BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004K18

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588520.1|  PREDICTED: putative kinase-like protein TMKL1    58.2    4e-07   Nicotiana tomentosiformis
ref|XP_009789263.1|  PREDICTED: putative kinase-like protein TMKL1    55.8    3e-06   Nicotiana sylvestris
ref|XP_011101106.1|  PREDICTED: putative kinase-like protein TMKL1    55.8    3e-06   Sesamum indicum [beniseed]
emb|CDP05369.1|  unnamed protein product                              52.0    4e-05   Coffea canephora [robusta coffee]
ref|XP_006358227.1|  PREDICTED: putative kinase-like protein TMKL...  49.3    4e-04   
ref|XP_004235179.1|  PREDICTED: putative kinase-like protein TMKL1    48.1    8e-04   Solanum lycopersicum



>ref|XP_009588520.1| PREDICTED: putative kinase-like protein TMKL1 [Nicotiana tomentosiformis]
Length=358

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  MEHTHLVILIIGLTSFCVAALAVYMWCYCRRRGAEDVPRDVEGGFEVKERDGV  476
            MEH H++ILII  +S     + + M   CRR+G E V RD+E  FEVKERDGV
Sbjct  1    MEHKHMLILIIVPSSVTAIIILLVMIYCCRRKGGETVSRDIEASFEVKERDGV  53



>ref|XP_009789263.1| PREDICTED: putative kinase-like protein TMKL1 [Nicotiana sylvestris]
Length=358

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  MEHTHLVILIIGLTSFCVAALAVYMWCYCRRRGAEDVPRDVEGGFEVKERDGV  476
            MEH H++ILII  +S     + + M   CRR+G E V RD+E   EVKERDGV
Sbjct  1    MEHKHMLILIIVPSSVTAIIILLVMIYCCRRKGGETVSRDIEASLEVKERDGV  53



>ref|XP_011101106.1| PREDICTED: putative kinase-like protein TMKL1 [Sesamum indicum]
Length=359

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +3

Query  318  MEHTHLVILIIGLTSFCVAALAVYMWCYCRRRGAEDVPRDVEGGFEVKERDGVVGKEILM  497
            M H H ++LIIGLTS  V  + ++    CRRR AE   RDVE  FE KE DG V  E L+
Sbjct  1    MRHRHKLMLIIGLTSVTVLTILLFTVFCCRRRKAEHGSRDVESAFECKEGDGRVNTEDLI  60



>emb|CDP05369.1| unnamed protein product [Coffea canephora]
Length=359

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  318  MEHTHLVILIIGLTSFCVAALAVYMWCYCRRRGAEDVPRDVEGGFEVKERDGVVGKEILM  497
            MEH +++ LIIGL+    AA+   M   C ++  ++VP+D+E GFE KER+    +E L+
Sbjct  1    MEHKYMLPLIIGLSLLGAAAILFLMIYCCWKKTEQNVPKDLEAGFEFKEREAGTDREYLI  60



>ref|XP_006358227.1| PREDICTED: putative kinase-like protein TMKL1-like [Solanum tuberosum]
Length=359

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  MEHTHLVILIIGLTSFCVAALAVYMWCYCRRRGAEDVPRDVEGGFEVKERDGV  476
            MEH H++ILII   S     + + +   C R+  E V RDVE  FEVKERDGV
Sbjct  1    MEHKHMLILIIVPCSVTALIVLLLVIYLCTRKRGEIVSRDVEANFEVKERDGV  53



>ref|XP_004235179.1| PREDICTED: putative kinase-like protein TMKL1 [Solanum lycopersicum]
Length=359

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  MEHTHLVILIIGLTSFCVAALAVYMWCYCRRRGAEDVPRDVEGGFEVKERDGV  476
            MEH H++ILII   S  V  + + +   C RR  E V RDVE  FEVKERDGV
Sbjct  1    MEHKHMLILIIVPCSVAVLIVLLLVIYLCTRRREEIVSRDVETSFEVKERDGV  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695