEPPLEVQELFKLYTGGGSYMASEQLWRFLMEVQGGSDTTIA  60

Query  316  EAEAIVXQILHKRHPIS  366
            EA+ IV  ++ +RH I+
Sbjct  61   EAKKIVEDLVKQRHHIA  77



>ref|XP_006488534.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X3 
[Citrus sinensis]
Length=383

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVC---MCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY +C    CFTRK KV EA P ADVKE FKKYAE G+ M++EQL +FL E QG    
Sbjct  1    MGSYLLCGLPACFTRKHKVAEAGPPADVKEMFKKYAEGGTHMTAEQLWQFLVEVQGHGGV  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            ++ +AE IV Q+L + H I+
Sbjct  61   SIEDAEQIVDQVLQRWHHIA  80



>gb|KDO66899.1| hypothetical protein CISIN_1g007473mg [Citrus sinensis]
Length=383

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVC---MCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY +C    CFTRK KV EA P ADVKE FKKYAE G+ M++EQL +FL E QG    
Sbjct  1    MGSYLLCGLPACFTRKHKVAEAGPPADVKEMFKKYAEGGTHMTAEQLWQFLVEVQGHGGV  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            ++ +AE IV Q+L + H I+
Sbjct  61   SIEDAEQIVDQVLQRWHHIA  80



>gb|KDO66898.1| hypothetical protein CISIN_1g007473mg [Citrus sinensis]
Length=437

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVC---MCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY +C    CFTRK KV EA P ADVKE FKKYAE G+ M++EQL +FL E QG    
Sbjct  1    MGSYLLCGLPACFTRKHKVAEAGPPADVKEMFKKYAEGGTHMTAEQLWQFLVEVQGHGGV  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            ++ +AE IV Q+L + H I+
Sbjct  61   SIEDAEQIVDQVLQRWHHIA  80



>gb|KDO66897.1| hypothetical protein CISIN_1g007473mg [Citrus sinensis]
Length=500

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVC---MCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY +C    CFTRK KV EA P ADVKE FKKYAE G+ M++EQL +FL E QG    
Sbjct  1    MGSYLLCGLPACFTRKHKVAEAGPPADVKEMFKKYAEGGTHMTAEQLWQFLVEVQGHGGV  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            ++ +AE IV Q+L + H I+
Sbjct  61   SIEDAEQIVDQVLQRWHHIA  80



>ref|XP_006488533.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Citrus sinensis]
Length=500

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVC---MCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY +C    CFTRK KV EA P ADVKE FKKYAE G+ M++EQL +FL E QG    
Sbjct  1    MGSYLLCGLPACFTRKHKVAEAGPPADVKEMFKKYAEGGTHMTAEQLWQFLVEVQGHGGV  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            ++ +AE IV Q+L + H I+
Sbjct  61   SIEDAEQIVDQVLQRWHHIA  80



>gb|KDO66896.1| hypothetical protein CISIN_1g007473mg [Citrus sinensis]
Length=602

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVC---MCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY +C    CFTRK KV EA P ADVKE FKKYAE G+ M++EQL +FL E QG    
Sbjct  1    MGSYLLCGLPACFTRKHKVAEAGPPADVKEMFKKYAEGGTHMTAEQLWQFLVEVQGHGGV  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            ++ +AE IV Q+L + H I+
Sbjct  61   SIEDAEQIVDQVLQRWHHIA  80



>ref|XP_006488532.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Citrus sinensis]
Length=602

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVC---MCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY +C    CFTRK KV EA P ADVKE FKKYAE G+ M++EQL +FL E QG    
Sbjct  1    MGSYLLCGLPACFTRKHKVAEAGPPADVKEMFKKYAEGGTHMTAEQLWQFLVEVQGHGGV  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            ++ +AE IV Q+L + H I+
Sbjct  61   SIEDAEQIVDQVLQRWHHIA  80



>ref|XP_006425073.1| hypothetical protein CICLE_v10028054mg [Citrus clementina]
 gb|ESR38313.1| hypothetical protein CICLE_v10028054mg [Citrus clementina]
Length=437

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVC---MCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY +C    CFTRK KV EA P ADVKE FKKYAE G+ M+ EQL +FL E QG    
Sbjct  1    MGSYLLCGLPACFTRKHKVAEAGPPADVKEMFKKYAEGGTHMTVEQLWQFLAEVQGHGGV  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            ++ +AE IV Q+L + H I+
Sbjct  61   SIEDAEQIVDQVLQRWHHIA  80



>ref|XP_009402378.1| PREDICTED: phosphoinositide phospholipase C 6-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR C+CFTRKF+ +EA+P  DV+EAF  YAE G+ M+++QL +FL E QG+  AT A
Sbjct  1    MGSYRCCICFTRKFRWSEAKPTEDVREAFATYAEGGAHMTADQLRQFLEEAQGEAGATAA  60

Query  316  EAEAIVXQILHKRHP  360
            +AE ++ ++   R P
Sbjct  61   DAERVMERVRQLRRP  75



>gb|ABR16299.1| unknown [Picea sitchensis]
Length=597

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYRVC+CFTRKFK     P  DVK+ F KY+E G QM+   L RFL E QGQ +AT  
Sbjct  1    MGSYRVCVCFTRKFKSDALSPPGDVKDLFNKYSESGGQMTVRNLHRFLVEVQGQTDATEK  60

Query  316  EAEAIVXQILHKRH  357
            +AE ++  +  +RH
Sbjct  61   DAEHVLEVLRQRRH  74



>ref|XP_009794867.1| PREDICTED: phosphoinositide phospholipase C 6-like [Nicotiana 
sylvestris]
 ref|XP_009794868.1| PREDICTED: phosphoinositide phospholipase C 6-like [Nicotiana 
sylvestris]
Length=590

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 58/77 (75%), Gaps = 3/77 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   R+  CF RKFK+ E +P  +V+EAF +YA  G+ M+++QLLRF+ E QG+++A
Sbjct  1    MGSYNYYRMFGCFNRKFKIRETEPPPEVREAFSRYAGRGTHMNADQLLRFIVEVQGEEDA  60

Query  307  TLAEAEAIVXQILHKRH  357
            T+ +AE I+ Q++++RH
Sbjct  61   TVKDAEQIIQQVVNRRH  77



>gb|AAL23439.1| phosphoinositide-specific phospholipase C4 [Arabidopsis thaliana]
Length=591

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+ FTRKF++TE+ P  DV++ F+KY E  + MS EQL + +TEE G+ E +L 
Sbjct  1    MGSYKFCLIFTRKFRMTESGPVEDVRDLFEKYTEGDAHMSPEQLQKLMTEEGGEGETSLE  60

Query  316  EAEAIVXQILHKRHPIS  366
            EAE IV ++L ++H I+
Sbjct  61   EAERIVDEVLRRKHHIA  77



>ref|XP_009385549.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=574

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+CFTRKF    A P  DV++ F +Y+E  +QM  +QL RFL E QGQ +ATLA
Sbjct  1    MGSYKYCICFTRKFVWRAAAPPPDVRQTFVEYSEGAAQMGPDQLRRFLAEAQGQADATLA  60

Query  316  EAEAIVXQILHKR  354
            +AE I   +LH+R
Sbjct  61   DAERINEVLLHRR  73



>ref|NP_200678.2| phosphoinositide phospholipase C 4 [Arabidopsis thaliana]
 sp|Q944C1.2|PLCD4_ARATH RecName: Full=Phosphoinositide phospholipase C 4; AltName: Full=Phosphoinositide 
phospholipase PLC4; Short=AtPLC4; Short=PI-PLC4 
[Arabidopsis thaliana]
 gb|AAL30749.2|AF434168_1 phosphoinositide-specific phospholipase C [Arabidopsis thaliana]
 dbj|BAA97338.1| phosphoinositide-specific phospholipase C [Arabidopsis thaliana]
 gb|AAM13216.1| phosphoinositide-specific phospholipase-like protein [Arabidopsis 
thaliana]
 gb|AAP37717.1| At5g58700 [Arabidopsis thaliana]
 gb|AED97086.1| phosphoinositide phospholipase C 4 [Arabidopsis thaliana]
Length=597

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+ FTRKF++TE+ P  DV++ F+KY E  + MS EQL + +TEE G+ E +L 
Sbjct  7    MGSYKFCLIFTRKFRMTESGPVEDVRDLFEKYTEGDAHMSPEQLQKLMTEEGGEGETSLE  66

Query  316  EAEAIVXQILHKRHPIS  366
            EAE IV ++L ++H I+
Sbjct  67   EAERIVDEVLRRKHHIA  83



>ref|XP_008457371.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Cucumis melo]
Length=581

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEE-GSQMSSEQLLRFLTEEQGQKEATL  312
            MG+YRVC+CF R+FK+++ +P  DVKEAF KYA    + M++EQL  FL E QG + A+L
Sbjct  1    MGNYRVCLCFIRRFKMSKEEPPPDVKEAFVKYAGGVAANMTAEQLRSFLVEFQGDQTASL  60

Query  313  AEAEAIVXQILHKRHPI  363
            A+A+ IV  +L +RH +
Sbjct  61   ADAQRIVEHVLQRRHHV  77



>ref|XP_009385550.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=570

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+CFTRKF    A P  DV++ F +Y+E  +QM  +QL RFL E QGQ +ATLA
Sbjct  1    MGSYKYCICFTRKFVWRAAAPPPDVRQTFVEYSEGAAQMGPDQLRRFLAEAQGQADATLA  60

Query  316  EAEAIVXQILHKR  354
            +AE I   +LH+R
Sbjct  61   DAERINEVLLHRR  73



>gb|KJB55726.1| hypothetical protein B456_009G091700 [Gossypium raimondii]
Length=598

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAE-EGSQMSSEQLLRFLTEEQGQKEATL  312
            MG Y +C+CF +KF VTEA P  DVKE F KYA   GS M+ EQL RFL E QG  EA++
Sbjct  4    MGDYSMCICFPKKFGVTEAGPPVDVKEVFMKYATGGGSGMTVEQLRRFLVEVQGDVEASM  63

Query  313  AEAEAIVXQILHKRH  357
             +AE IV ++  +RH
Sbjct  64   EDAERIVEEVFKRRH  78



>ref|XP_009385551.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=529

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+CFTRKF    A P  DV++ F +Y+E  +QM  +QL RFL E QGQ +ATLA
Sbjct  1    MGSYKYCICFTRKFVWRAAAPPPDVRQTFVEYSEGAAQMGPDQLRRFLAEAQGQADATLA  60

Query  316  EAEAIVXQILHKR  354
            +AE I   +LH+R
Sbjct  61   DAERINEVLLHRR  73



>ref|XP_007016095.1| Phosphatidylinositol-speciwc phospholipase C4, putative isoform 
2 [Theobroma cacao]
 gb|EOY33714.1| Phosphatidylinositol-speciwc phospholipase C4, putative isoform 
2 [Theobroma cacao]
Length=597

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            +G+Y +C+CF +KF  TEA P  DVKE F +YA  G+ M+ EQL RFL E QG  EA++ 
Sbjct  4    IGNYSLCICFPKKFGTTEAGPPVDVKEVFMEYAGGGTCMTVEQLRRFLVEVQGDAEASIE  63

Query  316  EAEAIVXQILHKRH  357
            +AE IV ++L +RH
Sbjct  64   DAERIVEEVLQRRH  77



>ref|XP_007016094.1| Phosphatidylinositol-speciwc phospholipase C4 isoform 1 [Theobroma 
cacao]
 gb|EOY33713.1| Phosphatidylinositol-speciwc phospholipase C4 isoform 1 [Theobroma 
cacao]
Length=596

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            +G+Y +C+CF +KF  TEA P  DVKE F +YA  G+ M+ EQL RFL E QG  EA++ 
Sbjct  4    IGNYSLCICFPKKFGTTEAGPPVDVKEVFMEYAGGGTCMTVEQLRRFLVEVQGDAEASIE  63

Query  316  EAEAIVXQILHKRH  357
            +AE IV ++L +RH
Sbjct  64   DAERIVEEVLQRRH  77



>ref|XP_010922549.1| PREDICTED: phosphoinositide phospholipase C 6-like [Elaeis guineensis]
Length=587

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+CFTRKF+ +EA P  DV  AF  YA  G  M  EQL RFL + QG+  ATLA
Sbjct  1    MGSYKYCLCFTRKFRWSEAAPPPDVVAAFAAYANGGDHMGPEQLRRFLAKAQGESGATLA  60

Query  316  EAEAIVXQILHKRH  357
            +AE I+ Q+   RH
Sbjct  61   DAERIIGQVRQLRH  74



>ref|XP_008457370.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Cucumis melo]
Length=572

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEE-GSQMSSEQLLRFLTEEQGQKEATL  312
            MG+YRVC+CF R+FK+++ +P  DVKEAF KYA    + M++EQL  FL E QG + A+L
Sbjct  1    MGNYRVCLCFIRRFKMSKEEPPPDVKEAFVKYAGGVAANMTAEQLRSFLVEFQGDQTASL  60

Query  313  AEAEAIVXQILHKRHPI  363
            A+A+ IV  +L +RH +
Sbjct  61   ADAQRIVEHVLQRRHHV  77



>ref|XP_006425074.1| hypothetical protein CICLE_v10028054mg [Citrus clementina]
 gb|ESR38314.1| hypothetical protein CICLE_v10028054mg [Citrus clementina]
Length=602

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVC---MCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY +C    CFTRK KV EA P ADVKE FKKYAE G+ M+ EQL +FL E QG    
Sbjct  1    MGSYLLCGLPACFTRKHKVAEAGPPADVKEMFKKYAEGGTHMTVEQLWQFLAEVQGHGGV  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            ++ +AE IV Q+L + H I+
Sbjct  61   SIEDAEQIVDQVLQRWHHIA  80



>ref|XP_009783760.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X2 
[Nicotiana sylvestris]
Length=805

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   +V  CF RKFK++E  P  DV++AF  YAE+G+ M+++QL RFL E QG+K  
Sbjct  1    MGSYNYYKVLGCFNRKFKISETGPPPDVRDAFSLYAEKGTHMTADQLARFLVEYQGEKGC  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            T+ +A+ I+ Q+ ++RH ++
Sbjct  61   TINDAQQIIQQVFNRRHHLT  80



>ref|XP_009783759.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X1 
[Nicotiana sylvestris]
Length=890

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   +V  CF RKFK++E  P  DV++AF  YAE+G+ M+++QL RFL E QG+K  
Sbjct  1    MGSYNYYKVLGCFNRKFKISETGPPPDVRDAFSLYAEKGTHMTADQLARFLVEYQGEKGC  60

Query  307  TLAEAEAIVXQILHKRH  357
            T+ +A+ I+ Q+ ++RH
Sbjct  61   TINDAQQIIQQVFNRRH  77



>ref|XP_011076690.1| PREDICTED: phosphoinositide phospholipase C 6-like [Sesamum indicum]
Length=583

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   ++  CF RKFKV+E+QP  DV+EAF +Y + GS M++EQLL+FL E Q ++ +
Sbjct  1    MGSYNYYKMFGCFNRKFKVSESQPPPDVREAFWRYTDGGSSMTAEQLLKFLVEYQKEESS  60

Query  307  TLAEAEAIVXQILHKRH  357
            T  +AEAI+  + H RH
Sbjct  61   TAEDAEAIMQHVFHHRH  77



>ref|XP_004490600.1| PREDICTED: phosphoinositide phospholipase C 4-like [Cicer arietinum]
Length=593

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQ--KEAT  309
            MGSYRVC+CF RKFK  EA+P  +++E F KY+E G+ M+ +QL RFLTE QG+   +  
Sbjct  1    MGSYRVCVCFRRKFKSGEAEPPHEIRELFNKYSEGGAHMTPDQLCRFLTEVQGEVVNDND  60

Query  310  LAEAEAIVXQILHKRHPIS  366
                + +V  +LHKRH I+
Sbjct  61   QLNPQKLVEDLLHKRHHIT  79



>ref|XP_010253909.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Nelumbo nucifera]
Length=564

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY++C+ FTRKF   EAQP  DV EAF+K++E  S M++EQL RF+ E QG  + T  
Sbjct  1    MGSYKMCIFFTRKFDFNEAQPPPDVMEAFEKFSEGESHMTAEQLHRFMVEFQGDADTTTN  60

Query  316  EAEAIVXQILHKRHPIS  366
            +A+ I+ +++ KRH ++
Sbjct  61   DAKRIIHKVIDKRHAVT  77



>ref|XP_010253908.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Nelumbo nucifera]
Length=578

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY++C+ FTRKF   EAQP  DV EAF+K++E  S M++EQL RF+ E QG  + T  
Sbjct  1    MGSYKMCIFFTRKFDFNEAQPPPDVMEAFEKFSEGESHMTAEQLHRFMVEFQGDADTTTN  60

Query  316  EAEAIVXQILHKRHPIS  366
            +A+ I+ +++ KRH ++
Sbjct  61   DAKRIIHKVIDKRHAVT  77



>ref|XP_004153207.1| PREDICTED: phosphoinositide phospholipase C 4-like [Cucumis sativus]
Length=581

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEE-GSQMSSEQLLRFLTEEQGQKEATL  312
            MG+YRVC+CF R+FK+++ +P  DVKEAF KYA    + M++E L  FL E QG + A+L
Sbjct  1    MGNYRVCLCFIRRFKMSKEEPPPDVKEAFVKYAGGVAANMTAEHLRSFLVEFQGDQTASL  60

Query  313  AEAEAIVXQILHKRHPI  363
            A+A+ IV  +L +RH +
Sbjct  61   ADAQRIVEHVLQRRHHV  77



>ref|XP_004145255.1| PREDICTED: phosphoinositide phospholipase C 4-like [Cucumis sativus]
Length=581

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEE-GSQMSSEQLLRFLTEEQGQKEATL  312
            MG+YRVC+CF R+FK+++ +P  DVKEAF KYA    + M++E L  FL E QG + A+L
Sbjct  1    MGNYRVCLCFIRRFKMSKEEPPPDVKEAFVKYAGGVAANMTAEHLRSFLVEFQGDQTASL  60

Query  313  AEAEAIVXQILHKRHPI  363
            A+A+ IV  +L +RH +
Sbjct  61   ADAQRIVEHVLQRRHHV  77



>gb|EYU20014.1| hypothetical protein MIMGU_mgv1a0236391mg, partial [Erythranthe 
guttata]
Length=122

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 3/77 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   ++  CF RKFK++E++P  DV+EAF +Y++ GS MS++QL +FL   Q +   
Sbjct  1    MGSYNYYKMFGCFNRKFKISESEPPPDVREAFWRYSDGGSHMSADQLHQFLVNHQQEDSC  60

Query  307  TLAEAEAIVXQILHKRH  357
            T  + EAI+  + H RH
Sbjct  61   TALDVEAIMQHVFHHRH  77



>ref|XP_009586599.1| PREDICTED: phosphoinositide phospholipase C 6-like [Nicotiana 
tomentosiformis]
Length=590

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   R+  CF RKFK+ E +P  +V+EAF +Y   G+ M+++QLLRFL E QG++ A
Sbjct  1    MGSYNYYRMFGCFNRKFKIRETEPPPEVREAFSRYTGRGTHMNADQLLRFLVEVQGEECA  60

Query  307  TLAEAEAIVXQILHKRH  357
            T+ +AE I+ Q++++RH
Sbjct  61   TVKDAEQIIQQVVNRRH  77



>gb|KGN65808.1| hypothetical protein Csa_1G531180 [Cucumis sativus]
Length=572

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEE-GSQMSSEQLLRFLTEEQGQKEATL  312
            MG+YRVC+CF R+FK+++ +P  DVKEAF KYA    + M++E L  FL E QG + A+L
Sbjct  1    MGNYRVCLCFIRRFKMSKEEPPPDVKEAFVKYAGGVAANMTAEHLRSFLVEFQGDQTASL  60

Query  313  AEAEAIVXQILHKRHPI  363
            A+A+ IV  +L +RH +
Sbjct  61   ADAQRIVEHVLQRRHHV  77



>ref|XP_010483472.1| PREDICTED: phosphoinositide phospholipase C 4 isoform X2 [Camelina 
sativa]
Length=590

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEAT-L  312
            MGSY+ C+ FTRKF++TEA P  DV+  F+KYAE  + MS EQL + + EE G++ +T L
Sbjct  7    MGSYKFCLIFTRKFRMTEAGPVDDVRAVFEKYAEGEANMSPEQLQKLMAEEGGEERSTSL  66

Query  313  AEAEAIVXQILHKRHPIS  366
             EAE IV ++L +RH I+
Sbjct  67   EEAERIVDEVLRRRHHIA  84



>ref|XP_003615683.1| Phosphoinositide phospholipase C [Medicago truncatula]
Length=173

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 52/79 (66%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQ--KEAT  309
            MGSYRVC+CF R+FK  EA    +V+E F KYAE G+ M+ EQL RFL E QG+   E  
Sbjct  1    MGSYRVCVCFRRRFKSGEAVAPQEVREIFNKYAEGGAHMTPEQLRRFLVEVQGEVDDEKD  60

Query  310  LAEAEAIVXQILHKRHPIS  366
              + + +V ++L KRH I+
Sbjct  61   GLDTQKVVEEVLQKRHHIT  79



>ref|XP_010483471.1| PREDICTED: phosphoinositide phospholipase C 4 isoform X1 [Camelina 
sativa]
Length=598

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEAT-L  312
            MGSY+ C+ FTRKF++TEA P  DV+  F+KYAE  + MS EQL + + EE G++ +T L
Sbjct  7    MGSYKFCLIFTRKFRMTEAGPVDDVRAVFEKYAEGEANMSPEQLQKLMAEEGGEERSTSL  66

Query  313  AEAEAIVXQILHKRHPIS  366
             EAE IV ++L +RH I+
Sbjct  67   EEAERIVDEVLRRRHHIA  84



>ref|XP_010685545.1| PREDICTED: phosphoinositide phospholipase C 4-like [Beta vulgaris 
subsp. vulgaris]
Length=582

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            M SY VC CF RKF   E QP +D+KE F +YAE G  M++EQL +F+ E QG+ +ATLA
Sbjct  1    MESYIVCGCFARKFAKAELQPPSDIKEYFDEYAECGPHMTAEQLKKFMVEVQGEIKATLA  60

Query  316  EAEAIVXQILHKR-HP  360
            EAE IV +I  +R HP
Sbjct  61   EAEKIVEEIKSRRKHP  76



>ref|XP_010920867.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Elaeis guineensis]
Length=592

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+CFTRKF+  EAQP ADVKEAF  YAE GS M++EQL RFL + QG   AT A
Sbjct  1    MGSYKYCLCFTRKFRWVEAQPPADVKEAFAAYAEGGSHMNAEQLRRFLADVQGDAGATAA  60

Query  316  EAEAIVXQILHKRH  357
            +A+ ++ Q+   RH
Sbjct  61   DADRVMEQVHQLRH  74



>ref|XP_010920866.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Elaeis guineensis]
Length=593

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+CFTRKF+  EAQP ADVKEAF  YAE GS M++EQL RFL + QG   AT A
Sbjct  1    MGSYKYCLCFTRKFRWVEAQPPADVKEAFAAYAEGGSHMNAEQLRRFLADVQGDAGATAA  60

Query  316  EAEAIVXQILHKRH  357
            +A+ ++ Q+   RH
Sbjct  61   DADRVMEQVHQLRH  74



>ref|XP_002525651.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF36769.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=578

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYR+CMCF RKFK+ +++P  DV++AFK Y E    M+ + L RFL + Q    AT +
Sbjct  1    MGSYRMCMCFIRKFKIMDSEPPPDVRDAFKNYTEGSLHMTPDHLRRFLLDVQHADAAT-S  59

Query  316  EAEAIVXQILHKRHPIS  366
            +A+ IV QI + RH I+
Sbjct  60   DADKIVDQIFNNRHHIA  76



>gb|AIU41540.1| phosphatidylinositol phospholipase C 7 [Solanum lycopersicum]
Length=594

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   +V  CF RKFK++E  P  DV  AF  Y E+GS M+ +QL RF+ E QG+KE 
Sbjct  1    MGSYNYYKVLGCFNRKFKISETGPPPDVSNAFSLYTEKGSHMTGDQLGRFMAEYQGEKEC  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            T+ +AE I+ +++++RH ++
Sbjct  61   TVNDAEQIIQEVVNRRHHLT  80



>ref|XP_010443621.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X2 
[Camelina sativa]
Length=590

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEAT-L  312
            MGSY+ C+ FTRKF++TE+ P  DV+  F+KYAE  + MS EQL + + +E G++ +T L
Sbjct  7    MGSYKFCLIFTRKFRMTESGPVDDVRAVFEKYAEGEAHMSPEQLQKLMADEGGEERSTSL  66

Query  313  AEAEAIVXQILHKRHPIS  366
             EAE IV ++L +RH I+
Sbjct  67   EEAERIVDEVLRRRHHIA  84



>ref|XP_010443620.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Camelina sativa]
Length=598

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEAT-L  312
            MGSY+ C+ FTRKF++TE+ P  DV+  F+KYAE  + MS EQL + + +E G++ +T L
Sbjct  7    MGSYKFCLIFTRKFRMTESGPVDDVRAVFEKYAEGEAHMSPEQLQKLMADEGGEERSTSL  66

Query  313  AEAEAIVXQILHKRHPIS  366
             EAE IV ++L +RH I+
Sbjct  67   EEAERIVDEVLRRRHHIA  84



>gb|ABR16641.1| unknown [Picea sitchensis]
Length=597

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSYRVC+CFTRKFK     P  DVK+ F +Y+E G QM+   L RFL E Q Q +A+  
Sbjct  1    MGSYRVCVCFTRKFKSDALSPPGDVKDLFNEYSESGGQMTVRNLHRFLVEVQRQTDASEK  60

Query  316  EAEAIVXQILHKRH  357
            +AE ++  +  +RH
Sbjct  61   DAEHVLEVLRQRRH  74



>ref|XP_006843548.1| hypothetical protein AMTR_s00007p00065880 [Amborella trichopoda]
 gb|ERN05223.1| hypothetical protein AMTR_s00007p00065880 [Amborella trichopoda]
Length=593

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG+Y++C+CFTRKFK  + +P  DVK+AF  Y+E G  M +E L RF+ E Q + E ++ 
Sbjct  1    MGTYKMCVCFTRKFKGGDTEPPVDVKKAFANYSESG-YMGAEHLRRFIVEVQREVEVSIK  59

Query  316  EAEAIVXQILHKRH  357
            +AE I+ QI H+RH
Sbjct  60   DAENIIDQIRHRRH  73



>gb|EYU22354.1| hypothetical protein MIMGU_mgv1a001900mg [Erythranthe guttata]
Length=741

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            Y+V  CF+RKFK+T++QP  DV+EAF +YAE   QM+++QLL+FL + Q ++  T+A+AE
Sbjct  8    YKVLGCFSRKFKITDSQPPPDVREAFWRYAEGAPQMTADQLLKFLVDSQREEGYTVADAE  67

Query  325  AIVXQILHKRHPIS  366
            AI+  +  +R  +S
Sbjct  68   AIIQNVFRRRSHVS  81



>ref|XP_009380683.1| PREDICTED: phosphoinositide phospholipase C 2-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C CFTRKF+ +EAQP ADV+ AF  ++E G+ M+++Q  RFL E QG  +A +A
Sbjct  1    MGSYKCCFCFTRKFRWSEAQPPADVRAAFDAHSEGGTHMTADQFRRFLAEAQG--DAAVA  58

Query  316  EAEAIVXQILHKRH  357
            + E ++ Q L   H
Sbjct  59   DVERVMEQALELGH  72



>ref|XP_010535374.1| PREDICTED: phosphoinositide phospholipase C 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535375.1| PREDICTED: phosphoinositide phospholipase C 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535376.1| PREDICTED: phosphoinositide phospholipase C 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535377.1| PREDICTED: phosphoinositide phospholipase C 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535378.1| PREDICTED: phosphoinositide phospholipase C 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535380.1| PREDICTED: phosphoinositide phospholipase C 5 isoform X1 [Tarenaya 
hassleriana]
Length=583

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +1

Query  139  GSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAE  318
            G YR+ +CFT +F++    P  DV+EAF +YAE G+ M++EQL RFL E QG+   +++E
Sbjct  6    GKYRMGLCFTGEFRINGQTPP-DVEEAFAEYAEGGAHMTAEQLSRFLVEVQGETGVSVSE  64

Query  319  AEAIVXQILHKRHPIS  366
            AE I+ Q++H RH I+
Sbjct  65   AEKIIEQVVHARHHIT  80



>ref|XP_006279487.1| hypothetical protein CARUB_v10026125mg [Capsella rubella]
 gb|EOA12385.1| hypothetical protein CARUB_v10026125mg [Capsella rubella]
Length=596

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+ FTRKF++TE  P  DV+  F KYAE  + MS EQL + + EE G   +TL 
Sbjct  7    MGSYKFCLVFTRKFRMTEPGPVDDVRAVFDKYAEGEAHMSPEQLQKLMAEEGGGG-STLE  65

Query  316  EAEAIVXQILHKRHPIS  366
            EAE IV ++L +RH I+
Sbjct  66   EAERIVDEVLRRRHHIA  82



>ref|XP_010318244.1| PREDICTED: phosphoinositide phospholipase C 6-like [Solanum lycopersicum]
Length=884

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   +V  CF RKFK++E  P  DV  AF  Y E+GS M+ +QL RF+ E QG+KE 
Sbjct  1    MGSYNYYKVLGCFNRKFKISETGPPPDVSNAFSLYTEKGSHMTGDQLGRFMAEYQGEKEC  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            T+ +AE I+ +++++RH ++
Sbjct  61   TVNDAEQIIQEVVNRRHHLT  80



>gb|AES98642.2| phosphatidylinositol-specific phospholipase C [Medicago truncatula]
Length=594

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 52/79 (66%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQ--KEAT  309
            MGSYRVC+CF R+FK  EA    +V+E F KYAE G+ M+ EQL RFL E QG+   E  
Sbjct  1    MGSYRVCVCFRRRFKSGEAVAPQEVREIFNKYAEGGAHMTPEQLRRFLVEVQGEVDDEKD  60

Query  310  LAEAEAIVXQILHKRHPIS  366
              + + +V ++L KRH I+
Sbjct  61   GLDTQKVVEEVLQKRHHIT  79



>emb|CDY32691.1| BnaA02g07530D [Brassica napus]
Length=594

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQ--KEAT  309
            MGSY++C+ FTRKF+VTE  P  DV+  F+KYAE  + M+ EQL + + +E G   + ++
Sbjct  1    MGSYKMCLVFTRKFRVTEPDPVDDVRHVFQKYAEGEAHMTPEQLQKLMADETGTGGEGSS  60

Query  310  LAEAEAIVXQILHKRHPIS  366
            L EAE IV ++L ++H I+
Sbjct  61   LEEAERIVDEVLRRKHHIA  79



>gb|KFK27404.1| hypothetical protein AALP_AA8G378600 [Arabis alpina]
Length=593

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGS--QMSSEQLLRFLTEEQGQKEAT  309
            MGSYR+C+ F RKF VTE  P  DVK+ F+KY E+G    MS EQL +F+ EE G+  ++
Sbjct  1    MGSYRMCLIFKRKFMVTEPGPVDDVKDLFEKYTEDGDDVHMSPEQLQKFMAEEHGEG-SS  59

Query  310  LAEAEAIVXQILHKRHPIS  366
            + EAE IV ++L ++H I+
Sbjct  60   IEEAERIVDEVLRRKHHIA  78



>ref|XP_008789096.1| PREDICTED: phosphoinositide phospholipase C 5-like [Phoenix dactylifera]
 ref|XP_008789097.1| PREDICTED: phosphoinositide phospholipase C 5-like [Phoenix dactylifera]
 ref|XP_008789098.1| PREDICTED: phosphoinositide phospholipase C 5-like [Phoenix dactylifera]
Length=286

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+ F+RKF++ EAQP  DVKEAF  YAE GS +++EQL RFL + QG   AT A
Sbjct  1    MGSYKYCLGFSRKFRLVEAQPPLDVKEAFTAYAEGGSHINAEQLRRFLADAQGDAGATAA  60

Query  316  EAEAIVXQI--LHKRH  357
            +AE ++ Q   LH RH
Sbjct  61   DAERVMEQAYQLHHRH  76



>ref|XP_002311222.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEE88589.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=590

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCM--CFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEAT  309
            MGSY   M   F RKFK+TEA+P  DVK+ F K++  GS M+++QL RFL   Q + + T
Sbjct  1    MGSYNYKMFNLFNRKFKITEAEPPKDVKQLFSKFSNGGSHMTADQLRRFLVLHQDELDCT  60

Query  310  LAEAEAIVXQILHKRHPIS  366
            LA+A+ IV +++++RH ++
Sbjct  61   LADAQKIVEEVINRRHHLT  79



>ref|XP_004166852.1| PREDICTED: phosphoinositide phospholipase C 6-like, partial [Cucumis 
sativus]
Length=488

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATL  312
            G  SY+V +CF+RKFK TEA+P  DV+  F  +++    MS +Q LRFL ++QG  E T 
Sbjct  4    GCSSYKV-LCFSRKFKSTEAEPPPDVRNLFSSFSDGRDYMSPDQFLRFLVDQQGDVECTP  62

Query  313  AEAEAIVXQILHKR  354
            +EA+ I+ Q+LHKR
Sbjct  63   SEADQILQQVLHKR  76



>ref|XP_011045853.1| PREDICTED: phosphoinositide phospholipase C 6 isoform X1 [Populus 
euphratica]
 ref|XP_011042809.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X1 
[Populus euphratica]
Length=614

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCM--CFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEAT  309
            MGSY   M   F RKFK+TEA+P  DVK+ F K++  GS M+++QL RFL   Q + + T
Sbjct  25   MGSYNYKMFNLFNRKFKITEAEPPKDVKQLFSKFSNGGSHMTADQLRRFLVLHQDELDCT  84

Query  310  LAEAEAIVXQILHKRHPIS  366
            LA+A+ IV +++++RH ++
Sbjct  85   LADAQKIVEEVINRRHHLT  103



>ref|XP_004138421.1| PREDICTED: phosphoinositide phospholipase C 6-like [Cucumis sativus]
 gb|KGN45789.1| hypothetical protein Csa_6G011650 [Cucumis sativus]
Length=586

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATL  312
            G  SY+V +CF+RKFK TEA+P  DV+  F  +++    MS +Q LRFL ++QG  E T 
Sbjct  4    GCSSYKV-LCFSRKFKSTEAEPPPDVRNLFSSFSDGRDYMSPDQFLRFLVDQQGDVECTP  62

Query  313  AEAEAIVXQILHKR  354
            +EA+ I+ Q+LHKR
Sbjct  63   SEADQILQQVLHKR  76



>ref|XP_006356459.1| PREDICTED: phosphoinositide phospholipase C 6-like [Solanum tuberosum]
Length=884

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   +V  CF RKFK++E  P  DV  AF  Y E+GS M+ +QL RF+ + QG+KE 
Sbjct  1    MGSYNYYKVLGCFNRKFKISETGPPPDVSNAFSLYTEKGSHMTGDQLGRFMVDYQGEKEC  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            T+ +AE I+ +++++RH ++
Sbjct  61   TINDAEQIIQEVVNRRHHLT  80



>ref|XP_011084908.1| PREDICTED: phosphoinositide phospholipase C 6 [Sesamum indicum]
Length=588

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   R+  CF RKFK++E QP  +V EAF++YAE    M+++QLL+FL E Q ++E 
Sbjct  1    MGSYNYYRMFGCFNRKFKISEWQPPPEVGEAFRRYAEGADHMTADQLLKFLVEYQREEEG  60

Query  307  -TLAEAEAIVXQILHKRHPIS  366
             + A+AEAI+ ++  +RH  S
Sbjct  61   CSAADAEAIMQKVFQRRHQTS  81



>ref|XP_009126743.1| PREDICTED: phosphoinositide phospholipase C 4 [Brassica rapa]
Length=594

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEE---QGQKEA  306
            MGSYR+C+ FTRKF+VTE  P  DV+  F+KYAE  + M+ EQL + + +E    G   +
Sbjct  1    MGSYRMCLVFTRKFRVTEPDPVDDVRHVFQKYAEGEAHMTPEQLQKLMADETGTGGGGGS  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            +L EAE IV ++L ++H I+
Sbjct  61   SLEEAERIVDEVLRRKHHIA  80



>ref|XP_011045930.1| PREDICTED: phosphoinositide phospholipase C 6 isoform X2 [Populus 
euphratica]
 ref|XP_011042810.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X2 
[Populus euphratica]
Length=534

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCM--CFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEAT  309
            MGSY   M   F RKFK+TEA+P  DVK+ F K++  GS M+++QL RFL   Q + + T
Sbjct  25   MGSYNYKMFNLFNRKFKITEAEPPKDVKQLFSKFSNGGSHMTADQLRRFLVLHQDELDCT  84

Query  310  LAEAEAIVXQILHKRHPIS  366
            LA+A+ IV +++++RH ++
Sbjct  85   LADAQKIVEEVINRRHHLT  103



>emb|CDP14022.1| unnamed protein product [Coffea canephora]
Length=584

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   R+  CF RKFK++E +P  DV  AF KYA  G+ M+ +Q  RFL E QG++  
Sbjct  1    MGSYNYYRMFGCFNRKFKISETEPPPDVMSAFHKYAGGGTHMTPDQFARFLVEYQGEEGC  60

Query  307  TLAEAEAIVXQILHKRHPIS  366
            TLA+AE ++  ++ +RH ++
Sbjct  61   TLADAERLMHIVIQRRHHLT  80



>gb|AFN53674.1| hypothetical protein [Linum usitatissimum]
Length=530

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  151  VCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAEAI  330
            +C CF RKF+V+EA P  DV++AF+KYA  G  M+ +QL  FL+E QG+ +     AE I
Sbjct  1    MCGCFVRKFRVSEAGPPPDVRDAFRKYAGGGLLMTVDQLRLFLSEVQGEGDCISDAAEKI  60

Query  331  VXQILHKRH  357
            V  ILHKRH
Sbjct  61   VASILHKRH  69



>ref|XP_002316213.2| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEF02384.2| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=595

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCM--CFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEAT  309
            MGSY   M   F RKFK+TEA+P  DVK+ F K+++ GS M ++QL RFL   Q +   T
Sbjct  25   MGSYNYKMFNLFNRKFKITEAEPPKDVKQVFSKFSDGGSHMMADQLRRFLVLHQDELHCT  84

Query  310  LAEAEAIVXQILHKRHPIS  366
            LAEA+ I+ +++++RH ++
Sbjct  85   LAEAKKIMEEVINRRHHLT  103



>ref|XP_009399994.1| PREDICTED: phosphoinositide phospholipase C 6-like [Musa acuminata 
subsp. malaccensis]
Length=592

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ CMCFTRKF  + AQP ADV+EAF  +A   +QM ++QL RFL E QG+  ATLA
Sbjct  1    MGSYKYCMCFTRKFLWSAAQPPADVREAFAAHAGGAAQMGADQLQRFLAEAQGEAAATLA  60

Query  316  EAEAIVXQILHKRH  357
            +AE IV ++L +RH
Sbjct  61   DAERIV-ELLRRRH  73



>ref|XP_006338847.1| PREDICTED: phosphoinositide phospholipase C 6-like [Solanum tuberosum]
Length=591

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +1

Query  136  MGS----YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKE  303
            MGS    YR+  CF RKFK+ E +P  DV++AF +Y  +G QM+++QLLR+L E QG++ 
Sbjct  1    MGSSYNYYRMFGCFNRKFKIRETEPPPDVRDAFFRYTGKGIQMNADQLLRYLVEVQGEEG  60

Query  304  ATLAEAEAIVXQILHKRH  357
             T+ +AE I+  +  +RH
Sbjct  61   CTIKDAEQIIQHVASRRH  78



>ref|XP_008806127.1| PREDICTED: phosphoinositide phospholipase C 4-like [Phoenix dactylifera]
Length=464

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY+ C+ FT+KF+ +EA P  DVK AF+ Y + G+ M  + LL FL E QG+  ATLA
Sbjct  1    MGSYKHCLFFTQKFRRSEAAPPPDVKAAFEAYTDGGNHMGPDDLLCFLAEAQGEAGATLA  60

Query  316  EAEAIVXQILH  348
            +A+ IV ++ H
Sbjct  61   DAKLIVDRVRH  71



>ref|XP_008789094.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Phoenix dactylifera]
Length=601

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            M SY+ C+CF+RKF+  EAQP  DVKEAF  YAE GS +++EQL RFL + QG   AT A
Sbjct  1    MESYKYCLCFSRKFRWVEAQPPEDVKEAFTAYAERGSHINAEQLRRFLADAQGDAGATAA  60

Query  316  EAEAIVXQILHKRH  357
            +AE ++ Q    RH
Sbjct  61   DAERVMEQAYQLRH  74



>ref|XP_008789093.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Phoenix dactylifera]
Length=602

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            M SY+ C+CF+RKF+  EAQP  DVKEAF  YAE GS +++EQL RFL + QG   AT A
Sbjct  1    MESYKYCLCFSRKFRWVEAQPPEDVKEAFTAYAERGSHINAEQLRRFLADAQGDAGATAA  60

Query  316  EAEAIVXQILHKRH  357
            +AE ++ Q    RH
Sbjct  61   DAERVMEQAYQLRH  74



>gb|EPS71356.1| hypothetical protein M569_03403 [Genlisea aurea]
Length=585

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 54/77 (70%), Gaps = 3/77 (4%)
 Frame = +1

Query  136  MGSY---RVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEA  306
            MGSY   ++  CF RKFK++E++P  DV+EAF ++ E  S+M+ +QLL+F+   Q ++  
Sbjct  1    MGSYNYYKMFGCFNRKFKISESEPPPDVREAFWRFTEGDSEMTPDQLLKFMVHHQREESC  60

Query  307  TLAEAEAIVXQILHKRH  357
            T A+ E+I+  +LH+R+
Sbjct  61   TAADVESIMNHVLHRRY  77



>gb|AJA33385.1| phosphatidylinositol phospholipase C 5 [Solanum lycopersicum]
Length=593

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 4/78 (5%)
 Frame = +1

Query  136  MGS----YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKE  303
            MGS    YR+  CF RKFK+ E +P  DV+ AF +Y  + +QM+++QL R+L E QG++E
Sbjct  1    MGSSYNYYRMFGCFNRKFKIREREPPPDVRNAFFRYTGKANQMNADQLFRYLVEVQGEEE  60

Query  304  ATLAEAEAIVXQILHKRH  357
             T+ +AE I+  +  +RH
Sbjct  61   CTIKDAEQIIQNVASRRH  78



>gb|AAW22879.1| putative phospholipase C [Solanum lycopersicum]
Length=574

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 4/78 (5%)
 Frame = +1

Query  136  MGS----YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKE  303
            MGS    YR+  CF RKFK+ E +P  DV+ AF +Y  + +QM+++QL R+L E QG++E
Sbjct  1    MGSSYNYYRMFGCFNRKFKIREREPPPDVRNAFFRYTGKANQMNADQLFRYLVEVQGEEE  60

Query  304  ATLAEAEAIVXQILHKRH  357
             T+ +AE I+  +  +RH
Sbjct  61   CTIKDAEQIIQNVASRRH  78



>ref|XP_010922548.1| PREDICTED: phosphoinositide phospholipase C 4-like [Elaeis guineensis]
Length=581

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAA-DVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATL  312
            MGS R C+CF RKF+ +EA P   DVKEAF+ Y++ G+ M  E LL FL E QG+  AT+
Sbjct  1    MGSCRYCLCFARKFRRSEAAPPPPDVKEAFEAYSDGGNHMGPEGLLCFLAEAQGEAGATI  60

Query  313  AEAEAIVXQI  342
            A+A+ IV ++
Sbjct  61   ADAKLIVDRV  70



>ref|XP_009387519.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=593

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY  C+CFTR+F+ +EAQP ADV+ AF  YAE  + M+++QL  F++E QG   A  A
Sbjct  1    MGSYTCCLCFTRRFRSSEAQPPADVRAAFATYAEGAAHMTADQLRSFMSEAQGGDGAD-A  59

Query  316  EAEAIVXQ  339
            +AE ++ Q
Sbjct  60   DAERVMEQ  67



>ref|XP_009387536.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=592

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY  C+CFTR+F+ +EAQP ADV+ AF  YAE  + M+++QL  F++E QG   A  A
Sbjct  1    MGSYTCCLCFTRRFRSSEAQPPADVRAAFATYAEGAAHMTADQLRSFMSEAQGGDGAD-A  59

Query  316  EAEAIVXQ  339
            +AE ++ Q
Sbjct  60   DAERVMEQ  67



>ref|XP_009387528.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=590

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY  C+CFTR+F+ +EAQP ADV+ AF  YAE  + M+++QL  F++E QG   A  A
Sbjct  1    MGSYTCCLCFTRRFRSSEAQPPADVRAAFATYAEGAAHMTADQLRSFMSEAQGGDGAD-A  59

Query  316  EAEAIVXQ  339
            +AE ++ Q
Sbjct  60   DAERVMEQ  67



>emb|CDX80341.1| BnaC09g34010D [Brassica napus]
Length=590

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQK-EATL  312
            MGSYR+C+ F RKF+VTE  P  DV++ F++YAE  + MS EQL + + +E+ +   ++L
Sbjct  1    MGSYRMCLIFKRKFRVTEPGPVDDVRDVFERYAEGQAHMSPEQLRKLMADERREDLGSSL  60

Query  313  AEAEAIVXQILHKRHPIS  366
             +AE +V ++L ++H I+
Sbjct  61   EDAERLVDEVLRRKHHIA  78



>ref|XP_009120385.1| PREDICTED: phosphoinositide phospholipase C 4 [Brassica rapa]
Length=589

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQK-EATL  312
            MGSYR+C+ F RKF+VTE  P  DV++ F +YAE  + MS EQL + + +E+ +   ++L
Sbjct  1    MGSYRMCLIFKRKFRVTEPGPVDDVRDVFSRYAEGQAHMSPEQLRKLMADERREDLGSSL  60

Query  313  AEAEAIVXQILHKRHPIS  366
             +AE +V ++L ++H I+
Sbjct  61   EDAERLVDEVLRRKHHIA  78



>emb|CDY52122.1| BnaA10g29510D [Brassica napus]
Length=589

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQK-EATL  312
            MGSYR+C+ F RKF+VTE  P  DV++ F +YAE  + MS EQL + + +E+ +   ++L
Sbjct  1    MGSYRMCLIFKRKFRVTEPGPVDDVRDVFSRYAEGQAHMSPEQLRKLMADERREDLGSSL  60

Query  313  AEAEAIVXQILHKRHPIS  366
             +AE +V ++L ++H I+
Sbjct  61   EDAERLVDEVLRRKHHIA  78



>ref|XP_008441466.1| PREDICTED: phosphoinositide phospholipase C 6 [Cucumis melo]
Length=587

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATL  312
            G  SY+V +CF+RKFK TEA+P  DV+  F  ++     MS++Q LRFL ++QG  E   
Sbjct  4    GCSSYKV-LCFSRKFKTTEAEPPPDVRNLFASFSGGRDYMSADQFLRFLVDQQGDVECAP  62

Query  313  AEAEAIVXQILHKR  354
            +EAE I+ Q+L +R
Sbjct  63   SEAEQILQQVLQRR  76



>ref|XP_010937846.1| PREDICTED: phosphoinositide phospholipase C 2-like [Elaeis guineensis]
Length=590

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            M +YRVC CF R+F+    +P A VKE F+KY+ EG  M +EQL RFL E QG+ +AT  
Sbjct  1    MSTYRVCFCFRRRFQPASNEPPAGVKEVFQKYS-EGGVMGAEQLQRFLVEVQGEAQATRE  59

Query  316  EAEAIVXQILHKRH  357
             AEA++  +   +H
Sbjct  60   AAEAVIDGMRELKH  73



>ref|XP_010106260.1| Phosphoinositide phospholipase C 6 [Morus notabilis]
 gb|EXC09417.1| Phosphoinositide phospholipase C 6 [Morus notabilis]
Length=599

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            Y++  CF RKFK+T+  P  DV++AF  ++     +S++QL RF+ E QG+   T+ EAE
Sbjct  12   YKMFKCFKRKFKITDVGPPPDVRDAFTTFSAGAEHLSADQLRRFMAENQGEPGVTVTEAE  71

Query  325  AIVXQILHKRHPIS  366
            AI+ ++L +R+ ++
Sbjct  72   AIIREVLRRRNDVT  85



>gb|AAB41107.1| phosphoinositide-specific phospholipase C [Vigna unguiculata]
Length=549

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V  CF RKF +TE +P  DV++AF ++++  S MS+E LLRFL E QG+ + T++++
Sbjct  5    NYKVFSCFNRKFTITEPKPPPDVQKAFSEFSDGASSMSAEHLLRFLAEHQGEVDCTVSDS  64

Query  322  EAIVXQ  339
            E I+ Q
Sbjct  65   EQILQQ  70



>ref|NP_001234176.1| PI-phospholipase C PLC5 [Solanum lycopersicum]
 gb|ABW80999.1| PI-phospholipase C PLC5 [Solanum lycopersicum]
Length=584

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  160  CFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAEAIVXQ  339
            CF RKFK+ E +P  DV+ AF +Y  + +QM+++QL R+L E QG++E T+ +AE I+  
Sbjct  4    CFNRKFKIREREPPPDVRNAFFRYTGKANQMNADQLFRYLVEVQGEEECTIKDAEQIIQN  63

Query  340  ILHKRH  357
            +  +RH
Sbjct  64   VASRRH  69



>ref|XP_011076692.1| PREDICTED: phosphoinositide phospholipase C 2-like [Sesamum indicum]
Length=587

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F++  ++  ADVKE F +Y++ G  MS +QL RFL E QG++ ATL +A
Sbjct  5    TYRVCFCFRRRFRLAASEAPADVKEIFARYSDNGV-MSVDQLRRFLVEVQGEENATLEDA  63

Query  322  EAIVXQILH  348
            ++++  + H
Sbjct  64   QSLMDSLKH  72



>ref|XP_007008969.1| Phosphoinositide-specific phospholipase C family protein [Theobroma 
cacao]
 gb|EOY17779.1| Phosphoinositide-specific phospholipase C family protein [Theobroma 
cacao]
Length=597

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 54/82 (66%), Gaps = 4/82 (5%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGS----QMSSEQLLRFLTEEQGQK  300
            G  +Y++   F RKFK+ E +P ADVK+AF ++ + G+     M++EQL RFL   QG+ 
Sbjct  8    GSYNYKMFNFFNRKFKINEVEPPADVKKAFAEFTDGGAAAALNMTAEQLKRFLVVHQGEV  67

Query  301  EATLAEAEAIVXQILHKRHPIS  366
            + TL +AE I+ Q++ +RH ++
Sbjct  68   DRTLEDAERIIQQVVSRRHHVT  89



>ref|XP_002866286.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42545.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=598

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLT-EEQGQKEATL  312
            MGSY+ C+ FTRKF++TE+ P ADV+E F+KYA+  + MS EQL + +  E  G  E +L
Sbjct  7    MGSYKFCLIFTRKFRMTESGPVADVRELFEKYADGEAHMSPEQLQKLMAEEGGGGGETSL  66

Query  313  AEAEAIVXQILHKRHPIS  366
             EAE IV ++L +RH I+
Sbjct  67   EEAERIVDEVLRRRHHIA  84



>ref|XP_002533649.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF28737.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=601

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCM--CFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEAT  309
            +GSY   M   F RKFK+TEA+P  DVKE F K++     MS +Q  RFL   Q   + T
Sbjct  22   LGSYNYKMFNLFNRKFKITEAEPPNDVKEVFAKFSYGERHMSPDQFRRFLVLHQDLVDCT  81

Query  310  LAEAEAIVXQILHKRHPIS  366
            LA+A+ IV  +++KRH I+
Sbjct  82   LADAQRIVEDVINKRHHIT  100



>ref|XP_010454096.1| PREDICTED: phosphoinositide phospholipase C 5 isoform X1 [Camelina 
sativa]
Length=581

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG Y++ +CF+ K ++    P  DV  AF +Y E  + +++EQL RFL E QGQ E  ++
Sbjct  5    MGRYKMGLCFSDKLRMNRGSPPPDVVTAFVEYTEGRNHLTAEQLCRFLVEVQGQTEVLVS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I   RH I+
Sbjct  65   DAEKIIERITCARHHIT  81



>ref|NP_001275400.1| phosphoinositide phospholipase C 2-like [Solanum tuberosum]
 emb|CAA63954.1| phosphoinositide-specific phospholipase C [Solanum tuberosum]
Length=585

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            SYRVC CF R+F+V  A+  ADVK  F +Y++ G  MS+E L RFL E Q ++ ATL +A
Sbjct  5    SYRVCFCFRRRFRVLAAEAPADVKNLFNRYSDNGV-MSAENLHRFLIEVQKEENATLEDA  63

Query  322  EAI--------VXQILHKR  354
             AI        +  I H+R
Sbjct  64   HAIMNNLHDLKILNIFHRR  82



>ref|XP_010454105.1| PREDICTED: phosphoinositide phospholipase C 5 isoform X2 [Camelina 
sativa]
Length=596

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG Y++ +CF+ K ++    P  DV  AF +Y E  + +++EQL RFL E QGQ E  ++
Sbjct  5    MGRYKMGLCFSDKLRMNRGSPPPDVVTAFVEYTEGRNHLTAEQLCRFLVEVQGQTEVLVS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I   RH I+
Sbjct  65   DAEKIIERITCARHHIT  81



>ref|XP_006435738.1| hypothetical protein CICLE_v10031019mg [Citrus clementina]
 gb|ESR48978.1| hypothetical protein CICLE_v10031019mg [Citrus clementina]
Length=515

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATL  312
            G   YR+   F RKFK+ E +P  DVK AF  ++++G  M   +  RF+ E QG+   TL
Sbjct  16   GSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTL  75

Query  313  AEAEAIVXQILHKRHPIS  366
            + AE IV  I+  RH I+
Sbjct  76   SRAEEIVNNIISSRHHIT  93



>ref|XP_006435739.1| hypothetical protein CICLE_v10031019mg [Citrus clementina]
 ref|XP_006486317.1| PREDICTED: phosphoinositide phospholipase C 6-like [Citrus sinensis]
 gb|ESR48979.1| hypothetical protein CICLE_v10031019mg [Citrus clementina]
Length=595

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATL  312
            G   YR+   F RKFK+ E +P  DVK AF  ++++G  M   +  RF+ E QG+   TL
Sbjct  16   GSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTL  75

Query  313  AEAEAIVXQILHKRHPIS  366
            + AE IV  I+  RH I+
Sbjct  76   SRAEEIVNNIISSRHHIT  93



>ref|XP_009120384.1| PREDICTED: phosphoinositide phospholipase C 5 [Brassica rapa]
Length=589

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            +G Y++ +CF+ K ++    P  DV   F +Y E G+ M++EQL RFL + QG+ E  ++
Sbjct  5    LGRYKMGLCFSDKLRMNRESPPPDVVRVFLEYTEGGNHMTAEQLCRFLVQVQGETEVLVS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I ++RH I+
Sbjct  65   DAEKIIERITNERHHIT  81



>emb|CDY52121.1| BnaA10g29500D [Brassica napus]
Length=589

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            +G Y++ +CF+ K ++    P  DV   F +Y E G+ M++EQL RFL + QG+ E  ++
Sbjct  5    LGRYKMGLCFSDKLRMNRESPPPDVVRVFLEYTEGGNHMTAEQLCRFLVQVQGETEVLVS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I ++RH I+
Sbjct  65   DAEKIIERITNERHHIT  81



>ref|XP_009344925.1| PREDICTED: phosphoinositide phospholipase C 6-like [Pyrus x bretschneideri]
Length=578

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y++  CF RKFK +EA P  DVK  F +YA+ G +MS +Q   FL E QG+   T+++A
Sbjct  10   NYKMFKCFNRKFKASEAGPPPDVKAVFAEYAQGGDRMSVDQFRSFLVEHQGESALTISDA  69

Query  322  EAIVXQILHKRHP  360
              I+ Q    RHP
Sbjct  70   HTILHQ-FTTRHP  81



>ref|XP_010483470.1| PREDICTED: phosphoinositide phospholipase C 5-like [Camelina 
sativa]
Length=581

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG Y++ +CF+ K ++    P  DV  AF +Y E  + +++EQL RFL E QG+ E  ++
Sbjct  5    MGRYKMGLCFSDKLRMNRGSPPPDVVTAFVEYTEGRNHLTAEQLCRFLVEVQGETEVPIS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I   RH I+
Sbjct  65   DAEKIIERITCARHHIT  81



>gb|KDO68976.1| hypothetical protein CISIN_1g043888mg, partial [Citrus sinensis]
Length=372

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATL  312
            G   YR+   F RKFK+ E +P  DVK AF  ++++G  M   +  RF+ E QG+   TL
Sbjct  33   GSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTL  92

Query  313  AEAEAIVXQILHKRHPIS  366
            + AE IV  I+  RH I+
Sbjct  93   SRAEEIVNNIISSRHHIT  110



>ref|XP_010454117.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Camelina sativa]
 ref|XP_010454124.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform X1 
[Camelina sativa]
Length=599

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLT----EEQGQKEAT  309
            SY+ C+ FTRKF++TE+ P  DV+  F+KYAE  + MS EQL + +      E  ++  +
Sbjct  7    SYKFCLIFTRKFRMTESGPVDDVRAVFEKYAEGEAHMSPEQLQKLMAEEGGGEGEERSTS  66

Query  310  LAEAEAIVXQILHKRHPIS  366
            L EAE IV ++L +RH I+
Sbjct  67   LEEAERIVDEVLRRRHHIA  85



>gb|EYU22355.1| hypothetical protein MIMGU_mgv1a003318mg [Erythranthe guttata]
Length=592

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            SYRVC CF R+F++  A+  AD+K  F +Y+E G  MS +Q+ RFL E Q ++ +TL +A
Sbjct  5    SYRVCFCFRRRFRMAAAEAPADIKAIFDEYSENGV-MSVDQMRRFLVEVQKEENSTLEDA  63

Query  322  EAIVXQILHKRH  357
            +A++  +   +H
Sbjct  64   QAVMDSLHELKH  75



>gb|EYU20012.1| hypothetical protein MIMGU_mgv1a003407mg [Erythranthe guttata]
Length=587

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F++  ++   DVK+ F +Y+E G  MS+EQL +FL + Q ++ ATL +A
Sbjct  5    TYRVCFCFRRRFRLAASEAPPDVKDIFNRYSENGV-MSAEQLRQFLVDVQSEEGATLEDA  63

Query  322  EAIVXQILH  348
            +AI+  + H
Sbjct  64   QAIMDSLKH  72



>emb|CDX80342.1| BnaC09g34000D [Brassica napus]
Length=589

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            +G Y++ +CF+ K ++    P  DV   F +Y E G+ M++E L RFL E QG+ E  ++
Sbjct  5    LGRYKMGLCFSDKLRMNRESPPPDVVRVFVEYTEGGNHMTAEHLRRFLVEVQGETEVLVS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ ++ ++RH I+
Sbjct  65   DAEKIIERVTNERHHIT  81



>ref|XP_002866285.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42544.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG Y++ +CF+ K ++    P  DV  AF +Y E  + M++EQL RFL E Q + E  ++
Sbjct  5    MGRYKMGLCFSDKLRMNRGAPPPDVVTAFVEYTEGRNHMTAEQLCRFLVEAQDETEVLVS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I  +RH I+
Sbjct  65   DAEKIIERITCERHHIT  81



>ref|NP_001234190.1| PI-phospholipase C PLC3 [Solanum lycopersicum]
 gb|ABW81001.1| PI-phospholipase C PLC3 [Solanum lycopersicum]
Length=583

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  ADVK  F +Y++ G  MS++ L RFL E Q ++ ATL +A
Sbjct  5    TYRVCFCFRRRFRVVAAEAPADVKNLFNRYSDNGV-MSADNLHRFLIEVQKEENATLEDA  63

Query  322  EAI--------VXQILHKR  354
             AI        +  I H+R
Sbjct  64   HAIMNNLHDLKILNIFHRR  82



>ref|XP_010443613.1| PREDICTED: phosphoinositide phospholipase C 5-like [Camelina 
sativa]
Length=581

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG Y++ +CF+ K ++    P  DV  AF +Y E  + + +EQL RFL E QG+ E  ++
Sbjct  5    MGRYKMGLCFSDKLRMNRGSPPPDVVTAFVEYTEGRNHLMAEQLCRFLVEVQGETEVPIS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I   RH I+
Sbjct  65   DAEKIIERITCARHHIT  81



>ref|XP_006401052.1| hypothetical protein EUTSA_v10013042mg [Eutrema salsugineum]
 gb|ESQ42505.1| hypothetical protein EUTSA_v10013042mg [Eutrema salsugineum]
Length=594

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLT--EEQGQKEAT  309
            MGSY++C+ FTRKF+VTE  P  DV++ F+KYA+  + MS EQL + +   E  G   ++
Sbjct  1    MGSYKMCLIFTRKFRVTEPGPVDDVRDVFEKYADGEAHMSPEQLQKLMAEEEGGGGGGSS  60

Query  310  LAEAEAIVXQILHKRHPIS  366
            L EAE IV ++L ++H I+
Sbjct  61   LEEAERIVDEVLRRKHHIA  79



>ref|XP_010920865.1| PREDICTED: phosphoinositide phospholipase C 2-like [Elaeis guineensis]
Length=588

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            M +YRVC CF R+F+    +P   VKE F+KY+ EG  M  EQL RFL E QG+ +A   
Sbjct  1    MTTYRVCFCFRRRFQPASNEPPERVKEVFRKYS-EGGVMGVEQLQRFLVEVQGEAQAIRE  59

Query  316  EAEAIVXQILHKRH  357
            +A+A++  +   +H
Sbjct  60   DAQAVIDGMREFKH  73



>ref|XP_010658272.1| PREDICTED: phosphoinositide phospholipase C 6 [Vitis vinifera]
 emb|CBI25478.3| unnamed protein product [Vitis vinifera]
Length=592

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V  CF+RKFK+   +P   VK  F KY+  G+ M   Q  RFL E QGQ+  T+A+A
Sbjct  5    NYKVFKCFSRKFKIGGVEPPPYVKLIFAKYSGGGTHMGPAQFRRFLAEVQGQEGCTVADA  64

Query  322  EAIVXQILHKRH  357
            E ++ ++  +RH
Sbjct  65   ERVMEEVARRRH  76



>gb|KHN36374.1| Phosphoinositide phospholipase C 6 [Glycine soja]
Length=556

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V  CF RKF VTE  P  DV++AF ++A+  S +S +QLLRFL + QG+ + T  ++
Sbjct  5    NYKVFSCFNRKFTVTEPGPPPDVQKAFSEFADGASSLSGDQLLRFLAKHQGEVDCTAVDS  64

Query  322  EAIVXQ  339
            E I+ Q
Sbjct  65   ERILQQ  70



>ref|XP_003616632.1| Phosphoinositide phospholipase C [Medicago truncatula]
 gb|AES99590.1| phosphoinositide-specific phospholipase C family protein [Medicago 
truncatula]
Length=607

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            Y+  + F +K+KVTE  P  D++E F ++A  GS MS+EQL RFL E QG++  TL + E
Sbjct  11   YKRVLFFIKKYKVTELVPPEDLREIFSEFAGGGSYMSTEQLHRFLVEHQGEENFTLLDTE  70

Query  325  AIVXQILHKR  354
             IV +IL  R
Sbjct  71   KIVDKILQLR  80



>ref|XP_010031224.1| PREDICTED: phosphoinositide phospholipase C 6 [Eucalyptus grandis]
 gb|KCW50480.1| hypothetical protein EUGRSUZ_J00209 [Eucalyptus grandis]
Length=599

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 50/85 (59%), Gaps = 13/85 (15%)
 Frame = +1

Query  139  GSYRVCMC--FTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQ-----  297
            GSY   M   F RKFK+TE +P  DVKEAF ++++ G QM  +QL RFL E+QG+     
Sbjct  7    GSYNYTMFKYFNRKFKITEIEPPQDVKEAFLRFSDGGPQMGKDQLRRFLVEQQGEPGAAD  66

Query  298  ------KEATLAEAEAIVXQILHKR  354
                    A  +EAE +V Q+LH +
Sbjct  67   ADAAAAAAAAASEAERVVEQVLHTK  91



>gb|KDP46487.1| hypothetical protein JCGZ_08459 [Jatropha curcas]
Length=571

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  EAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAEAIVXQILHKRHPIS  366
            E  P +DVK+AF KY E  + M++EQL RFL E QG   A++AEAE IV Q+L KRH I+
Sbjct  2    ETGPPSDVKKAFLKYTEGNAYMTAEQLQRFLVEVQGDVGASVAEAELIVDQVLQKRHHIT  61



>ref|XP_003538468.2| PREDICTED: phosphoinositide phospholipase C 6-like [Glycine max]
Length=610

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V  CF RKF VTE  P  DV+ AF ++A   S +S + +LRFL E QG  + T A++
Sbjct  59   NYKVFSCFNRKFTVTEPGPPPDVERAFSEFAAGASSLSGDHILRFLAEHQGDVDCTAADS  118

Query  322  EAIVXQ  339
            E ++ Q
Sbjct  119  ERMLQQ  124



>ref|XP_011035945.1| PREDICTED: phosphoinositide phospholipase C 2-like [Populus euphratica]
Length=588

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC+CF+R+FK+  A+   +++  F +Y+E G  M+   L RFL E Q Q++ATL EA
Sbjct  5    TYRVCLCFSRRFKLAVAEAPEEIRALFNQYSENGI-MTDNHLHRFLIEVQKQEKATLEEA  63

Query  322  EAIVXQILH  348
            +AI+  + H
Sbjct  64   QAIIESLKH  72



>ref|NP_200677.2| phosphoinositide phospholipase C 5 [Arabidopsis thaliana]
 sp|Q944C2.2|PLCD5_ARATH RecName: Full=Phosphoinositide phospholipase C 5; AltName: Full=Phosphoinositide 
phospholipase PLC5; Short=AtPLC5; Short=AtPLCx; 
Short=PI-PLC5 [Arabidopsis thaliana]
 gb|AAL30748.2|AF434167_1 phosphoinositide-specific phospholipase C [Arabidopsis thaliana]
 gb|AAL32759.1| phosphoinositide-specific phospholipase C-line [Arabidopsis thaliana]
 gb|AAQ56842.1| At5g58690 [Arabidopsis thaliana]
 gb|AED97085.1| phosphoinositide phospholipase C 5 [Arabidopsis thaliana]
Length=578

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY++ +C + K ++    P  DV  AF +Y E  S M++EQL RFL E Q + E  ++
Sbjct  5    MGSYKMGLCCSDKLRMNRGAPPQDVVTAFVEYTEGRSHMTAEQLCRFLVEVQDETEVLVS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I  +RH I+
Sbjct  65   DAEKIIERITCERHHIT  81



>ref|XP_011077556.1| PREDICTED: phosphoinositide phospholipase C 2-like [Sesamum indicum]
Length=593

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YR+C CF R+F+V EA+  AD+K  F+ Y+E G  M  E L RFL E QG+ + T  EA
Sbjct  10   TYRICFCFRRRFRVKEAEVPADIKTLFQNYSENG-LMDVEHLYRFLKEVQGEDKLTREEA  68

Query  322  EAIVXQILHK  351
            E ++   L++
Sbjct  69   ETVMETFLNQ  78



>gb|KHN20847.1| Phosphoinositide phospholipase C 6 [Glycine soja]
Length=599

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            Y+  + F RKFKVTE     D++EAF K+   GS MS+++L RFL E QG+++ TL ++E
Sbjct  7    YKSFLFFIRKFKVTEPVSPQDLEEAFSKFTGGGSHMSADELHRFLVEHQGEEDYTLLDSE  66

Query  325  AIVXQILHKR  354
             +V ++L +R
Sbjct  67   KVVEKVLKER  76



>ref|XP_009772725.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana sylvestris]
Length=588

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  ADVK  F +Y++ G  M++E L RFL E Q ++ A+L +A
Sbjct  5    TYRVCFCFRRRFRVVAAEAPADVKNLFNRYSDNGV-MNAENLQRFLIEVQKEENASLEDA  63

Query  322  EAI--------VXQILHKR  354
            + I        +  I H+R
Sbjct  64   QGIMNNLHDLKILNIFHRR  82



>ref|XP_002525652.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF36770.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=578

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  EAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAEAIVXQILHKRHPIS  366
            E  P +DVKE+F KY+E  S M++EQL RFL E QG   A+++EAE I+ Q+L KRH ++
Sbjct  2    EIGPPSDVKESFMKYSEGRSHMTAEQLQRFLVEVQGDNAASISEAELILDQVLQKRHHMT  61



>gb|AAF33824.1|AF223573_1 phospholipase C2 [Nicotiana tabacum]
Length=605

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  ADVK  F KY++ G  M++E L RFL E Q ++ +++ +A
Sbjct  5    TYRVCFCFRRRFRVVAAEAPADVKNLFNKYSDNGV-MNAENLQRFLIEVQKEENSSIEDA  63

Query  322  EAI--------VXQILHKR  354
            + I        +  I H+R
Sbjct  64   QGIMNNLHDLKILNIFHRR  82



>ref|XP_007163545.1| hypothetical protein PHAVU_001G243200g [Phaseolus vulgaris]
 gb|ESW35539.1| hypothetical protein PHAVU_001G243200g [Phaseolus vulgaris]
Length=549

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V  CF RKF +TE +P  DV++AF +++   S MS++ LLRFL E QG+ + T +++
Sbjct  5    NYKVFSCFNRKFTLTEPEPLPDVQKAFSEFSAGASSMSADHLLRFLAEHQGEVDCTASDS  64

Query  322  EAIVXQ  339
              I+ Q
Sbjct  65   NQILQQ  70



>ref|XP_007163544.1| hypothetical protein PHAVU_001G243200g [Phaseolus vulgaris]
 gb|ESW35538.1| hypothetical protein PHAVU_001G243200g [Phaseolus vulgaris]
Length=550

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V  CF RKF +TE +P  DV++AF +++   S MS++ LLRFL E QG+ + T +++
Sbjct  5    NYKVFSCFNRKFTLTEPEPLPDVQKAFSEFSAGASSMSADHLLRFLAEHQGEVDCTASDS  64

Query  322  EAIVXQ  339
              I+ Q
Sbjct  65   NQILQQ  70



>ref|XP_009772724.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana sylvestris]
Length=589

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  ADVK  F +Y++ G  M++E L RFL E Q ++ A+L +A
Sbjct  5    TYRVCFCFRRRFRVVAAEAPADVKNLFNRYSDNGV-MNAENLQRFLIEVQKEENASLEDA  63

Query  322  EAI--------VXQILHKR  354
            + I        +  I H+R
Sbjct  64   QGIMNNLHDLKILNIFHRR  82



>gb|AAF33823.1|AF223351_1 phospholipase C1 [Nicotiana tabacum]
Length=586

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  ADVK  F +Y++ G  M++E L RFL E Q ++ A+L +A
Sbjct  5    TYRVCFCFRRRFRVVAAEAPADVKNLFNRYSDNGV-MNAENLQRFLIEVQKEENASLEDA  63

Query  322  EAI--------VXQILHKR  354
            + I        +  I H+R
Sbjct  64   QGIMNNLHDLKILNIFHRR  82



>dbj|BAA97337.1| phosphoinositide-specific phospholipase C-line [Arabidopsis thaliana]
Length=909

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MGSY++ +C + K ++    P  DV  AF +Y E  S M++EQL RFL E Q + E  ++
Sbjct  5    MGSYKMGLCCSDKLRMNRGAPPQDVVTAFVEYTEGRSHMTAEQLCRFLVEVQDETEVLVS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I  +RH I+
Sbjct  65   DAEKIIERITCERHHIT  81



>ref|XP_010253735.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nelumbo nucifera]
Length=586

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK + A+   ++K+ F  Y+E G  M++E L +FL E QG+K AT  +A
Sbjct  6    TYRVCFCFRRRFKQSAAEAPKEIKDLFNAYSENGI-MTAEHLCKFLVEIQGEKNATTEDA  64

Query  322  EAIVXQILHKRH  357
            E I+  +   +H
Sbjct  65   ENIIDSLRELKH  76



>dbj|BAO02533.1| predicted phospholipase C ortholog [Nicotiana alata]
Length=588

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  ADVK  F +Y++ G  M++E L RFL E Q ++ A+L +A
Sbjct  5    TYRVCFCFRRRFRVVAAEAPADVKNLFNRYSDNGI-MNAENLQRFLIEVQKEENASLEDA  63

Query  322  EAI--------VXQILHKR  354
            + I        +  I H+R
Sbjct  64   QGIMNNLHDLKILNIFHRR  82



>ref|XP_002316212.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEF02383.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=587

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC+CF+R+FK+  A+   +++  F +Y++ G  M+   L RFL E Q Q++ATL EA
Sbjct  5    TYRVCLCFSRRFKLAVAEAPEEIRALFNQYSDNGI-MTDNHLHRFLIEVQKQEKATLEEA  63

Query  322  EAIVXQILH  348
            +AI+  + H
Sbjct  64   QAIIESLKH  72



>ref|XP_010253733.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nelumbo nucifera]
Length=587

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK + A+   ++K+ F  Y+E G  M++E L +FL E QG+K AT  +A
Sbjct  6    TYRVCFCFRRRFKQSAAEAPKEIKDLFNAYSENGI-MTAEHLCKFLVEIQGEKNATTEDA  64

Query  322  EAIVXQILHKRH  357
            E I+  +   +H
Sbjct  65   ENIIDSLRELKH  76



>gb|KCW50479.1| hypothetical protein EUGRSUZ_J00208 [Eucalyptus grandis]
Length=417

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK+  A+P  +VK  F +Y+E G+ M+ + L RFL E Q ++ AT  +A
Sbjct  5    TYRVCFCFRRRFKLHVAEPPGEVKRLFVQYSENGT-MTVDHLHRFLVEVQKEERATREDA  63

Query  322  EAIVXQILHKRH  357
            +AIV  +   +H
Sbjct  64   QAIVDSLRELKH  75



>ref|XP_009605158.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Nicotiana tomentosiformis]
Length=588

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  ADVK  F KY++ G  M++E L RFL E Q ++ +++ +A
Sbjct  5    TYRVCFCFRRRFRVVAAEAPADVKNLFNKYSDNGV-MNAENLQRFLIEVQKEENSSIEDA  63

Query  322  EAI--------VXQILHKR  354
            + I        +  I H+R
Sbjct  64   QGIMNNLHDLKILNIFHRR  82



>gb|ABJ99758.1| phospholipase C [Nicotiana tabacum]
Length=588

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  ADVK  F KY++ G  M++E L RFL E Q ++ +++ +A
Sbjct  5    TYRVCFCFRRRFRVVAAEAPADVKNLFNKYSDNGV-MNAENLQRFLIEVQKEENSSIEDA  63

Query  322  EAI--------VXQILHKR  354
            + I        +  I H+R
Sbjct  64   QGIMNNLHDLKILNIFHRR  82



>gb|KHN34718.1| Phosphoinositide phospholipase C 6 [Glycine soja]
Length=540

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V  CF RKF VTE  P  DV+ AF ++A   S +S + +LRFL E QG  + T A++
Sbjct  5    NYKVFSCFNRKFTVTEPGPPPDVERAFSEFAAGASSLSGDHILRFLAEHQGDVDCTAADS  64

Query  322  EAIVXQ  339
            E I+ Q
Sbjct  65   ERILQQ  70



>ref|XP_010031217.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X2 
[Eucalyptus grandis]
 gb|KCW50477.1| hypothetical protein EUGRSUZ_J00208 [Eucalyptus grandis]
Length=593

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK+  A+P  +VK  F +Y+E G+ M+ + L RFL E Q ++ AT  +A
Sbjct  5    TYRVCFCFRRRFKLHVAEPPGEVKRLFVQYSENGT-MTVDHLHRFLVEVQKEERATREDA  63

Query  322  EAIVXQILHKRH  357
            +AIV  +   +H
Sbjct  64   QAIVDSLRELKH  75



>ref|XP_010031216.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Eucalyptus grandis]
Length=601

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK+  A+P  +VK  F +Y+E G+ M+ + L RFL E Q ++ AT  +A
Sbjct  5    TYRVCFCFRRRFKLHVAEPPGEVKRLFVQYSENGT-MTVDHLHRFLVEVQKEERATREDA  63

Query  322  EAIVXQILHKRH  357
            +AIV  +   +H
Sbjct  64   QAIVDSLRELKH  75



>gb|KCW50478.1| hypothetical protein EUGRSUZ_J00208 [Eucalyptus grandis]
Length=593

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK+  A+P  +VK  F +Y+E G+ M+ + L RFL E Q ++ AT  +A
Sbjct  5    TYRVCFCFRRRFKLHVAEPPGEVKRLFVQYSENGT-MTVDHLHRFLVEVQKEERATREDA  63

Query  322  EAIVXQILHKRH  357
            +AIV  +   +H
Sbjct  64   QAIVDSLRELKH  75



>ref|XP_011042811.1| PREDICTED: phosphoinositide phospholipase C 2-like [Populus euphratica]
Length=586

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK+ EA+   ++K  F  Y+E G  M+++Q+ RFL E Q Q++AT  EA
Sbjct  5    TYRVCFCFRRRFKLAEAEVPDEIKALFDLYSENGI-MTADQIHRFLIEVQKQEKATFEEA  63

Query  322  EAIVXQILH  348
            ++IV  + H
Sbjct  64   QSIVESLKH  72



>ref|XP_011046045.1| PREDICTED: phosphoinositide phospholipase C 2-like [Populus euphratica]
Length=586

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK+ EA+   ++K  F  Y+E G  M+++Q+ RFL E Q Q++AT  EA
Sbjct  5    TYRVCFCFRRRFKLAEAEVPDEIKALFDLYSENGI-MTADQIHRFLIEVQKQEKATFEEA  63

Query  322  EAIVXQILH  348
            ++IV  + H
Sbjct  64   QSIVESLKH  72



>ref|XP_007141768.1| hypothetical protein PHAVU_008G224200g [Phaseolus vulgaris]
 gb|ESW13762.1| hypothetical protein PHAVU_008G224200g [Phaseolus vulgaris]
Length=604

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            Y+  + F RKFKV E  P  D++EAF K+    S MS EQL RF+ E QG++  TL+++E
Sbjct  11   YKSLLFFIRKFKVIEPDPPQDLEEAFSKFTGGESHMSVEQLHRFMVEHQGEEHYTLSDSE  70

Query  325  AIVXQILHKR  354
             +  ++L +R
Sbjct  71   KVFEKVLQER  80



>ref|XP_009605157.1| PREDICTED: phosphoinositide phospholipase C 2-like isoform X1 
[Nicotiana tomentosiformis]
Length=589

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  ADVK  F KY++ G  M++E L RFL E Q ++ +++ +A
Sbjct  5    TYRVCFCFRRRFRVVAAEAPADVKNLFNKYSDNGV-MNAENLQRFLIEVQKEENSSIEDA  63

Query  322  EAI--------VXQILHKR  354
            + I        +  I H+R
Sbjct  64   QGIMNNLHDLKILNIFHRR  82



>ref|XP_007141769.1| hypothetical protein PHAVU_008G224200g [Phaseolus vulgaris]
 gb|ESW13763.1| hypothetical protein PHAVU_008G224200g [Phaseolus vulgaris]
Length=605

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            Y+  + F RKFKV E  P  D++EAF K+    S MS EQL RF+ E QG++  TL+++E
Sbjct  11   YKSLLFFIRKFKVIEPDPPQDLEEAFSKFTGGESHMSVEQLHRFMVEHQGEEHYTLSDSE  70

Query  325  AIVXQILHKR  354
             +  ++L +R
Sbjct  71   KVFEKVLQER  80



>ref|XP_004490993.1| PREDICTED: phosphoinositide phospholipase C 6-like [Cicer arietinum]
Length=596

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y++  CF RKF ++E  P +DVKE F ++A+ GS MS++QL RFL E Q + + T  ++
Sbjct  7    NYKMFKCFNRKFAISEQAPPSDVKETFSEFAKGGSSMSADQLRRFLLEYQREPDCTEEDS  66

Query  322  EAIVXQILHKR  354
            + IV   L  R
Sbjct  67   KRIVENALQSR  77



>gb|ABC50164.1| phospholipase C [Petunia integrifolia subsp. inflata]
Length=588

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 8/79 (10%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  A+  AD+K  F +YA+    M+ E L RFL E Q ++ A+L +A
Sbjct  6    TYRVCFCFRRRFRVVAAEAPADIKNLFNEYADSNGVMNVENLHRFLIEVQKEENASLEDA  65

Query  322  EAI--------VXQILHKR  354
              I        +  I H+R
Sbjct  66   SNIMNNLHDLKILNIFHRR  84



>ref|XP_003552358.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X1 
[Glycine max]
Length=556

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V  CF RKF VTE  P  DV++AF ++A+  S +S + LLRFL + QG+ + T  ++
Sbjct  5    NYKVFSCFNRKFTVTEPGPPPDVQKAFSEFADGASSLSGDHLLRFLAKHQGEVDCTAVDS  64

Query  322  EAIVXQ  339
            E I+ Q
Sbjct  65   ERILQQ  70



>ref|XP_006601952.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X2 
[Glycine max]
Length=557

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V  CF RKF VTE  P  DV++AF ++A+  S +S + LLRFL + QG+ + T  ++
Sbjct  5    NYKVFSCFNRKFTVTEPGPPPDVQKAFSEFADGASSLSGDHLLRFLAKHQGEVDCTAVDS  64

Query  322  EAIVXQ  339
            E I+ Q
Sbjct  65   ERILQQ  70



>emb|CDP14020.1| unnamed protein product [Coffea canephora]
Length=589

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC C  R+F++  A+  A++K  F  Y+E G+ +S + L RFL E Q Q+ ATL +A
Sbjct  5    TYRVCFCCRRRFRLASAEAPAEIKSLFDSYSENGT-ISVDNLHRFLVEVQKQENATLEDA  63

Query  322  EAIVXQILHKRH  357
            EAI+  +   +H
Sbjct  64   EAILNSLHEPKH  75



>ref|XP_006280227.1| hypothetical protein CARUB_v10026144mg [Capsella rubella]
 gb|EOA13125.1| hypothetical protein CARUB_v10026144mg [Capsella rubella]
Length=581

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            MG Y++ +C   K ++    P  DV   F +Y E  + +++EQL RFL E Q + E +L+
Sbjct  5    MGRYKMGLCCNDKLRINRGAPPPDVVTTFVEYTEGRNHLTAEQLCRFLVEAQDETEVSLS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I   RH I+
Sbjct  65   DAEKIIERITCARHHIT  81



>ref|XP_010689668.1| PREDICTED: phosphoinositide phospholipase C 6 [Beta vulgaris 
subsp. vulgaris]
Length=582

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y++ MCF RKFK+ + QP  DV EAF  YAE+G+ M+  QL RF+ E QG+ + +  + 
Sbjct  9    NYKMFMCFNRKFKINDTQPPFDVVEAFTIYAEKGTHMNQTQLHRFMVEFQGE-DMSENDT  67

Query  322  EAIVXQILHKRHPIS  366
              ++  IL +R  +S
Sbjct  68   VRVLDDILRRRRHLS  82



>ref|XP_008793309.1| PREDICTED: phosphoinositide phospholipase C 2-like [Phoenix dactylifera]
Length=597

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            M +YRVC CF R+F+    +P   VKE F++Y+ EG  M +EQL RFL E QG+ + T  
Sbjct  1    MTTYRVCFCFQRRFRPATNEPPEAVKEVFRRYS-EGGVMGAEQLQRFLVEVQGEAKVTRE  59

Query  316  EAEAIVXQILHKRH  357
             A+ ++  +   +H
Sbjct  60   AAQDVIDGMRKLKH  73



>ref|XP_002269949.1| PREDICTED: phosphoinositide phospholipase C 2 [Vitis vinifera]
 emb|CAN64084.1| hypothetical protein VITISV_006935 [Vitis vinifera]
Length=593

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F++T ++   ++KE F +Y+E G  MS + L RFL E Q +++AT+ +A
Sbjct  5    TYRVCFCFRRRFRLTVSEAPQEIKELFDRYSENG-MMSIDHLQRFLIEVQQEEKATVEDA  63

Query  322  EAIVXQILHKRH  357
            +AI+  +   +H
Sbjct  64   QAILDSLHEFKH  75



>gb|KHG08567.1| Phosphoinositide phospholipase C 6 -like protein [Gossypium arboreum]
Length=577

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGS-QMSSEQLLRFLTEEQGQKEAT  309
            G  +Y++   F RKFK+ E +P +DV +AF  + ++GS  M++EQL RF++  Q +    
Sbjct  17   GSYNYKMFSFFNRKFKINEVEPPSDVNKAFSLFTDDGSTHMTAEQLRRFMSVHQCEVSTR  76

Query  310  LAEAEAIVXQILHKRHPIS  366
            L +A+ I+ Q++++RH I+
Sbjct  77   LEDAQNIIEQVVNRRHHIT  95



>emb|CDY07057.1| BnaA04g22580D [Brassica napus]
Length=610

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/89 (34%), Positives = 50/89 (56%), Gaps = 11/89 (12%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQ-----------MSSEQLLRFL  279
            G  +Y++  CF RKFK+ E QP  DV++AF K++  G             M +EQL  FL
Sbjct  13   GSYNYKMFKCFNRKFKINEVQPTNDVRDAFCKFSVNGGGGESDGDRSSGVMGAEQLCSFL  72

Query  280  TEEQGQKEATLAEAEAIVXQILHKRHPIS  366
             + Q     T+AEA+ ++ +++ +RH ++
Sbjct  73   DDHQVHSVTTVAEAQRLIDEVIRRRHHVT  101



>gb|ABM90640.1| phospholipase C [Torenia fournieri]
Length=601

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YR+C C  R+FK  EA+   ++K  F+ Y+E GS MS E L RFL E QG++  T  E 
Sbjct  6    TYRICFCIRRRFKHKEAEAPEEIKLLFENYSENGS-MSVENLHRFLQEVQGEENITAEET  64

Query  322  EAIVXQILHKRH  357
            E ++   LH+ H
Sbjct  65   ENLMESFLHEEH  76



>gb|KJB67581.1| hypothetical protein B456_010G198000 [Gossypium raimondii]
Length=608

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGS-QMSSEQLLRFLTEEQGQKEAT  309
            G  +Y++   F RKFK+ E +P +DV +AF  + ++GS  M++EQL RF++  Q +    
Sbjct  36   GSYNYKMFSFFNRKFKINEVEPPSDVNKAFSLFTDDGSTHMTAEQLRRFMSVHQCEVSTR  95

Query  310  LAEAEAIVXQILHKRHPIS  366
            L +A+ I+ Q++++RH I+
Sbjct  96   LEDAQNIIEQVVNRRHHIT  114



>gb|KJB67580.1| hypothetical protein B456_010G198000 [Gossypium raimondii]
Length=596

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGS-QMSSEQLLRFLTEEQGQKEAT  309
            G  +Y++   F RKFK+ E +P +DV +AF  + ++GS  M++EQL RF++  Q +    
Sbjct  36   GSYNYKMFSFFNRKFKINEVEPPSDVNKAFSLFTDDGSTHMTAEQLRRFMSVHQCEVSTR  95

Query  310  LAEAEAIVXQILHKRHPIS  366
            L +A+ I+ Q++++RH I+
Sbjct  96   LEDAQNIIEQVVNRRHHIT  114



>ref|XP_006401053.1| hypothetical protein EUTSA_v10013061mg [Eutrema salsugineum]
 gb|ESQ42506.1| hypothetical protein EUTSA_v10013061mg [Eutrema salsugineum]
Length=587

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +1

Query  136  MGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLA  315
            +G Y++ +CF+ K ++    P  DV  AF +Y E  + M++EQL RFL E Q + E  ++
Sbjct  5    LGRYKMGLCFSDKLRMNRGAPPPDVVTAFVEYTEGRNYMTAEQLCRFLAEVQKETEVFVS  64

Query  316  EAEAIVXQILHKRHPIS  366
            +AE I+ +I   RH I+
Sbjct  65   DAEKIIERITSARHHIT  81



>gb|KDP46489.1| hypothetical protein JCGZ_08461 [Jatropha curcas]
Length=538

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  187  EAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAEAIVXQILHKRHPIS  366
            E  P +DVK+AF KY E  + M++EQL RFL E QG   A++AEAE IV Q+L KR  I+
Sbjct  2    ETGPPSDVKKAFLKYTEGNAYMTAEQLQRFLVEVQGDVGASVAEAELIVDQVLQKRRHIT  61



>ref|XP_002533650.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
 gb|EEF28738.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative 
[Ricinus communis]
Length=594

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F++  A+   ++K  F +Y++    MS +QL RFL E Q Q  AT  +A
Sbjct  5    TYRVCFCFRRRFRLAVAEAPQEIKSLFDQYSDNNGLMSIDQLRRFLVEIQKQDNATTEDA  64

Query  322  EAIVXQILHKRH  357
            +AI   +   +H
Sbjct  65   QAIFNNLHELKH  76



>ref|XP_010534598.1| PREDICTED: phosphoinositide phospholipase C 6 [Tarenaya hassleriana]
Length=604

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYAE----EGSQMSSEQLLRFLTEEQGQK  300
            G  +Y++  CF RKFK+ E +P  DV++   ++A     +   + +EQL RFL E QG+K
Sbjct  14   GSYNYKMFKCFNRKFKINEVEPTDDVRQLSTRFASGDGGDSGVIGAEQLCRFLEEHQGEK  73

Query  301  EATLAEAEAIVXQILHKRH  357
              T  EA+ I+  ++ +RH
Sbjct  74   GTTATEAQHIIDDVIRRRH  92



>gb|KHG11557.1| Phosphoinositide phospholipase C 2 -like protein [Gossypium arboreum]
Length=570

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S++VC+C+ R FK    +P  D+K AF  ++  G  M+ + LLRFL + QGQK AT  +A
Sbjct  5    SFKVCLCWRRVFKTRVVEPPLDIKNAFYSFSPSG-MMTVDDLLRFLIDHQGQKNATKEDA  63

Query  322  EAIVXQILH  348
            +AI   + H
Sbjct  64   QAIFDSLKH  72



>emb|CAN62452.1| hypothetical protein VITISV_032539 [Vitis vinifera]
Length=592

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R FK+  A+  +++K  F  Y+EEG  MS EQL +FL E QG+ EA++ + 
Sbjct  5    TYRVCFCFRRGFKLKVAEAPSEIKALFNDYSEEGV-MSLEQLQKFLIEVQGEDEASMEDV  63

Query  322  EAIVXQILHKRH  357
            + I+  +   +H
Sbjct  64   QGIMDSLHEFKH  75



>ref|XP_009347255.1| PREDICTED: phosphoinositide phospholipase C 2-like [Pyrus x bretschneideri]
Length=554

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S+ VC CF RKF++  A+P  D+K  F+K+AE G+ M+ ++L  FL E QG+  AT  +A
Sbjct  6    SFDVCFCFQRKFRLRMAEPPEDIKNLFEKFAESGT-MTIDELQCFLIEFQGESSATKEDA  64

Query  322  EAIVXQILH  348
            + I   + H
Sbjct  65   QTIFNSLKH  73



>ref|XP_009142132.1| PREDICTED: phosphoinositide phospholipase C 6-like [Brassica 
rapa]
Length=600

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 52/88 (59%), Gaps = 10/88 (11%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYA------EEGSQ----MSSEQLLRFLT  282
            G  +Y++  CF RKFK+ E QP  DV++AF K++       +G +    M +EQL  FL 
Sbjct  13   GSYNYKMFKCFNRKFKINEVQPTNDVRDAFCKFSVGSGGESDGDRSSGVMGAEQLCSFLD  72

Query  283  EEQGQKEATLAEAEAIVXQILHKRHPIS  366
            + Q     T+AEA+ ++ +++ +RH ++
Sbjct  73   DHQVHSVTTVAEAQRLIDEVIRRRHHVT  100



>gb|KDP44771.1| hypothetical protein JCGZ_01271 [Jatropha curcas]
Length=591

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK+  A+   ++K  F +Y+E G  MS   L RFL E Q Q +AT+ EA
Sbjct  5    TYRVCFCFRRRFKLAVAEAPEEIKALFDQYSENGI-MSVHNLHRFLVEIQKQDKATIEEA  63

Query  322  EAIVXQILHKRH  357
            +AI   +   +H
Sbjct  64   QAIFDHLNQFKH  75



>ref|XP_007016093.1| Phospholipase C 2, putative [Theobroma cacao]
 gb|EOY33712.1| Phospholipase C 2, putative [Theobroma cacao]
Length=585

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +++VC+C+ R FK    +P  DVK  F +Y+  G  M+ ++LLRFL E QG+K AT  +A
Sbjct  5    NFKVCLCWRRIFKTRVVEPPLDVKNVFYRYSP-GGMMTIDELLRFLIEHQGEKNATKDDA  63

Query  322  EAIVXQILH  348
            +AI   + H
Sbjct  64   QAIFDSLKH  72



>emb|CBI30388.3| unnamed protein product [Vitis vinifera]
Length=581

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R FK+  A+  +++K  F  Y+E+G  MS EQL +FL E QG+ EA++ + 
Sbjct  5    TYRVCFCFRRGFKLKVAEAPSEIKALFNDYSEQGV-MSLEQLQKFLIEVQGEDEASMEDV  63

Query  322  EAIVXQILHKRH  357
            + I+  +   +H
Sbjct  64   QGIMDSLHEFKH  75



>gb|KDP46488.1| hypothetical protein JCGZ_08460 [Jatropha curcas]
Length=583

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S RVC CF R  K+   +P +DVK  F KY++ G+ M+ E LLRFL E QG+  AT  +A
Sbjct  5    SSRVCFCFRRILKLRLLEPPSDVKILFNKYSQNGN-MALEDLLRFLIEVQGEDNATKEDA  63

Query  322  EAIVXQILH  348
            +AI   + H
Sbjct  64   QAIFNSLKH  72



>ref|XP_010446364.1| PREDICTED: phosphoinositide phospholipase C 3-like [Camelina 
sativa]
Length=571

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S++VC C +R FK    QP   +K  F+ Y+  G +MSSE+LLRF++E QG++ A L  A
Sbjct  4    SFKVCFCCSRNFKEKTRQPPVSIKRLFEAYSRNG-KMSSEELLRFVSEVQGERHAGLDYA  62

Query  322  EAIVXQILH  348
            + I   + H
Sbjct  63   QDIFHSVKH  71



>ref|XP_007008968.1| Phospholipase C 2 [Theobroma cacao]
 gb|EOY17778.1| Phospholipase C 2 [Theobroma cacao]
Length=586

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F++T ++    +K+ F++Y+E G  MS ++L RFL E Q +++AT+ +A
Sbjct  5    TYRVCFCFRRRFRLTVSEAPEGIKKLFEQYSENGI-MSLDRLQRFLVEVQKEEKATIEDA  63

Query  322  EAIVXQILH  348
            + I+  + H
Sbjct  64   QKIIDSVKH  72



>ref|XP_008384797.1| PREDICTED: phosphoinositide phospholipase C 2-like [Malus domestica]
Length=557

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S+ VC CF RKF++  A+P  D+K  F  YAE G+ M+ + L +FL E QG+  AT  +A
Sbjct  6    SFNVCFCFQRKFRLWMAEPPEDIKNLFDLYAENGT-MTIDGLQKFLIEFQGESSATKEDA  64

Query  322  EAIVXQILH  348
             AI   + H
Sbjct  65   HAIFNNLKH  73



>ref|XP_010541457.1| PREDICTED: phosphoinositide phospholipase C 1 isoform X3 [Tarenaya 
hassleriana]
Length=582

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            +RVC C +R FKV  ++P  D++  F++Y++ GS MS++ LLRF+ + QG+ +A L  A 
Sbjct  33   FRVCFCCSRSFKVRASEPPEDIQRLFREYSDNGS-MSADHLLRFVNQVQGEGQAGLDYAT  91

Query  325  AIVXQILH  348
             +  ++ H
Sbjct  92   EVFHRLKH  99



>emb|CDY22153.1| BnaC01g39480D [Brassica napus]
Length=581

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+ T ++   DVK  F+KY+E G  M+ + L RFL + Q Q +AT  +A
Sbjct  5    TYRVCFCFNRRFRYTASEAPRDVKTLFEKYSENGV-MTVDHLQRFLIDVQKQDKATKEDA  63

Query  322  EAIV---XQILHK  351
            ++I+     +LH+
Sbjct  64   QSIINAASSLLHR  76



>ref|XP_010541455.1| PREDICTED: phosphoinositide phospholipase C 1 isoform X1 [Tarenaya 
hassleriana]
Length=597

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            +RVC C +R FKV  ++P  D++  F++Y++ GS MS++ LLRF+ + QG+ +A L  A 
Sbjct  33   FRVCFCCSRSFKVRASEPPEDIQRLFREYSDNGS-MSADHLLRFVNQVQGEGQAGLDYAT  91

Query  325  AIVXQILH  348
             +  ++ H
Sbjct  92   EVFHRLKH  99



>ref|XP_006297293.1| hypothetical protein CARUB_v10013310mg [Capsella rubella]
 gb|EOA30191.1| hypothetical protein CARUB_v10013310mg [Capsella rubella]
Length=584

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+ T ++   ++K  F+KY+E G  M+ + LLRFL + Q Q +AT  +A
Sbjct  5    TYRVCFCFRRRFRYTASEAPREIKTIFEKYSENGV-MTVDHLLRFLIDVQKQDKATREDA  63

Query  322  EAIV---XQILHK  351
            ++I+     +LH+
Sbjct  64   QSIINSASSLLHR  76



>ref|XP_011460955.1| PREDICTED: phosphoinositide phospholipase C 2 [Fragaria vesca 
subsp. vesca]
Length=548

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S++VC CF R F++  A+P  D+K  F  YAE G+ +S + L  FL E QG+ EAT  +A
Sbjct  7    SFKVCFCFRRIFRLKVAEPPEDIKRMFNMYAENGT-ISLDDLHSFLVEFQGEGEATKEDA  65

Query  322  EAIVXQILH  348
            +AI   + H
Sbjct  66   QAIFNSLKH  74



>ref|XP_009123935.1| PREDICTED: phosphoinositide phospholipase C 2 [Brassica rapa]
Length=581

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+ T ++   DVK  F+KY+E G  M+ + L RFL + Q Q +AT  +A
Sbjct  5    TYRVCFCFNRRFRYTASEAPRDVKTLFEKYSENGV-MTVDHLQRFLIDVQKQDKATKEDA  63

Query  322  EAIV---XQILHK  351
            ++I+     +LH+
Sbjct  64   QSIINAASSLLHR  76



>ref|XP_006297294.1| hypothetical protein CARUB_v10013310mg [Capsella rubella]
 gb|EOA30192.1| hypothetical protein CARUB_v10013310mg [Capsella rubella]
Length=495

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+ T ++   ++K  F+KY+E G  M+ + LLRFL + Q Q +AT  +A
Sbjct  5    TYRVCFCFRRRFRYTASEAPREIKTIFEKYSENGV-MTVDHLLRFLIDVQKQDKATREDA  63

Query  322  EAIV---XQILHK  351
            ++I+     +LH+
Sbjct  64   QSIINSASSLLHR  76



>ref|XP_010654153.1| PREDICTED: phosphoinositide phospholipase C 2-like [Vitis vinifera]
Length=666

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R FK+  A+  +++K  F  Y+E+G  MS EQL +FL E QG+ EA++ + 
Sbjct  50   TYRVCFCFRRGFKLKVAEAPSEIKALFNDYSEQGV-MSLEQLQKFLIEVQGEDEASMEDV  108

Query  322  EAIVXQILHKRH  357
            + I+  +   +H
Sbjct  109  QGIMDSLHEFKH  120



>ref|XP_010541458.1| PREDICTED: phosphoinositide phospholipase C 1 isoform X4 [Tarenaya 
hassleriana]
Length=486

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            +RVC C +R FKV  ++P  D++  F++Y++ GS MS++ LLRF+ + QG+ +A L  A 
Sbjct  33   FRVCFCCSRSFKVRASEPPEDIQRLFREYSDNGS-MSADHLLRFVNQVQGEGQAGLDYAT  91

Query  325  AIVXQILH  348
             +  ++ H
Sbjct  92   EVFHRLKH  99



>ref|XP_007205014.1| hypothetical protein PRUPE_ppa003685mg [Prunus persica]
 gb|EMJ06213.1| hypothetical protein PRUPE_ppa003685mg [Prunus persica]
Length=556

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S++VC CF R F++  A+P  D+K  F +YAE G+ ++ + L  FL E QG+  AT  +A
Sbjct  6    SFKVCFCFKRIFRLKVAEPPEDIKNLFNQYAENGT-ITIDNLQNFLIEFQGEPNATKEDA  64

Query  322  EAIVXQILH  348
            +AI   + H
Sbjct  65   QAIFNSLRH  73



>ref|XP_009143251.1| PREDICTED: phosphoinositide phospholipase C 6 [Brassica rapa]
Length=615

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/94 (32%), Positives = 49/94 (52%), Gaps = 16/94 (17%)
 Frame = +1

Query  133  GMGSYRVCMCFTRKFKVTEAQPAADVKEAFKKYA----------------EEGSQMSSEQ  264
            G  +Y++  CF RKFK+ E QP  DV++AF ++A                     M +EQ
Sbjct  13   GSYNYKMFKCFNRKFKINEVQPTDDVRDAFCQFAVGCGGGGGDGDSSDGDASSGVMGAEQ  72

Query  265  LLRFLTEEQGQKEATLAEAEAIVXQILHKRHPIS  366
            L  FL + QG    T+AEA+ ++  ++ +RH ++
Sbjct  73   LCSFLDDHQGDSGTTVAEAQRLIDDVIRRRHHVT  106



>gb|AFW90632.1| phosphoinositide-specific phospholipase C [Solanum tuberosum]
Length=263

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+V   F R+F +  A+  AD+K  FK+Y+++   MS + L RFL E Q +K A+L  A
Sbjct  5    TYKVGFFFRRQFTMAAAEAPADIKNLFKRYSDDSGVMSVQNLHRFLIEIQKEKNASLDNA  64

Query  322  EAIVXQ  339
            EAI+  
Sbjct  65   EAIINN  70



>ref|XP_010541456.1| PREDICTED: phosphoinositide phospholipase C 1 isoform X2 [Tarenaya 
hassleriana]
Length=589

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            +RVC C +R FKV  ++P  D++  F++Y++ GS MS++ LLRF+ + QG+ +A L  A 
Sbjct  33   FRVCFCCSRSFKVRASEPPEDIQRLFREYSDNGS-MSADHLLRFVNQVQGEGQAGLDYAT  91

Query  325  AIVXQILH  348
             +  ++ H
Sbjct  92   EVFHRLKH  99



>gb|EYU26667.1| hypothetical protein MIMGU_mgv1a003464mg [Erythranthe guttata]
Length=583

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            SYRVC CF+RKF + EA+  AD+K  F+ Y+E G  M+ E   +FL E QG  + T  EA
Sbjct  5    SYRVCCCFSRKFNLKEAEVPADIKALFENYSENG-LMNIEHFHKFLIEVQGDDKLTREEA  63

Query  322  EAIV  333
            E ++
Sbjct  64   ETVM  67



>gb|KJB74323.1| hypothetical protein B456_011G288000 [Gossypium raimondii]
Length=558

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            SYRVC CF R+FK+T AQ   DVK  F+ Y+E G  M+++ L +FL E Q + E T  +A
Sbjct  5    SYRVCFCFRRRFKMTVAQAPEDVKNLFEMYSENG-LMNADGLHKFLVEYQKEDETTTDDA  63

Query  322  EAIV  333
            + I+
Sbjct  64   QKII  67



>ref|XP_002311223.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
 gb|EEE88590.1| phosphoinositide-specific phospholipase C family protein [Populus 
trichocarpa]
Length=590

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK+  A+   ++K  F  Y+E G  M+++ + RFL E Q Q++AT  EA
Sbjct  5    TYRVCFCFRRRFKLAVAEVPDEIKALFDLYSENGI-MTADHIHRFLIEVQKQEKATFEEA  63

Query  322  EAIVXQILH  348
            ++IV  + H
Sbjct  64   QSIVESLKH  72



>ref|XP_010689655.1| PREDICTED: phosphoinositide phospholipase C 2 [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+VC C  R+FK+  ++   ++K  F KY+E G  MS+  L RFL EEQ + +AT+ +A
Sbjct  5    TYKVCFCCRRRFKLAVSEAPQEIKTLFGKYSENGV-MSATHLHRFLVEEQKEIKATVQDA  63

Query  322  EAIVXQILH  348
            +AI+  I H
Sbjct  64   QAIIDNIRH  72



>gb|KJB55725.1| hypothetical protein B456_009G091600 [Gossypium raimondii]
Length=562

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +++VC+C+ R FK    +P  DVK AF  +++ G+ M+ + LL FL E QG+  AT  +A
Sbjct  5    NFKVCLCWRRIFKTRVVEPPPDVKNAFNHFSQSGT-MTVDDLLTFLIEHQGENNATKEDA  63

Query  322  EAIVXQILH  348
            +AI   + H
Sbjct  64   QAIFDSLKH  72



>ref|XP_004490992.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X3 
[Cicer arietinum]
Length=520

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            Y+  + F +K+KVTE  P  ++KE F K+   G  MS+EQL +FL E Q +   TL+++E
Sbjct  11   YKSFLFFIKKYKVTELVPPQELKEVFSKFTGGGLYMSTEQLYQFLVEHQSEDNLTLSDSE  70

Query  325  AIVXQILHKR  354
             IV ++L  R
Sbjct  71   KIVDKVLLLR  80



>emb|CDY70294.1| BnaCnng67650D [Brassica napus]
Length=546

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+VC CF R+++ T +   +++K  F  Y+++G  M+ + LLRFLT+ Q Q +AT  EA
Sbjct  5    TYKVCFCFRRRYRHTASVAPSEIKTIFDNYSDKG-LMTVDHLLRFLTDVQKQDQATREEA  63

Query  322  EAIV---XQILHK  351
            +AIV     +LH+
Sbjct  64   QAIVNASSSLLHR  76



>ref|NP_001234203.1| PI-phospholipase C PLC1 [Solanum lycopersicum]
 gb|ABW81003.1| PI-phospholipase C PLC1 [Solanum lycopersicum]
Length=601

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YR+C CF RKFK+ EA+   ++KE F +++E G  M+SE L +FL + QG++  T  EA
Sbjct  5    TYRIC-CFQRKFKLKEAEAPDEIKELFGRFSENGI-MTSEHLCKFLKDVQGEENVTKEEA  62

Query  322  EAIVXQILHKRH  357
            E ++   L   H
Sbjct  63   ETVMESALKLVH  74



>ref|XP_009344939.1| PREDICTED: phosphoinositide phospholipase C 2-like [Pyrus x bretschneideri]
Length=592

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+FK+   +   ++K  F +Y+E G  M+++   RFLTE Q ++ AT  EA
Sbjct  5    TYRVCFCFQRRFKLAVKEAPPEIKALFDQYSENGI-MTADHFHRFLTEVQKEENATKEEA  63

Query  322  EAIVXQIL  345
            +A++ Q L
Sbjct  64   QALIEQSL  71



>gb|AIG51130.1| phospholipase C [Gossypium hirsutum]
Length=578

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YRVC CF R+F+V  ++   ++K  F++Y+E G  MS + L RFL E Q + +AT  +A
Sbjct  5    TYRVCFCFRRRFRVAVSEAPEEIKRVFEQYSENG-MMSIDALHRFLVEFQKEDKATREDA  63

Query  322  EAIVXQILH  348
            + IV  + H
Sbjct  64   QKIVDSVKH  72



>ref|XP_007218974.1| hypothetical protein PRUPE_ppa003890mg [Prunus persica]
 gb|EMJ20173.1| hypothetical protein PRUPE_ppa003890mg [Prunus persica]
Length=542

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQ--KEATLA  315
            +Y++  CF RKFK +E  P  DVK  F K+A++G  MS +Q   FL E QG+     TL+
Sbjct  7    NYKMFKCFNRKFKASEGGPPPDVKAIFSKFAQDGDLMSVDQFRSFLVEHQGEPADAVTLS  66

Query  316  EAEAIVXQILHKRHP  360
            +A  I+ Q   + HP
Sbjct  67   DAHGIL-QEFSRVHP  80



>ref|XP_009116286.1| PREDICTED: phosphoinositide phospholipase C 7 [Brassica rapa]
Length=582

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +Y+VC CF R+++ T +   +++K  F  Y+++G  M+ + LLRFLT+ Q Q +AT  EA
Sbjct  5    TYKVCFCFRRRYRHTASVAPSEIKTIFDNYSDKG-LMTVDHLLRFLTDVQKQDQATREEA  63

Query  322  EAIV---XQILHK  351
            +AIV     +LH+
Sbjct  64   QAIVNASSSLLHR  76



>ref|XP_009612249.1| PREDICTED: phosphoinositide phospholipase C 2-like [Nicotiana 
tomentosiformis]
Length=596

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            +YR+C CF RKFK+ EA+P  ++K+ F +Y+E G  M++E L +FL + Q + + T  EA
Sbjct  5    TYRIC-CFQRKFKMKEAEPPNEIKDLFDRYSENGI-MTAEHLYQFLKDVQSEDKVTKEEA  62

Query  322  EAIVXQILHKRH  357
            E I+   L   H
Sbjct  63   EFILESALKLVH  74



>ref|XP_010446184.1| PREDICTED: phosphoinositide phospholipase C 1-like, partial [Camelina 
sativa]
Length=169

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S++VC C  R FKV  ++P  ++K  F +Y+++  +MS+++LLRF+ + QG+K A ++  
Sbjct  5    SFKVCFCCVRSFKVKSSEPPEEIKNLFHEYSKD-ERMSADELLRFVIQVQGEKHADISHV  63

Query  322  EAIVXQILH  348
            + I   + H
Sbjct  64   KDIFHLLKH  72



>ref|XP_008220880.1| PREDICTED: phosphoinositide phospholipase C 2 isoform X2 [Prunus 
mume]
Length=553

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S++VC CF R F++  A+P  ++K  F +YAE G+ ++ + L  FL E QG+  AT  +A
Sbjct  6    SFKVCFCFKRIFRLKVAEPPEEIKNLFNQYAENGT-ITIDNLQNFLIEFQGEPNATKEDA  64

Query  322  EAIVXQILH  348
            +AI   + H
Sbjct  65   QAIFNSLRH  73



>ref|XP_008220872.1| PREDICTED: phosphoinositide phospholipase C 2 isoform X1 [Prunus 
mume]
Length=554

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +1

Query  142  SYRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEA  321
            S++VC CF R F++  A+P  ++K  F +YAE G+ ++ + L  FL E QG+  AT  +A
Sbjct  6    SFKVCFCFKRIFRLKVAEPPEEIKNLFNQYAENGT-ITIDNLQNFLIEFQGEPNATKEDA  64

Query  322  EAIVXQILH  348
            +AI   + H
Sbjct  65   QAIFNSLRH  73



>ref|XP_004490991.1| PREDICTED: phosphoinositide phospholipase C 6-like isoform X2 
[Cicer arietinum]
Length=600

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +1

Query  145  YRVCMCFTRKFKVTEAQPAADVKEAFKKYAEEGSQMSSEQLLRFLTEEQGQKEATLAEAE  324
            Y+  + F +K+KVTE  P  ++KE F K+   G  MS+EQL +FL E Q +   TL+++E
Sbjct  11   YKSFLFFIKKYKVTELVPPQELKEVFSKFTGGGLYMSTEQLYQFLVEHQSEDNLTLSDSE  70

Query  325  AIVXQILHKR  354
             IV ++L  R
Sbjct  71   KIVDKVLLLR  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559392177135