BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004K11

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     156   8e-41   Nicotiana sylvestris
gb|EYU40534.1|  hypothetical protein MIMGU_mgv11b016088mg               141   9e-39   Erythranthe guttata [common monkey flower]
ref|XP_009594458.1|  PREDICTED: pectinesterase                          149   3e-38   Nicotiana tomentosiformis
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                148   3e-37   Erythranthe guttata [common monkey flower]
emb|CDP21547.1|  unnamed protein product                                140   3e-35   Coffea canephora [robusta coffee]
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         135   9e-34   Jatropha curcas
ref|XP_010315470.1|  PREDICTED: pectinesterase                          135   1e-33   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    132   2e-32   Cucumis melo [Oriental melon]
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    133   2e-32   Solanum tuberosum [potatoes]
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    130   7e-32   Cucumis sativus [cucumbers]
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         129   1e-31   Jatropha curcas
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                130   2e-31   Erythranthe guttata [common monkey flower]
emb|CBI22967.3|  unnamed protein product                                131   3e-31   Vitis vinifera
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         127   8e-31   Jatropha curcas
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    126   2e-30   Vitis vinifera
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    126   3e-30   Cicer arietinum [garbanzo]
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    124   1e-29   Morus notabilis
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             124   1e-29   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    125   3e-29   Sesamum indicum [beniseed]
ref|XP_002516960.1|  Pectinesterase precursor, putative                 122   5e-29   Ricinus communis
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    122   7e-29   Morus notabilis
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    122   1e-28   Vitis vinifera
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             121   1e-28   Phaseolus vulgaris [French bean]
emb|CBI39537.3|  unnamed protein product                                122   2e-28   Vitis vinifera
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    120   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             120   4e-28   Prunus persica
emb|CDO98832.1|  unnamed protein product                                120   5e-28   Coffea canephora [robusta coffee]
gb|AGT17860.1|  pollen-specific pectin methylesterase                   119   6e-28   Pisum sativum [garden pea]
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             119   6e-28   
gb|EPS69059.1|  hypothetical protein M569_05708                         121   1e-27   Genlisea aurea
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    119   1e-27   Cicer arietinum [garbanzo]
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             119   1e-27   Prunus persica
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    118   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    118   2e-27   Prunus mume [ume]
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    118   2e-27   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    118   3e-27   Populus euphratica
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    118   3e-27   Prunus mume [ume]
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             118   3e-27   Prunus persica
ref|XP_003591168.1|  Pectinesterase                                     118   3e-27   Medicago truncatula
ref|XP_003626199.1|  Pectinesterase                                     118   3e-27   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    117   4e-27   Eucalyptus grandis [rose gum]
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     117   5e-27   Glycine soja [wild soybean]
ref|XP_003557034.1|  PREDICTED: putative pectinesterase/pectinest...    115   8e-27   
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    116   1e-26   Cicer arietinum [garbanzo]
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    115   2e-26   Elaeis guineensis
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    115   2e-26   Prunus mume [ume]
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    115   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    114   4e-26   Cucumis sativus [cucumbers]
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    114   4e-26   Glycine max [soybeans]
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    114   4e-26   Phoenix dactylifera
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     114   5e-26   Glycine soja [wild soybean]
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    114   5e-26   Glycine max [soybeans]
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    114   9e-26   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    114   9e-26   Glycine max [soybeans]
ref|XP_006382447.1|  pectin methylesterase family protein               114   9e-26   Populus trichocarpa [western balsam poplar]
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    114   1e-25   
gb|EPS65387.1|  pectinesterase                                          113   1e-25   Genlisea aurea
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    113   1e-25   Populus euphratica
ref|XP_002512459.1|  Pectinesterase precursor, putative                 113   1e-25   Ricinus communis
ref|XP_004252915.1|  PREDICTED: pectinesterase                          113   1e-25   Solanum lycopersicum
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                113   1e-25   Erythranthe guttata [common monkey flower]
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                113   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    112   2e-25   Cucumis melo [Oriental melon]
ref|XP_006349952.1|  PREDICTED: probable pectinesterase/pectinest...    111   2e-25   Solanum tuberosum [potatoes]
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    112   3e-25   Cicer arietinum [garbanzo]
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    112   3e-25   Glycine max [soybeans]
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                112   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_002314364.1|  putative pectinesterase family protein             111   7e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    110   9e-25   Populus euphratica
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     110   1e-24   Glycine soja [wild soybean]
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    110   1e-24   Glycine max [soybeans]
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    110   1e-24   Eucalyptus grandis [rose gum]
ref|XP_003604119.1|  Pectinesterase                                     110   1e-24   
gb|KJB45338.1|  hypothetical protein B456_007G302000                    110   2e-24   Gossypium raimondii
ref|XP_003591166.1|  Pectinesterase                                     109   3e-24   Medicago truncatula
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    109   3e-24   Eucalyptus grandis [rose gum]
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    109   3e-24   Glycine max [soybeans]
emb|CDO98834.1|  unnamed protein product                                109   4e-24   Coffea canephora [robusta coffee]
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             108   5e-24   Phaseolus vulgaris [French bean]
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    108   6e-24   Glycine max [soybeans]
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     108   6e-24   Nicotiana tomentosiformis
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    108   7e-24   Nelumbo nucifera [Indian lotus]
ref|XP_007031044.1|  Pectinesterase, putative                           108   7e-24   
gb|EPS72184.1|  pectinesterase family protein                           108   8e-24   Genlisea aurea
ref|XP_007144962.1|  hypothetical protein PHAVU_007G198100g             108   1e-23   Phaseolus vulgaris [French bean]
gb|KJB45965.1|  hypothetical protein B456_007G340800                    109   1e-23   Gossypium raimondii
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g             107   1e-23   Phaseolus vulgaris [French bean]
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     107   1e-23   Nicotiana sylvestris
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    107   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    107   1e-23   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     107   2e-23   Nicotiana sylvestris
ref|XP_003591164.1|  Pectinesterase                                     107   2e-23   Medicago truncatula
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     106   2e-23   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    107   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    106   3e-23   Solanum tuberosum [potatoes]
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    106   3e-23   Malus domestica [apple tree]
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     106   3e-23   Glycine soja [wild soybean]
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    106   4e-23   Fragaria vesca subsp. vesca
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     106   4e-23   Nicotiana tomentosiformis
dbj|BAO02509.1|  predicted pectin esterase ortholog                     106   4e-23   Nicotiana alata [flowering tobacco]
ref|XP_009761202.1|  PREDICTED: pectinesterase                          105   5e-23   Nicotiana sylvestris
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    105   6e-23   Prunus mume [ume]
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    105   8e-23   Cicer arietinum [garbanzo]
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     105   8e-23   Nicotiana tomentosiformis
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             104   2e-22   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          104   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     103   2e-22   Nicotiana sylvestris
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     103   3e-22   Nicotiana tomentosiformis
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    103   3e-22   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    103   3e-22   Pyrus x bretschneideri [bai li]
gb|EPS70728.1|  pectinesterase                                          103   3e-22   Genlisea aurea
ref|XP_002872255.1|  pectinesterase family protein                      103   3e-22   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             104   4e-22   Capsella rubella
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                103   5e-22   Erythranthe guttata [common monkey flower]
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    103   5e-22   Arabis alpina [alpine rockcress]
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     103   5e-22   Sesamum indicum [beniseed]
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    103   5e-22   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    103   8e-22   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                102   1e-21   Erythranthe guttata [common monkey flower]
ref|XP_008370617.1|  PREDICTED: pectinesterase                          102   1e-21   
emb|CDO98833.1|  unnamed protein product                                101   1e-21   Coffea canephora [robusta coffee]
gb|EMS65303.1|  putative pectinesterase/pectinesterase inhibitor 21   99.8    2e-21   Triticum urartu
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          101   2e-21   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    101   3e-21   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    100   3e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH37214.1|  pectinesterase/pectinesterase inhibitor               99.0    4e-21   Medicago truncatula
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                100   4e-21   Erythranthe guttata [common monkey flower]
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     100   5e-21   Solanum tuberosum [potatoes]
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     100   5e-21   Solanum tuberosum [potatoes]
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             100   5e-21   Prunus persica
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                   99.8    7e-21   Sesamum indicum [beniseed]
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    100   8e-21   Arabis alpina [alpine rockcress]
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...  99.8    9e-21   Prunus mume [ume]
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                   99.4    1e-20   Sesamum indicum [beniseed]
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg           99.4    1e-20   Eutrema salsugineum [saltwater cress]
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                   99.0    1e-20   Sesamum indicum [beniseed]
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg           99.4    2e-20   Eutrema salsugineum [saltwater cress]
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...  99.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001060715.1|  Os07g0691100                                     98.6    2e-20   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...  98.6    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ05229.1|  hypothetical protein OsI_27427                        98.6    2e-20   Oryza sativa Indica Group [Indian rice]
gb|EAZ41174.1|  hypothetical protein OsJ_25671                        98.6    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor               98.2    3e-20   Medicago truncatula
ref|XP_003604120.1|  Pectinesterase                                   98.6    3e-20   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...  98.2    3e-20   Oryza brachyantha
gb|KJB38561.1|  hypothetical protein B456_006G260700                  98.2    3e-20   Gossypium raimondii
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...  98.2    3e-20   Cicer arietinum [garbanzo]
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                   98.2    3e-20   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...  98.6    3e-20   Brassica rapa
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21   97.8    3e-20   Glycine soja [wild soybean]
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...  98.2    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                   97.8    4e-20   Solanum lycopersicum
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                   97.8    4e-20   Sesamum indicum [beniseed]
ref|XP_006651293.1|  PREDICTED: probable pectinesterase/pectinest...  95.5    4e-20   
emb|CDX99968.1|  BnaC09g03330D                                        98.2    5e-20   
gb|KHN04169.1|  Putative pectinesterase/pectinesterase inhibitor 21   97.1    5e-20   Glycine soja [wild soybean]
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...  97.8    6e-20   Brassica rapa
emb|CDY68790.1|  BnaAnng28400D                                        97.8    6e-20   Brassica napus [oilseed rape]
ref|XP_003559753.1|  PREDICTED: pectinesterase-like                   97.4    7e-20   Brachypodium distachyon [annual false brome]
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...  97.1    8e-20   Setaria italica
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                   97.1    1e-19   Sesamum indicum [beniseed]
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700        96.7    1e-19   Amborella trichopoda
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...  96.7    1e-19   Prunus mume [ume]
ref|XP_002884519.1|  pectinesterase family protein                    97.1    1e-19   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor               96.7    1e-19   Medicago truncatula
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...  96.7    1e-19   Brassica rapa
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                   96.3    1e-19   Sesamum indicum [beniseed]
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21   96.3    1e-19   Glycine soja [wild soybean]
emb|CDX74137.1|  BnaA03g29100D                                        96.7    2e-19   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...  96.7    2e-19   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...  96.3    2e-19   Brassica rapa
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...  96.7    2e-19   Brassica rapa
emb|CDY27751.1|  BnaA05g31600D                                        96.3    2e-19   Brassica napus [oilseed rape]
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...  95.9    2e-19   Fragaria vesca subsp. vesca
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...  95.9    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY05188.1|  BnaC05g46150D                                        95.9    2e-19   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                   95.5    2e-19   Sesamum indicum [beniseed]
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                   95.5    2e-19   Sesamum indicum [beniseed]
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                   95.5    3e-19   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...  95.9    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                   95.1    4e-19   Solanum lycopersicum
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...  95.5    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...  95.1    4e-19   Camelina sativa [gold-of-pleasure]
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...  94.7    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...  94.7    7e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42986.1|  putative pectinesterase                              94.7    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900        94.4    7e-19   Sorghum bicolor [broomcorn]
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551            94.0    8e-19   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg           94.0    8e-19   Capsella rubella
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...  94.0    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor               94.0    8e-19   Glycine soja [wild soybean]
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...  94.0    8e-19   Glycine max [soybeans]
ref|NP_001151322.1|  pectinesterase-1 precursor                       93.6    1e-18   
ref|XP_002461260.1|  hypothetical protein SORBIDRAFT_02g043780        93.2    2e-18   Sorghum bicolor [broomcorn]
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg           93.2    2e-18   Prunus persica
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...  93.2    2e-18   Setaria italica
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...  92.8    2e-18   Gossypium arboreum [tree cotton]
tpg|DAA64233.1|  TPA: pectinesterase                                  92.8    2e-18   
ref|XP_002865716.1|  pectinesterase family protein                    92.8    2e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...  92.4    3e-18   Glycine max [soybeans]
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...  92.4    3e-18   Cicer arietinum [garbanzo]
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor               92.4    3e-18   Medicago truncatula
emb|CDY40720.1|  BnaC03g34360D                                        88.2    5e-18   Brassica napus [oilseed rape]
ref|XP_006658993.1|  PREDICTED: probable pectinesterase/pectinest...  90.9    1e-17   Oryza brachyantha
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg           90.9    1e-17   
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg           90.9    2e-17   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg           90.9    2e-17   
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg           90.9    2e-17   
ref|NP_001049858.1|  Os03g0300500                                     90.1    2e-17   
emb|CDY33925.1|  BnaA02g30620D                                        90.1    2e-17   Brassica napus [oilseed rape]
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...  90.1    2e-17   Brassica rapa
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                   90.1    2e-17   Sesamum indicum [beniseed]
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...  89.7    3e-17   Citrus sinensis [apfelsine]
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                 89.7    3e-17   Citrus sinensis [apfelsine]
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor               89.4    3e-17   Glycine soja [wild soybean]
emb|CAB65290.2|  pectin methyl-esterase PER                           89.7    3e-17   Medicago truncatula
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor               89.7    3e-17   Medicago truncatula
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...  89.4    4e-17   Brachypodium distachyon [annual false brome]
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...  89.4    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...  89.0    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg           89.4    4e-17   Capsella rubella
gb|KDP23452.1|  hypothetical protein JCGZ_23285                       84.7    6e-17   Jatropha curcas
ref|XP_011462740.1|  PREDICTED: pectinesterase-like                   88.6    7e-17   Fragaria vesca subsp. vesca
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g           88.2    9e-17   Phaseolus vulgaris [French bean]
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...  87.8    1e-16   Tarenaya hassleriana [spider flower]
gb|EMS57827.1|  putative pectinesterase/pectinesterase inhibitor 21   87.4    1e-16   Triticum urartu
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...  87.4    1e-16   Glycine max [soybeans]
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...  87.4    2e-16   Camelina sativa [gold-of-pleasure]
dbj|BAK06954.1|  predicted protein                                    87.0    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...  87.0    2e-16   Gossypium arboreum [tree cotton]
ref|XP_010489679.1|  PREDICTED: probable pectinesterase/pectinest...  85.1    2e-16   
emb|CDX80613.1|  BnaC07g28310D                                        87.0    3e-16   
gb|EMT00224.1|  Putative pectinesterase/pectinesterase inhibitor 21   86.3    3e-16   
gb|KJB38560.1|  hypothetical protein B456_006G260600                  86.3    4e-16   Gossypium raimondii
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...  85.9    5e-16   Gossypium arboreum [tree cotton]
gb|KJB38562.1|  hypothetical protein B456_006G260800                  85.9    5e-16   Gossypium raimondii
gb|KJB38563.1|  hypothetical protein B456_006G260900                  85.9    5e-16   Gossypium raimondii
gb|EPS59322.1|  pectinesterase                                        85.5    7e-16   Genlisea aurea
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg              85.1    1e-15   Erythranthe guttata [common monkey flower]
gb|AEL79481.1|  pectin methylesterase-like protein                    84.3    2e-15   Capsicum annuum
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor               84.0    3e-15   Glycine soja [wild soybean]
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg           83.2    4e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...  82.8    6e-15   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...  83.2    7e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...  82.4    8e-15   Phoenix dactylifera
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor               81.6    1e-14   Medicago truncatula
emb|CAB65291.1|  pectin methyl-esterase PEF1                          81.6    1e-14   Medicago truncatula
emb|CDY34927.1|  BnaA01g32580D                                        81.3    2e-14   Brassica napus [oilseed rape]
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...  81.3    2e-14   Brassica rapa
gb|KJB26381.1|  hypothetical protein B456_004G238800                  81.6    3e-14   Gossypium raimondii
ref|XP_007138937.1|  hypothetical protein PHAVU_009G250600g           80.1    4e-14   Phaseolus vulgaris [French bean]
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...  79.7    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                   79.3    8e-14   Sesamum indicum [beniseed]
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                   79.0    1e-13   Elaeis guineensis
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                   77.8    3e-13   Prunus mume [ume]
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg           77.8    3e-13   Prunus persica
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...  76.6    7e-13   Tarenaya hassleriana [spider flower]
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...  76.6    8e-13   Camelina sativa [gold-of-pleasure]
gb|EMT12798.1|  Putative pectinesterase/pectinesterase inhibitor 21   76.3    1e-12   
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...  76.3    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250        75.5    2e-12   Amborella trichopoda
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                   75.1    2e-12   Malus domestica [apple tree]
gb|EPS58111.1|  pectinesterase                                        73.9    3e-12   Genlisea aurea
ref|XP_002868170.1|  predicted protein                                75.1    3e-12   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                   74.7    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                   74.7    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...  74.7    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g           74.3    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...  74.3    4e-12   Camelina sativa [gold-of-pleasure]
ref|NP_193333.1|  putative pectinesterase/pectinesterase inhibito...  74.7    4e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08032.1|  BnaC03g34910D                                        72.8    7e-12   Brassica napus [oilseed rape]
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                   73.2    9e-12   Populus euphratica
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...  73.2    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009134931.1|  PREDICTED: probable pectinesterase/pectinest...  73.2    1e-11   Brassica rapa
emb|CDY05295.1|  BnaC05g45080D                                        72.8    1e-11   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...  72.8    1e-11   Brassica rapa
ref|XP_003632385.1|  PREDICTED: pectinesterase-like                   72.4    2e-11   Vitis vinifera
emb|CDY24663.1|  BnaA05g30620D                                        72.0    2e-11   Brassica napus [oilseed rape]
emb|CDX74078.1|  BnaA03g29690D                                        72.0    2e-11   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                   71.6    3e-11   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg           71.6    3e-11   
ref|XP_004298254.1|  PREDICTED: pectinesterase-like                   71.6    3e-11   
ref|XP_011008693.1|  PREDICTED: pectinesterase-like                   71.6    4e-11   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg           71.6    4e-11   
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                   71.6    4e-11   
dbj|BAC42959.2|  putative pectin methylesterase                       71.2    4e-11   
ref|XP_006414405.1|  hypothetical protein EUTSA_v10024582mg           71.6    4e-11   
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...  71.2    4e-11   
gb|AAF63815.1|  pectin methylesterase, putative                       71.2    5e-11   
ref|XP_010489680.1|  PREDICTED: probable pectinesterase/pectinest...  69.7    6e-11   
emb|CAN67129.1|  hypothetical protein VITISV_040170                   71.6    6e-11   
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...  70.9    6e-11   
ref|XP_009107897.1|  PREDICTED: putative pectinesterase/pectinest...  71.2    6e-11   
emb|CDY66111.1|  BnaAnng21510D                                        70.9    7e-11   
ref|XP_002882495.1|  pectinesterase family protein                    70.5    7e-11   
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g           70.1    1e-10   
ref|XP_006285748.1|  hypothetical protein CARUB_v10007222mg           70.5    1e-10   
ref|XP_002304074.1|  hypothetical protein POPTR_0003s01550g           70.1    1e-10   
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative             69.7    1e-10   
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g           69.3    2e-10   
gb|KDP43632.1|  hypothetical protein JCGZ_16919                       68.9    3e-10   
gb|KFK22175.1|  hypothetical protein AALP_AAs39369U000100             68.9    3e-10   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                  68.6    3e-10   
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg              68.2    5e-10   
ref|XP_007133558.1|  hypothetical protein PHAVU_011G1890000g          67.4    6e-10   
emb|CBI26012.3|  unnamed protein product                              67.4    7e-10   
ref|XP_002275000.1|  PREDICTED: pectinesterase                        67.4    8e-10   
ref|XP_011007987.1|  PREDICTED: pectinesterase-like                   67.4    9e-10   
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                   67.4    9e-10   
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...  67.0    1e-09   
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                   65.9    2e-09   
ref|XP_010098736.1|  Putative pectinesterase/pectinesterase inhib...  62.0    3e-09   
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...  65.1    4e-09   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                   65.1    5e-09   
ref|XP_010062118.1|  PREDICTED: 21 kDa protein-like                   62.4    5e-09   
ref|XP_002298186.1|  hypothetical protein POPTR_0001s21630g           65.1    5e-09   
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...  65.1    5e-09   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative             64.7    6e-09   
ref|XP_003546684.1|  PREDICTED: putative pectinesterase/pectinest...  64.7    6e-09   
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...  64.3    8e-09   
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor               64.3    8e-09   
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...  64.3    8e-09   
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24   64.3    9e-09   
gb|KHN10154.1|  Putative pectinesterase/pectinesterase inhibitor 24   63.9    1e-08   
ref|XP_009370481.1|  PREDICTED: 21 kDa protein-like                   61.2    1e-08   
ref|XP_009794842.1|  PREDICTED: pectinesterase 4-like                 63.2    1e-08   
ref|XP_010487229.1|  PREDICTED: pectinesterase 1-like                 62.8    2e-08   
ref|XP_004956918.1|  PREDICTED: putative pectinesterase/pectinest...  62.8    3e-08   
ref|XP_009370482.1|  PREDICTED: 21 kDa protein-like                   60.5    3e-08   
gb|KJB24470.1|  hypothetical protein B456_004G146900                  62.8    3e-08   
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...  62.4    3e-08   
ref|XP_010038523.1|  PREDICTED: pectinesterase-like                   62.4    3e-08   
ref|XP_006281048.1|  hypothetical protein CARUB_v10027064mg           60.5    4e-08   
ref|XP_011046142.1|  PREDICTED: pectinesterase-like                   62.0    4e-08   
gb|KDP43631.1|  hypothetical protein JCGZ_16918                       62.0    4e-08   
ref|XP_006297279.1|  hypothetical protein CARUB_v10013297mg           62.0    4e-08   
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                   62.0    4e-08   
ref|XP_010259038.1|  PREDICTED: 21 kDa protein-like                   60.1    4e-08   
ref|XP_009372895.1|  PREDICTED: 21 kDa protein-like                   59.3    6e-08   
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                   61.2    8e-08   
ref|XP_009335681.1|  PREDICTED: 21 kDa protein-like                   58.5    1e-07   
ref|XP_010501837.1|  PREDICTED: pectinesterase 1-like                 60.5    1e-07   
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...  60.5    1e-07   
ref|XP_009589773.1|  PREDICTED: pectinesterase-like                   60.5    2e-07   
ref|XP_009335740.1|  PREDICTED: 21 kDa protein                        58.2    2e-07   
gb|KFK27963.1|  hypothetical protein AALP_AA8G454300                  58.2    2e-07   
ref|XP_004511148.1|  PREDICTED: probable pectinesterase/pectinest...  60.1    2e-07   
ref|NP_187682.1|  root hair specific 12                               60.1    2e-07   
ref|XP_010465322.1|  PREDICTED: pectinesterase 1-like                 59.7    2e-07   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020        59.7    2e-07   
ref|XP_002265217.1|  PREDICTED: pectinesterase 3                      59.7    2e-07   
gb|KDP34079.1|  hypothetical protein JCGZ_07650                       59.7    3e-07   
ref|XP_010444081.1|  PREDICTED: 21 kDa protein-like                   57.8    3e-07   
gb|KFK35692.1|  hypothetical protein AALP_AA4G024800                  59.3    3e-07   
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...  59.3    4e-07   
ref|XP_010458855.1|  PREDICTED: 21 kDa protein-like                   57.4    4e-07   
ref|XP_010483948.1|  PREDICTED: 21 kDa protein-like isoform X1        57.0    4e-07   
emb|CDY51799.1|  BnaC06g41950D                                        59.3    4e-07   
ref|XP_002885032.1|  hypothetical protein ARALYDRAFT_318218           59.3    4e-07   
gb|KJB49774.1|  hypothetical protein B456_008G137200                  58.9    4e-07   
ref|XP_009112019.1|  PREDICTED: 21 kDa protein-like                   57.0    4e-07   
gb|EYU21271.1|  hypothetical protein MIMGU_mgv1a022830mg              58.9    5e-07   
ref|XP_008357027.1|  PREDICTED: 21 kDa protein-like                   57.0    5e-07   
ref|XP_011093900.1|  PREDICTED: pectinesterase-like                   58.9    5e-07   
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...  58.9    5e-07   
ref|XP_008466403.1|  PREDICTED: pectinesterase-like                   58.5    5e-07   
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                   58.5    6e-07   
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                   58.5    6e-07   
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063            58.5    6e-07   
emb|CDX87244.1|  BnaC09g05590D                                        56.6    6e-07   
ref|XP_003541560.1|  PREDICTED: putative pectinesterase/pectinest...  58.2    8e-07   
ref|XP_009123647.1|  PREDICTED: pectinesterase 1                      58.2    8e-07   
ref|NP_188047.1|  pectin methylesterase 26                            58.5    8e-07   
gb|KHN10316.1|  Putative pectinesterase/pectinesterase inhibitor 24   58.2    8e-07   
ref|XP_010679482.1|  PREDICTED: probable pectinesterase/pectinest...  58.2    9e-07   
ref|XP_006394407.1|  hypothetical protein EUTSA_v10004950mg           56.2    9e-07   
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...  57.8    1e-06   
ref|XP_010264194.1|  PREDICTED: 21 kDa protein-like                   56.2    1e-06   
ref|XP_002864788.1|  invertase/pectin methylesterase inhibitor fa...  55.8    1e-06   
ref|XP_006488977.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...  57.8    1e-06   
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                   57.4    1e-06   
ref|XP_010542351.1|  PREDICTED: pectinesterase 1                      57.4    2e-06   
gb|KHG23523.1|  putative pectinesterase/pectinesterase inhibitor ...  57.0    2e-06   
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                   57.0    2e-06   
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...  57.0    2e-06   
gb|EYU25819.1|  hypothetical protein MIMGU_mgv1a014485mg              55.1    2e-06   
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                   57.0    2e-06   
gb|AEK07905.1|  pectin methylesterase                                 57.0    2e-06   
ref|XP_004149499.1|  PREDICTED: putative pectinesterase/pectinest...  57.0    2e-06   
ref|XP_010687597.1|  PREDICTED: pectinesterase                        56.6    2e-06   
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                   56.6    2e-06   
ref|XP_010247944.1|  PREDICTED: probable pectinesterase/pectinest...  56.6    3e-06   
emb|CDY24071.1|  BnaA06g00690D                                        56.6    3e-06   
ref|XP_002882691.1|  pectinesterase family protein                    56.6    3e-06   
ref|XP_007163235.1|  hypothetical protein PHAVU_001G217300g           56.6    3e-06   
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850        56.2    3e-06   
ref|XP_010679479.1|  PREDICTED: probable pectinesterase/pectinest...  56.2    3e-06   
gb|KJB67055.1|  hypothetical protein B456_010G173200                  56.2    3e-06   
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...  56.6    3e-06   
tpg|DAA44943.1|  TPA: hypothetical protein ZEAMMB73_754551            55.8    4e-06   
ref|XP_006392744.1|  hypothetical protein EUTSA_v10011342mg           55.8    4e-06   
ref|XP_008238630.1|  PREDICTED: 21 kDa protein                        54.3    4e-06   
ref|XP_002509582.1|  21 kDa protein precursor, putative               54.7    5e-06   
emb|CDY24165.1|  BnaC03g57120D                                        54.7    5e-06   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...  55.8    5e-06   
ref|XP_009398948.1|  PREDICTED: probable pectinesterase/pectinest...  55.8    5e-06   
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28   55.8    5e-06   
ref|XP_002264167.1|  PREDICTED: 21 kDa protein                        54.3    5e-06   
ref|XP_008804471.1|  PREDICTED: pectinesterase-like                   55.5    7e-06   
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                   55.5    7e-06   
ref|XP_008376226.1|  PREDICTED: 21 kDa protein-like                   53.5    8e-06   
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                   55.1    9e-06   
gb|EAY94388.1|  hypothetical protein OsI_16156                        55.1    9e-06   
gb|KDP22409.1|  hypothetical protein JCGZ_26240                       53.5    9e-06   
ref|XP_011041731.1|  PREDICTED: 21 kDa protein-like                   53.5    1e-05   
ref|NP_201042.2|  plant invertase/pectin methylesterase inhibitor...  53.5    1e-05   
ref|XP_008242280.1|  PREDICTED: 21 kDa protein                        53.5    1e-05   
gb|AAN60276.1|  unknown                                               53.5    1e-05   
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28   54.7    1e-05   
ref|XP_002447200.1|  hypothetical protein SORBIDRAFT_06g030310        55.1    1e-05   
ref|XP_002515781.1|  Pectinesterase-3 precursor, putative             54.7    1e-05   
ref|XP_008668795.1|  PREDICTED: pectinesterase-like                   54.7    1e-05   
ref|XP_009386320.1|  PREDICTED: pectinesterase-like                   54.7    1e-05   
ref|NP_001052981.1|  Os04g0458900                                     54.3    1e-05   
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...  54.3    1e-05   
emb|CAH67075.1|  OSIGBa0097P08.5                                      54.3    1e-05   
ref|XP_004973589.1|  PREDICTED: putative pectinesterase/pectinest...  54.3    1e-05   
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...  54.3    1e-05   
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2        54.3    2e-05   
emb|CDX86901.1|  BnaC03g51710D                                        52.8    2e-05   
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...  54.3    2e-05   
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3        54.3    2e-05   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...  54.3    2e-05   
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                  54.3    2e-05   
ref|XP_010248006.1|  PREDICTED: probable pectinesterase/pectinest...  53.9    2e-05   
ref|XP_003521616.1|  PREDICTED: pectinesterase 4-like                 54.3    2e-05   
ref|XP_003528738.1|  PREDICTED: pectinesterase 3                      54.3    2e-05   
gb|KHN14164.1|  Putative pectinesterase/pectinesterase inhibitor 28   54.3    2e-05   
ref|XP_010067062.1|  PREDICTED: probable pectinesterase/pectinest...  53.9    2e-05   
ref|XP_010418644.1|  PREDICTED: putative pectinesterase/pectinest...  53.9    2e-05   
gb|KFK38796.1|  hypothetical protein AALP_AA3G161400                  53.9    2e-05   
ref|XP_002462429.1|  hypothetical protein SORBIDRAFT_02g025460        53.9    2e-05   
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...  53.9    2e-05   
ref|XP_002322403.1|  ripening-related family protein                  52.4    2e-05   
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                   53.9    2e-05   
emb|CDY36938.1|  BnaA06g17230D                                        52.8    2e-05   
gb|KGN49779.1|  hypothetical protein Csa_5G119700                     53.9    2e-05   
ref|XP_007149847.1|  hypothetical protein PHAVU_005G103500g           53.5    2e-05   
ref|XP_007163236.1|  hypothetical protein PHAVU_001G217400g           53.5    2e-05   
ref|XP_009149885.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...  53.1    2e-05   
ref|XP_002322404.2|  ripening-related family protein                  52.4    2e-05   
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1        53.5    3e-05   
ref|XP_011010937.1|  PREDICTED: 21 kDa protein-like isoform X2        52.0    3e-05   
ref|XP_011010936.1|  PREDICTED: 21 kDa protein-like isoform X1        52.4    3e-05   
gb|ACF79975.1|  unknown                                               53.5    3e-05   
ref|XP_010501046.1|  PREDICTED: pectinesterase 1-like                 53.5    3e-05   
ref|XP_009374503.1|  PREDICTED: 21 kDa protein-like                   52.4    3e-05   
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                   53.5    3e-05   
gb|KHN32444.1|  21 kDa protein                                        52.4    3e-05   
ref|XP_010545015.1|  PREDICTED: 21 kDa protein-like                   52.0    3e-05   
ref|XP_006307084.1|  hypothetical protein CARUB_v10008670mg           53.5    3e-05   
gb|KDP40628.1|  hypothetical protein JCGZ_24627                       53.5    3e-05   
gb|ABK24761.1|  unknown                                               53.1    3e-05   
ref|XP_004307822.1|  PREDICTED: 21 kDa protein-like                   52.0    3e-05   
ref|XP_010327317.1|  PREDICTED: 21 kDa protein-like                   52.0    3e-05   
ref|XP_011032980.1|  PREDICTED: putative pectinesterase/pectinest...  53.1    3e-05   
ref|XP_006398953.1|  hypothetical protein EUTSA_v10013108mg           53.1    4e-05   
gb|KJB20850.1|  hypothetical protein B456_003G168700                  52.0    4e-05   
ref|NP_001145377.1|  uncharacterized protein LOC100278720             53.1    4e-05   
gb|AFW59628.1|  pectinesterase                                        53.1    4e-05   
ref|XP_007209621.1|  hypothetical protein PRUPE_ppa011699mg           52.0    4e-05   
ref|XP_006490093.1|  PREDICTED: 21 kDa protein-like                   51.6    4e-05   
ref|XP_009407599.1|  PREDICTED: putative pectinesterase/pectinest...  52.8    4e-05   
ref|XP_010276571.1|  PREDICTED: uncharacterized protein LOC104611288  53.1    4e-05   
gb|EAY94391.1|  hypothetical protein OsI_16158                        53.1    4e-05   
emb|CDY00279.1|  BnaA06g21800D                                        51.6    5e-05   
ref|XP_003535291.1|  PREDICTED: probable pectinesterase/pectinest...  52.8    5e-05   
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                   52.8    5e-05   
ref|XP_003541070.2|  PREDICTED: 21 kDa protein-like                   52.0    5e-05   
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...  52.8    5e-05   
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...  52.8    5e-05   
ref|XP_009381017.1|  PREDICTED: 21 kDa protein-like                   51.6    5e-05   
ref|XP_007221469.1|  hypothetical protein PRUPE_ppa003369mg           52.8    5e-05   
ref|XP_010519346.1|  PREDICTED: 21 kDa protein-like                   51.2    5e-05   
ref|XP_009362111.1|  PREDICTED: 21 kDa protein-like                   51.2    6e-05   
gb|KDP25618.1|  hypothetical protein JCGZ_20774                       51.6    6e-05   
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g           52.4    6e-05   
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative             52.4    6e-05   
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...  52.4    6e-05   
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg              52.4    6e-05   
emb|CDP19930.1|  unnamed protein product                              52.4    6e-05   
ref|XP_006828609.1|  hypothetical protein AMTR_s00129p00068690        52.4    6e-05   
ref|XP_008375511.1|  PREDICTED: putative pectinesterase/pectinest...  52.0    6e-05   
ref|XP_008227793.1|  PREDICTED: pectinesterase                        52.4    7e-05   
ref|XP_003598363.1|  Pectinesterase                                   52.4    7e-05   
ref|XP_009780443.1|  PREDICTED: pectinesterase 4-like                 52.4    7e-05   
ref|XP_002322405.2|  ripening-related family protein                  50.8    7e-05   
ref|XP_010939548.1|  PREDICTED: pectinesterase-like                   52.4    8e-05   
ref|XP_007218426.1|  hypothetical protein PRUPE_ppa011607mg           50.8    8e-05   
ref|XP_009151355.1|  PREDICTED: 21 kDa protein                        50.8    9e-05   



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            G  + +N+TII V SLILVAMV+A+A   +         ++ TSQKAIES+CQ T Y+ T
Sbjct  3    GNNRKRNVTIISVCSLILVAMVVAVAITMKGKDSDNNGQDVTTSQKAIESICQTTRYQHT  62

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            CV SL  S  G S+DPK LIQ +F VT+  I+ AI NST+L+ L  D R+K+AL+ C++L
Sbjct  63   CVESLESSAEG-SSDPKELIQKSFQVTMEKIKEAIENSTMLQKLEKDPRAKLALENCQKL  121

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            A +AV+DL RT  KF +F+  +D+  W+ADLK W+SGA
Sbjct  122  AWQAVNDLNRTHIKFESFEF-NDLSHWIADLKIWLSGA  158



>gb|EYU40534.1| hypothetical protein MIMGU_mgv11b016088mg, partial [Erythranthe 
guttata]
Length=152

 Score =   141 bits (356),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQ  282
            M + K K + I+ V SLILVAMV+AL  GG E  E +   ++++SQKAI S+C+ TDY+Q
Sbjct  1    MDQRKKKKIAIVSVCSLILVAMVVALVIGGTENEEEDTVPDVSSSQKAISSICETTDYQQ  60

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
            TC+NSL+     NST+PK LI+ AF   +  I +A  NS+ L++L  D  +K ALQ C++
Sbjct  61   TCMNSLA---GHNSTNPKDLIEVAFQAAVNYINQAAENSSTLQHLETDPMAKSALQVCQD  117

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWI  570
            LA RA++DL+R+ AKF  FD+++  DI L DLK W+
Sbjct  118  LANRAINDLQRSFAKFSNFDIINVDDILL-DLKIWL  152



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            G  + +N+ II V SLILVAM++A+A   +         +  TSQK IES+CQ T Y+ T
Sbjct  3    GNNRKRNVAIISVCSLILVAMIVAVAITMKGKDSDNNGQDATTSQKTIESICQTTRYQHT  62

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            CV SL  S  G S+DPK LIQ +F V I  I+ AI NST+L+ L  D R+K+AL+ C++L
Sbjct  63   CVESLESSAEG-SSDPKDLIQKSFQVAIKKIKEAIENSTMLQKLEKDPRAKLALENCQKL  121

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            A +AV+DL RT  KF +F+  +D+  W+ADLK W+SGA
Sbjct  122  AWQAVNDLNRTHTKFESFEF-NDLSHWIADLKIWLSGA  158



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 4/159 (3%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQ  282
            M + K K + I+ V SLILVAMV+AL  GG E  E +   ++++SQKAI S+C+ TDY+Q
Sbjct  1    MDQRKKKKIAIVSVCSLILVAMVVALVIGGTENEEEDTVPDVSSSQKAISSICETTDYQQ  60

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
            TC+NSL+     NST+PK LI+ AF   +  I +A  NS+ L++L  D  +K ALQ C++
Sbjct  61   TCMNSLA---GHNSTNPKDLIEVAFQAAVNYINQAAENSSTLQHLETDPMAKSALQVCQD  117

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            LA RA++DL+R+ AKF  FD+++  DI L DLK W+SGA
Sbjct  118  LANRAINDLQRSFAKFSNFDIINVDDILL-DLKIWLSGA  155



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 113/162 (70%), Gaps = 7/162 (4%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN-IATSQKAIESVCQPTDYK  279
            M     K   I+G++SL+LVAMV+A+  G Q +         ++ SQKAI+++C+PTDYK
Sbjct  1    MAGQAKKKFAILGIASLVLVAMVVAVTLGTQNSDTDNYNHQAVSDSQKAIQTICEPTDYK  60

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            +TC+ +L +++AGNSTDPK LIQAAF  T   I  A  NST+L+ L  D R+K+AL+ CK
Sbjct  61   ETCIKTL-QAEAGNSTDPKELIQAAFKATTNYINEAAKNSTVLQELQKDPRTKLALENCK  119

Query  460  ELAGRAVSDLKRTIAKFRTFDL--MDDMDIWLADLKTWISGA  579
            ELA +AV DL+R+ AKF+TFD   +DDM   LAD+K W+SGA
Sbjct  120  ELAHQAVEDLERSFAKFQTFDFSNIDDM---LADIKVWLSGA  158



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 105/156 (67%), Gaps = 5/156 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            K K   I GV+S +LVAMV+A+A+G   G   + +     I+TS K+++++CQPTDY++ 
Sbjct  12   KKKKYAIFGVASFLLVAMVIAVAYGINSGDHQNGSNASAEISTSSKSVQAICQPTDYREI  71

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C  SLSK+ AGN+TDP  L+QA F VTI  +++A+ NS+ L+++  D  +K AL  CKEL
Sbjct  72   CGKSLSKA-AGNTTDPLKLVQAGFQVTIDALQQALQNSSTLKDVAKDPMAKQALDNCKEL  130

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
               A+ DLK +  +   FD+ + MD +LA+LKTW+S
Sbjct  131  MDDAIHDLKVSFEEVEHFDV-NKMDEYLANLKTWLS  165



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            G  + +N TIIGV SLILVAMV+A+        +  E  ++ +++KAIES+CQ T Y+ T
Sbjct  3    GNNRKRNFTIIGVCSLILVAMVVAVVVTMNWNDKEAEAQDVTSTKKAIESICQTTQYQTT  62

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            CV SL +S    S+DPK LIQ +F VTI  I+ AI NST ++ L  D R+KMAL+ C++L
Sbjct  63   CVESL-ESTGECSSDPKELIQKSFQVTIKKIKEAIDNSTFMQKLEKDPRAKMALENCEKL  121

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            A +AV+DL RT  KF +F+  +D+  W+ADLK W+SGA
Sbjct  122  ALQAVNDLNRTHLKFESFEF-NDLSHWIADLKIWLSGA  158



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 108/176 (61%), Gaps = 12/176 (7%)
 Frame = +1

Query  82   LTNSFPKM-GETKSKNMTIIGVSSLILVAMVLALAFG---------GQetseteeeGNIA  231
            ++N F    G+ K K + II VSSLILVAMV+A+  G         G+    ++    I+
Sbjct  1    MSNGFANAEGDKKKKKIAIISVSSLILVAMVVAVTVGINNAPYEEHGEGDQGSKTTPEIS  60

Query  232  TSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLR  411
            +S KAI+++CQPTDYK+TC  SL  ++AGN+TDPK L++  F +    +  AI NST L+
Sbjct  61   SSTKAIQAICQPTDYKETCEKSL-MAEAGNTTDPKELVKVGFKIATRSLNEAIRNSTTLQ  119

Query  412  NLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L+ D R+  ALQ C+EL   A+ DL  +  +  TF  M  +D ++ADLK W+SGA
Sbjct  120  ELSKDPRTNQALQNCRELLEYAIDDLNESFERIGTFQ-MSKLDEFVADLKIWLSGA  174



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 107/158 (68%), Gaps = 2/158 (1%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            G  + +N TIIGV SLILVAMV+A+        +  E  ++ +++KAIES+CQ T Y+ T
Sbjct  3    GNNRKRNFTIIGVCSLILVAMVVAVVVTMNWNDKEAEAKDVTSTKKAIESICQTTQYQTT  62

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            CV SL ++    S+DPK LIQ +F VTI  I+ AI NST ++ L  D R+KMAL+ C+ L
Sbjct  63   CVESL-EATGECSSDPKDLIQMSFQVTIKKIKEAIDNSTFMQKLEKDPRAKMALENCEML  121

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            A +AV+DL RT  KF +F+  +D+  W+ADLK W+SGA
Sbjct  122  ALQAVNDLNRTHIKFESFEF-NDLSHWIADLKIWLSGA  158



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 108/177 (61%), Gaps = 13/177 (7%)
 Frame = +1

Query  82   LTNSFPKM-GETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN----------I  228
            ++N F    G+ K K + II VSSLILVAMV+A+  G       EE G+          I
Sbjct  1    MSNGFANAEGDKKKKKIAIISVSSLILVAMVVAVTVGVNNAPHGEEHGDDNHGSETTPEI  60

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
             +S KAI+++CQPTDYK+TC  SL +++AGN+TDPK L++  F +    +  AI NST L
Sbjct  61   TSSTKAIQAICQPTDYKETCEKSL-EAEAGNTTDPKELVKVGFKIATRSLNEAIKNSTTL  119

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            + L  D R+  ALQ C+EL   A+ DL ++  +  TF  M  +D ++ADLK W+SGA
Sbjct  120  KELAKDPRTNQALQNCRELLEYAIDDLNQSFERIGTFQ-MSKLDDFVADLKIWLSGA  175



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 98/156 (63%), Gaps = 5/156 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            K K   I GV+S +LVAMV+A+A+G   G     +     I TS K+++S+CQPTDY++ 
Sbjct  12   KKKKYAIFGVTSFLLVAMVIAVAYGINSGDHQDGSNPSAEITTSSKSVQSICQPTDYREI  71

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C  SL K+ AGN+TDP  L+QA F VTI  +++A+ NS+ L+ +  D  +K AL  CKEL
Sbjct  72   CEKSLRKA-AGNTTDPHKLVQAGFQVTIDALQQALQNSSTLKEVAKDPMAKQALDNCKEL  130

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
               A+ DLK +  +   FD+   MD +L +LK W+S
Sbjct  131  MDDAIHDLKVSFEEVGHFDV-SKMDEYLENLKIWLS  165



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQ  282
            M +   K + I+ V SL+LVAMV+AL         T+ E +++ SQK+I+++CQ TDY++
Sbjct  1    MADNPKKKIAIVSVCSLLLVAMVVALFTTRHGNGNTDGEQDVSASQKSIQTLCQNTDYQE  60

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
            TCVNSL+ S + NS+DPK LI+ AF   I  IR A +NST+   +  D R K AL++C+E
Sbjct  61   TCVNSLTSSGS-NSSDPKELIEIAFQAAIKQIRDAANNSTVFHEVEKDPRGKEALESCRE  119

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            LA RA++DL+R+  KF  FD+ D  +I LADLK W+SGA
Sbjct  120  LADRAINDLQRSFDKFNNFDITDVENI-LADLKIWLSGA  157



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 98/153 (64%), Gaps = 12/153 (8%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSL  300
            K + ++G SS++LVAMV+    GG           I+TS KAI+++CQPTDYK+ CVNSL
Sbjct  15   KKVALMGFSSILLVAMVVGTVAGG----------GISTSVKAIQAICQPTDYKEACVNSL  64

Query  301  SKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAV  480
            + + A N++DPK L++ AF V I  I  A+ NST LR+L  D R+K AL+ C EL   A+
Sbjct  65   TSAKA-NTSDPKELVRTAFQVAINQISSALQNSTTLRDLEKDPRTKGALENCHELMDYAI  123

Query  481  SDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             DL+ +  K   FD+   +D ++ DLK W+SGA
Sbjct  124  DDLRNSFNKLGVFDI-SKIDDYVEDLKIWLSGA  155



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 102/162 (63%), Gaps = 12/162 (7%)
 Frame = +1

Query  118  SKNMTIIGVSSLILVAMVLALAFG------GQet----seteeeGNIATSQKAIESVCQP  267
            +K + IIG+SS++LVAMV+A+  G      G+         +  G I+ S KAI+S+CQP
Sbjct  7    NKRLAIIGISSILLVAMVVAVTIGVGFSENGESEDITGKSHKSTGEISASMKAIKSICQP  66

Query  268  TDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMAL  447
             DYK+TC  SL KS AGN+TDPK LI+AAF +    IR A   S  L  L  D R++ AL
Sbjct  67   ADYKKTCEKSLEKS-AGNTTDPKELIKAAFKIAQKKIREAAKKSATLEELEKDPRTRDAL  125

Query  448  QTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            Q+CKEL   ++S+L+ +  K   FD+   +D ++ADL+TW+S
Sbjct  126  QSCKELMDMSISELQNSFDKVADFDIT-MLDDFMADLRTWLS  166



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 100/161 (62%), Gaps = 10/161 (6%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAF--------GGQetseteeeGNIATSQKAIESVCQPTDY  276
            K + ++G SS++LVAMV+                T + +  G I+TS KAI+++CQPTDY
Sbjct  15   KKVALMGFSSILLVAMVVGTVVTVNHRNGSSSSATDDAQAGGGISTSVKAIQAICQPTDY  74

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTC  456
            K+ CVNSL+ + A N++DPK L++ AF V I  I  A+ NST LR+L  D R+K AL+ C
Sbjct  75   KEACVNSLTSAKA-NTSDPKELVRTAFQVAINQISSALQNSTTLRDLEKDPRTKGALENC  133

Query  457  KELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             EL   A+ DL+ +  K   FD+   +D ++ DLK W+SGA
Sbjct  134  HELMDYAIDDLRNSFNKLGVFDI-SKIDDYVEDLKIWLSGA  173



>ref|XP_004494574.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=586

 Score =   126 bits (316),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 66/160 (41%), Positives = 106/160 (66%), Gaps = 7/160 (4%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLA----LAFGGQetseteee-GNIATSQKAIESVCQPTDYK  279
            K + + IIGVS+++LVAMV+A    + FG    +E   +  +I++S KA++++C+PTDY+
Sbjct  9    KKRRIAIIGVSTILLVAMVVAATVSVGFGKNVEAEDASKDSHISSSVKAVQTICEPTDYR  68

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            + C  SL+ + AGN TDP+ L++ AFN+TI  I   +  + LL  +  D+R+K AL TCK
Sbjct  69   KECEESLT-AQAGNITDPRELVKIAFNITITKISDGLSKTQLLHEVESDERTKEALDTCK  127

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +L   ++ + KR++ KF  FDL +++D  L  LK W+SGA
Sbjct  128  QLMNLSIDEFKRSLEKFSNFDL-NNLDRVLTSLKVWLSGA  166



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 103/169 (61%), Gaps = 11/169 (7%)
 Frame = +1

Query  91   SFPKMGETKSKNMTIIGVSSLILVAMVLALAFG-----GQetsetee---eGNIATSQKA  246
            S+   GE K K   +IG+SS++LVAMV+A+  G     GQ +  +        ++ S KA
Sbjct  2    SYGDDGE-KRKRYAVIGISSVLLVAMVIAVTVGVSLNNGQSSPASSNKDGSHEVSASMKA  60

Query  247  IESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDD  426
            I+S+CQPTDYK+ C+NSLS S++GN+TDPK LIQA F V +  +  A   S +L++L  D
Sbjct  61   IKSICQPTDYKEECINSLS-SESGNTTDPKKLIQAGFKVAMKYLSEAAKKSVVLQDLEKD  119

Query  427  KRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             R+  AL  CK+L   ++ DLK ++ K   FD+    D  L DLK W+S
Sbjct  120  PRASKALGHCKQLMENSIDDLKHSVDKLGEFDI-SKFDQMLMDLKIWLS  167



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 104/164 (63%), Gaps = 11/164 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---------GQetseteeeGNIATSQKAIESVCQP  267
            + + + IIGVSS++LVAMV+A+  G         G   S  +    ++ S KA++++CQP
Sbjct  9    RKRRLAIIGVSSMLLVAMVVAVTVGVGLNNDGNDGLNGSSHKSTSQVSASVKAVKAICQP  68

Query  268  TDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMAL  447
            TDY++TC  SL K+ AGN+TDPK LI+ AF +    I  A   S LL  L+ D R++ AL
Sbjct  69   TDYRKTCEESLQKA-AGNTTDPKELIKIAFKIAEKQINEASEKSKLLEELSKDPRTRGAL  127

Query  448  QTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            Q+CKEL   +V +LK+++ K   FDL  +++  +AD+KTW+S +
Sbjct  128  QSCKELMNMSVGELKQSLDKVTDFDL-SELEKMMADVKTWLSAS  170



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 106/160 (66%), Gaps = 6/160 (4%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLAL-AFGGQetseteeeGNIATSQKAIESVCQPTDYK  279
            M E+K K +TI+ V S +LVAMV+AL A G Q+  +  +  ++++S+KAI S+C+ TDY+
Sbjct  1    MDESK-KKITIVAVCSCLLVAMVVALIAVGLQDEDKEVQ--DVSSSKKAITSLCETTDYQ  57

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            + CV SL+ S   NST+PK LI A F   I  I+ A  NST+L  L  D R+K AL+ C+
Sbjct  58   EACVESLNAS-GTNSTNPKDLIDAIFQSAIDYIKEASKNSTVLLELQTDPRAKAALENCQ  116

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ELA RAV DL+R+   F  FD+  +MD  L +LK W+SGA
Sbjct  117  ELADRAVHDLERSFQSFNNFDIT-NMDDLLLELKIWLSGA  155



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 106/161 (66%), Gaps = 10/161 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAF--------GGQetseteeeGNIATSQKAIESVCQPT  270
            + K   +IGVSS+ILVAMV+A+A         GG+ +  +   G ++TS K+I+++CQPT
Sbjct  16   RKKKFAVIGVSSIILVAMVVAVAVGVNDGKEKGGESSPLSGSSGQLSTSTKSIQAICQPT  75

Query  271  DYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQ  450
            DYKQTC +SL+K+ AGN++DP  L+QA F V I  ++ AI NST L+ +  D  +K AL 
Sbjct  76   DYKQTCEDSLNKA-AGNTSDPHKLVQAGFQVAIDALKVAIENSTTLKEVAKDPMAKQALD  134

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             CKEL   A+SDLK +  +   FD+   +D ++A+LK W+S
Sbjct  135  NCKELMNTAISDLKTSFQQVGDFDI-SKLDEYVANLKIWLS  174



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 106/165 (64%), Gaps = 9/165 (5%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIESVCQ  264
            G  + K + IIG S+LILVAMV+A+A G        Q  + T    +++T+ KAI+++CQ
Sbjct  10   GGQRKKKIAIIGTSALILVAMVVAVAVGFNRSESDSQSAAPTSPPPSVSTTTKAIQAICQ  69

Query  265  PTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMA  444
            PTDY++TC NSL+ S AGN++DPK LI+AAFNV I  I  AI NS+ L+ L  D R+  A
Sbjct  70   PTDYRETCENSLT-SAAGNTSDPKELIKAAFNVAIDHISAAIRNSSTLKELAKDSRTNQA  128

Query  445  LQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L  C EL   A+ DLK +  +   F+  + +D ++ DLK W+SGA
Sbjct  129  LSNCDELLKYAIDDLKESFDRIGPFEY-EKLDEYVDDLKIWLSGA  172



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN-----IATSQKAIESVCQPTDYK  279
            K K + IIG SS+ LVAMV+A+      +S + + GN     I++S KAI+++CQPTDYK
Sbjct  12   KKKKLAIIGFSSIFLVAMVIAVI--ASVSSSSSDSGNAQKQEISSSMKAIQAICQPTDYK  69

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
              CVNSL+ S AGN+TDPK L+QAAF   +  +  A  NSTLL+ LN D R+  ALQ C+
Sbjct  70   DACVNSLT-SKAGNTTDPKDLVQAAFASAMEHLSAAAKNSTLLQELNKDPRASQALQNCE  128

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            +L   A+ DLK++  +   FD    MD  +AD+K W+S
Sbjct  129  DLVNYAIDDLKKSFNQVGDFDY-SKMDNIIADIKIWLS  165



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 104/165 (63%), Gaps = 9/165 (5%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAF-------GGQetseteeeGNIATSQKAIESVCQ  264
            G+ + K + IIGVS+ +LVAMV+A+         G  E      + ++A+S KA++++C 
Sbjct  3    GDAQKKRIVIIGVSTFLLVAMVVAVTVSVGLNNKGASEDETEARKSHVASSMKAVKTLCA  62

Query  265  PTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMA  444
            PTDY++ C +SL++ +AGN TDP+ LI+ AFN+TI  I   +  + LL ++  D R+K A
Sbjct  63   PTDYQKECEDSLNE-NAGNITDPRELIKLAFNITITRISDGLGKTQLLHDVESDPRTKEA  121

Query  445  LQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L TCK+L   ++ +  R++ +F  F+L + +D  L  LK W+SGA
Sbjct  122  LDTCKQLMHLSIEEFNRSLQRFNKFEL-NSLDRILTSLKVWLSGA  165



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN-----IATSQKAIESVCQPTDYK  279
            K K + IIG SS+ LVAMV+A+      +S + + GN     I++S KAI+++CQPTDYK
Sbjct  12   KKKKLAIIGFSSIFLVAMVIAVI--ASVSSSSSDSGNAQKQEISSSMKAIQAICQPTDYK  69

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
              CVNSL+ S AGN+TDPK L+QAAF   +  +  A  NSTLL+ LN D R+  ALQ C+
Sbjct  70   DACVNSLT-SKAGNTTDPKDLVQAAFASAMEHLSAAAKNSTLLQELNKDPRASQALQNCE  128

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            +L   A+ DLK++  +   FD    MD  +AD+K W+S
Sbjct  129  DLVNYAIDDLKKSFNQVGDFDY-SKMDNIIADIKIWLS  165



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 100/160 (63%), Gaps = 4/160 (3%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFGGQet--seteeeGNIATSQKAIESVCQPTDYK  279
            G  K K   IIG S+LILVAMV+A+  GG  +       +G+ +TS KAI+++CQPTDYK
Sbjct  6    GSNKKKKFAIIGASALILVAMVVAVTVGGTVSRRGGGSSDGHTSTSTKAIQAICQPTDYK  65

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            +TC  SLS + AGN TDPK LI+  F VT+  +R  I  ST L++L  D  +  ALQ CK
Sbjct  66   KTCEESLSGA-AGNVTDPKELIKVGFQVTMDMLRGVIEKSTTLKDLAKDPSTGDALQNCK  124

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            EL   A+ DL  +  +   FD M  +D+++ DLK W+S A
Sbjct  125  ELLEYAIDDLGDSFDRIGAFD-MSKLDLYVEDLKVWLSAA  163



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 101/161 (63%), Gaps = 5/161 (3%)
 Frame = +1

Query  106  GETKSKN-MTIIGVSSLILVAMVLALAFGGQetseteeeG--NIATSQKAIESVCQPTDY  276
            GE ++K  M IIGVS+LILVAMV+A+  G   +    + G    +TS KAI+S+CQPTDY
Sbjct  4    GEVQNKKKMAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDY  63

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTC  456
            K+TC ++LSK  A N TDPK L++A F V I  +R  I NST L+ L  D R+  ALQ C
Sbjct  64   KKTCEDNLSKV-ASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPRANQALQNC  122

Query  457  KELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            KEL   A+ DL  +  K   FD    +D ++ DLK W+S A
Sbjct  123  KELLEYAIDDLGDSFDKLGPFDFT-KLDAYVEDLKVWLSAA  162



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 97/165 (59%), Gaps = 9/165 (5%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALA------FGGQetseteeeGNIATSQKAIESVCQ  264
            MG    K   I+GVSS++LVA V+          G +  +       ++TS K++ESVC+
Sbjct  1    MGSEGKKKAAILGVSSILLVAAVVGTVTYSVGRHGTETATSGGGSDQVSTSSKSVESVCK  60

Query  265  PTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMA  444
              DYKQTC  SLS   A N++DP+ LI+ AF   + +I   I NSTLL+N   D R+  A
Sbjct  61   HVDYKQTCEQSLS--GAKNTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQA  118

Query  445  LQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L+TCK     ++ DL+R+     TFD+ + +D ++ADLKTW+S A
Sbjct  119  LETCKYALNTSIEDLQRSFETVGTFDI-NKIDDYVADLKTWLSAA  162



>gb|AGT17860.1| pollen-specific pectin methylesterase [Pisum sativum]
Length=584

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 103/163 (63%), Gaps = 9/163 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQets-------eteeeGNIATSQKAIESVCQPTD  273
            K + + IIGVSSL+LVAMV+A+  G            E   + +++++ +A++++CQPTD
Sbjct  9    KGRRIAIIGVSSLLLVAMVIAVTVGANRNQNGFDDDIENNRKNHVSSTMRAVQTICQPTD  68

Query  274  YKQTCVNSLS-KSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQ  450
            YK+ CV++L+ +++AGN TDPK LI+ AFNVT+  I   I  + L+  +  D RSK A+ 
Sbjct  69   YKKECVDTLTAEAEAGNVTDPKELIKIAFNVTMKKIGEQIKATDLMHEVEKDPRSKDAID  128

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            TCK+L   ++ +  R +     FDL  D+D  L +LK W++GA
Sbjct  129  TCKQLMDLSIGEFARAMDGIDQFDL-KDIDRILMNLKVWLNGA  170



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 101/161 (63%), Gaps = 5/161 (3%)
 Frame = +1

Query  106  GETKSKN-MTIIGVSSLILVAMVLALAFGGQetseteeeG--NIATSQKAIESVCQPTDY  276
            GE ++K  M IIGVS+LILVAMV+A+  G   +    + G    +TS KAI+S+CQPTDY
Sbjct  7    GEAQNKKKMAIIGVSALILVAMVVAVTVGVTVSRHQGKSGGEQTSTSTKAIQSICQPTDY  66

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTC  456
            K+TC ++LSK  A N TDPK L++A F V I  +R  I NST L+ L  D R+  ALQ C
Sbjct  67   KKTCEDNLSKV-ASNVTDPKELVKAGFQVAIGQLREVIKNSTTLKALAKDSRANQALQNC  125

Query  457  KELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            KEL   A+ DL  +  K   FD    +D ++ DLK W+S A
Sbjct  126  KELLEYAIDDLGDSFDKLGPFDFT-KLDSYVEDLKVWLSAA  165



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 96/160 (60%), Gaps = 11/160 (7%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAF---GGQetseteeeGNIATSQKAIESVCQPTDYK  279
            E + + M II  SS++LVAM + L     GG +        +++ SQ+AI S+C  TDY+
Sbjct  2    EDRKRKMGIIAASSVVLVAMAVILVVACTGGNDEKPP----DVSASQRAIMSICDTTDYQ  57

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            QTC++SL+     NS+DPK LI+ A   +I  I  A+ NST + +     R ++AL+TC+
Sbjct  58   QTCLDSLA---GHNSSDPKALIEVAIQSSINHIEEAVKNSTAIHDAEKTPRGRLALETCR  114

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ELA RAV DL R+   F  FD+    D+ L +LK W+SGA
Sbjct  115  ELANRAVDDLDRSFGTFDDFDITSVADVPL-ELKIWLSGA  153



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 99/163 (61%), Gaps = 9/163 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetsete-------eeGNIATSQKAIESVCQPTD  273
            K + + IIGVS+L+LVAMV+A+  G               +  +IA++ KA++++C PT+
Sbjct  8    KGRRIAIIGVSTLLLVAMVVAVTVGANRNQNGYDDDIEDNQRNHIASTMKAVQTICHPTE  67

Query  274  YKQTCVNSL-SKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQ  450
            YK+ C  +L +++ A N TDPK LI+ AFNVT+  I   I  + L+  +  D RSK AL 
Sbjct  68   YKKECEETLVAEAQADNVTDPKELIKIAFNVTMRRISEKIKETDLMHEVEKDPRSKDALD  127

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            TCK+L   ++ +  R++  F  FDL  DMD  L +LK W++GA
Sbjct  128  TCKQLMDLSIGEFTRSLDGFSQFDLQ-DMDKILMNLKVWLNGA  169



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 101/161 (63%), Gaps = 5/161 (3%)
 Frame = +1

Query  106  GETKSKN-MTIIGVSSLILVAMVLALAFGGQetseteeeG--NIATSQKAIESVCQPTDY  276
            GE ++K  + IIGVS+LILVAMV+A+  G   +    + G    +TS KAI+S+CQPTDY
Sbjct  4    GEVQNKKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDY  63

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTC  456
            K+TC ++LSK  A N TDPK L++A F V I  +R  I NST L+ L  D R+  ALQ C
Sbjct  64   KKTCEDNLSKV-ASNVTDPKELVKAGFQVAIGQLREVIKNSTTLKELAKDSRANQALQNC  122

Query  457  KELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            KEL   A+ DL  +  K   FD    +D ++ DLK W+S A
Sbjct  123  KELLEYAIDDLGDSFDKLGPFDFT-KLDSYVEDLKVWLSAA  162



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 102/163 (63%), Gaps = 8/163 (5%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFG------GQetseteeeGNIATSQKAIESVCQPT  270
              K K   IIGVSS+ILVAMV+A+  G      G    +  + G++ TS KAI+++CQPT
Sbjct  5    HNKKKKFAIIGVSSVILVAMVVAVTVGVTAKNKGGGGHKNSDGGHVTTSTKAIKAICQPT  64

Query  271  DYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQ  450
            DYK+TC  SL +S AGNST+PK LI+A FNVT+  +R  I NST L+ L  D+ +  AL+
Sbjct  65   DYKETCERSL-ESAAGNSTEPKDLIKAGFNVTMDKLRAIIKNSTTLQELAKDESTNQALE  123

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             CKEL   A+ D+  +  K   FD+   +D +  DLK W+S A
Sbjct  124  NCKELLEYAIDDITTSFQKLGPFDI-SKIDDYAEDLKVWLSAA  165



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 98/159 (62%), Gaps = 4/159 (3%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeG--NIATSQKAIESVCQPTDYKQ  282
            + K K + IIGVS+LILVAMV+A+  G   +    + G    +TS KAI+S+CQPTDYK+
Sbjct  7    QNKRKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDYKK  66

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
            TC ++LSK  A N TDPK L++A F V I  +R  I NST L+ L  D  S  ALQ CKE
Sbjct  67   TCEDNLSKV-ASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPSSNQALQNCKE  125

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L   A+ DL  +  K   FD    +D ++ DLK W+S A
Sbjct  126  LLEYAIDDLGDSFDKLGPFDFT-KLDAYVEDLKVWLSAA  163



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 103/166 (62%), Gaps = 14/166 (8%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAF---------GGQetseteeeGNIATSQKAIESVC  261
              K K   IIGVSS+ILVAMV+A+           GG + S+    G++ TS KAI+++C
Sbjct  5    HNKKKKFAIIGVSSVILVAMVVAVTVGVTTKNKVGGGHKNSDG---GHVTTSTKAIKAIC  61

Query  262  QPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKM  441
            QPTDYK+TC  SL +S AGNST+PK LI+A FNVT+  +R  I NST L+ L  D+ +  
Sbjct  62   QPTDYKETCERSL-ESAAGNSTEPKDLIKAGFNVTMDKLRAIIKNSTTLQELAKDESTNQ  120

Query  442  ALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            AL+ CKEL   A+ DL  +  K   FD+   +D +  DLK W+S A
Sbjct  121  ALENCKELLEYAIDDLTTSFQKLGPFDI-SKIDDYAEDLKVWLSAA  165



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 102/164 (62%), Gaps = 11/164 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---------GQetseteeeGNIATSQKAIESVCQP  267
            + + + IIGVSS++LVAMV+A+  G             S  +    ++ S KA++++CQP
Sbjct  9    RKRRLAIIGVSSMLLVAMVVAVTVGVGLNNDGNDDLNGSSHKSTSQVSASVKAVKAICQP  68

Query  268  TDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMAL  447
            TDY++TC  SL K+ AGN+T+PK LI+ AF +    I  A   S LL  L+ D R++ AL
Sbjct  69   TDYRKTCEESLQKA-AGNTTNPKELIKIAFKIAEKQINEASEKSKLLEELSKDARTRGAL  127

Query  448  QTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            Q+CKEL   +  +LK+++ K   FDL  +++  +AD+KTW+S +
Sbjct  128  QSCKELMNMSAGELKQSLNKVTDFDL-SELETLMADVKTWLSAS  170



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 92/159 (58%), Gaps = 6/159 (4%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG----GQetseteeeGNIATSQKAIESVCQPTDYKQ  282
            K K + II VSSL LVAMV+A+  G      +      +G   TS KAI+++CQPTDYK+
Sbjct  7    KKKKIAIIAVSSLFLVAMVIAVTVGVTTSWSKGGSKSNDGQTTTSTKAIQAICQPTDYKE  66

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
            TC  SL +S   NST+PK LI+A F V +  +   I NST L+ L  D  +  AL+ CKE
Sbjct  67   TCQKSL-ESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQELAKDPGANQALENCKE  125

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L   A+ DL  +  K   FD+   +D +  DLK W+S A
Sbjct  126  LLDYAIGDLAASFDKLGPFDI-SKIDAYAEDLKIWLSAA  163



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 92/159 (58%), Gaps = 6/159 (4%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG----GQetseteeeGNIATSQKAIESVCQPTDYKQ  282
            K K + II VSSL LVAMV+A+  G      +      +G   TS KAI+++CQPTDYK+
Sbjct  7    KKKKIAIIAVSSLFLVAMVIAVTVGVTTSRSKGGSKSNDGQTTTSTKAIQAICQPTDYKE  66

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
            TC  SL +S   NST+PK LI+A F V +  +   I NST L+ L  D  +  AL+ CKE
Sbjct  67   TCQKSL-ESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQELAKDPGANQALENCKE  125

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L   A+ DL  +  K   FD+   +D +  DLK W+S A
Sbjct  126  LLDYAIGDLAASFDKLGPFDI-SKIDAYAEDLKIWLSAA  163



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 102/159 (64%), Gaps = 6/159 (4%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALA----FGGQetseteeeGNIATSQKAIESVCQPTDYKQ  282
            K + + IIGVS+ +LVAMV+A+     FG  ++ +     ++A++ KA++S C PTDYK+
Sbjct  8    KRRRIVIIGVSTFLLVAMVVAVTVGVNFGANDSKDNNGNTHMASTVKAVKSFCHPTDYKK  67

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
             C  ++  ++AGN+TD + LI+ AFNVT+  I   I  + LL  +  + R+KMAL TCK+
Sbjct  68   ECEENVI-ANAGNTTDSRELIKIAFNVTVTKISDGIKKTNLLHEVEKEPRAKMALDTCKQ  126

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L   ++ +  R+I   + FDL ++++  L +LK W+SGA
Sbjct  127  LMDLSIGEFDRSIEGIKNFDL-NNLENILVNLKVWLSGA  164



>ref|XP_003626199.1| Pectinesterase [Medicago truncatula]
 gb|AES82417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=593

 Score =   118 bits (295),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 65/161 (40%), Positives = 104/161 (65%), Gaps = 8/161 (5%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG------GQetseteeeGNIATSQKAIESVCQPTDY  276
            ++K + IIGVS+ +LVAMV+A+          +   ET +E +++ S KA++++C PTDY
Sbjct  9    RNKRLAIIGVSTFLLVAMVVAVTVNVGFNNKKEPGEETSKESHVSQSVKAVKTLCAPTDY  68

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTC  456
            K+ C +SL  + AGN T+PK LI+ AFN+TIA I   +  + LL+    D+R+K AL TC
Sbjct  69   KKECEDSLI-AHAGNITEPKELIKIAFNITIAKISEGLKKTHLLQEAEKDERTKQALDTC  127

Query  457  KELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            K++   ++ + +R++ +F  FDL + +D  L  LK W+SGA
Sbjct  128  KQVMQLSIDEFQRSLERFSNFDL-NSLDRVLTSLKVWLSGA  167



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            +TS K+I+S+C+PTDY++TCV SLS +  GNSTDPK LI+  F V I  ++ AI NST++
Sbjct  59   STSMKSIQSICEPTDYRETCVKSLSAA-GGNSTDPKDLIRTGFQVAINQVKAAIENSTVV  117

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++L  D RSK AL+TC+ L   ++ DL+ +  +   FD+  ++D ++ADL  W+SGA
Sbjct  118  KDLAKDPRSKQALETCQHLLEYSIDDLQSSFERLGAFDV-SNLDKYMADLHVWLSGA  173



>gb|KHN03958.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=580

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 105/165 (64%), Gaps = 9/165 (5%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAF-------GGQetseteeeGNIATSQKAIESVCQ  264
            G+ + K + IIGVS+ +LVAMV+A+         G    S+ E + ++A+S KA++++C 
Sbjct  3    GDAQKKRIAIIGVSTFLLVAMVVAVTVSINLNNKGSSYDSKEESKSSVASSIKAVKTLCA  62

Query  265  PTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMA  444
            PTDYK+ C +SL +  + N TDP+ LI+ AF+VTI+ I   +  + L+  + +D R+K A
Sbjct  63   PTDYKKECEDSLIEH-SNNITDPRELIKIAFHVTISKIGEGLEKTELMHQVENDPRTKEA  121

Query  445  LQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L TCK+L   ++ +  R++ +F  FDL +++D  L  LK W+SGA
Sbjct  122  LDTCKQLMNLSIGEFTRSLDRFTKFDL-NNLDNILTSLKVWLSGA  165



>ref|XP_003557034.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=402

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 103/162 (64%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIESVCQPTD  273
            K K + IIGVS+L+LVAMV+A+  G            E  ++ ++A+S KA++++C PT+
Sbjct  8    KGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKDHVASSIKAVQTLCHPTN  67

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            Y++ C  SL  + AGN+TDPK LI+  FN+TI  I   +  + +L  + ++ R+KMAL T
Sbjct  68   YEKECEESLI-AGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMALDT  126

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            CK+L   ++ +L R++     F+L+ ++D  L +LK W+SGA
Sbjct  127  CKQLMDLSIGELTRSLDGINEFNLI-NVDKILMNLKVWLSGA  167



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 102/163 (63%), Gaps = 9/163 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALA---FGGQets----eteeeGNIATSQKAIESVCQPTD  273
            K + + IIGVS+L+LVAMV+A+    +G Q       E   + +IA++ KA++++C PTD
Sbjct  8    KGRRIAIIGVSTLLLVAMVVAVTVGTYGDQNGYDDNIEDTRKNHIASTMKAVQTICHPTD  67

Query  274  YKQTCVNSL-SKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQ  450
            YK+ C  +L ++++A N TDPK LI+ AFNVT+  I   I  + LL  +  D RSK AL 
Sbjct  68   YKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKETDLLHEVEKDPRSKDALD  127

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            TCK+L   ++ +  R++     FDL  D+D  L +LK W++GA
Sbjct  128  TCKQLMDLSIEEFTRSLDGINEFDL-KDIDKILMNLKVWLNGA  169



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 100/168 (60%), Gaps = 9/168 (5%)
 Frame = +1

Query  97   PKMGETKSKNMTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIES  255
            P+  E K K + IIG S++IL+ MV+    G           S     G + T+ KAI+S
Sbjct  13   PRNPEQKKKKLAIIGGSAVILLCMVVGAVVGVSHHNSSSDGGSSNSGGGRLVTTSKAIKS  72

Query  256  VCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRS  435
            +CQPTDYK  C +SL+ + AGN++DPK L++AAFNVTI  IR A ++S++L+    D R+
Sbjct  73   ICQPTDYKDICESSLTHA-AGNTSDPKALVEAAFNVTIDYIRDAFNHSSVLQAAAKDPRT  131

Query  436  KMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              AL  CKEL   AV +L+ +  KF   ++   +D  + DLK W+S A
Sbjct  132  SDALDDCKELLDYAVDELRNSFTKFGQLEI-SKIDEIIDDLKIWLSAA  178



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 4/155 (3%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFGGQetseteeeG--NIATSQKAIESVCQPTDYKQTCVN  294
            K + IIGVS+LILVAMV+A+  G   +    + G    +TS KAI+S+CQPTDYK+TC +
Sbjct  11   KKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDYKKTCED  70

Query  295  SLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGR  474
            +LSK  A N TDPK L++A F V I  +R  I NST L+ L  D  +  ALQ CKEL   
Sbjct  71   NLSKV-ASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPSANQALQNCKELLEY  129

Query  475  AVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            A+ DL  +  K   FD    +D ++ DLK W+S A
Sbjct  130  AIDDLGDSFDKLGPFDFT-KLDAYVGDLKVWLSAA  163



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 12/163 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLAL----------AFGGQetseteeeGNIATSQKAIESVCQ  264
            K K + +I  SSLILVAMV+A+          A G  E+   +  G+I +S KAI+++CQ
Sbjct  12   KKKRIAVISASSLILVAMVVAVAVGVNHNTSDASGDGESVSKDSGGDIQSSMKAIKAICQ  71

Query  265  PTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMA  444
            PTDYK+TCV SLS S AGN+TDPK L++  F V +  IR A+  S  L+ +  D R+K A
Sbjct  72   PTDYKETCVQSLS-SAAGNTTDPKELVRVGFQVAMKHIREALSQSETLKEVEKDPRAKQA  130

Query  445  LQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            L +C+EL   A+ DLK +  K   FD+   +D  LADLK W++
Sbjct  131  LLSCQELMDYAIDDLKNSFDKLGAFDI-SKVDNILADLKVWLT  172



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 95/158 (60%), Gaps = 9/158 (6%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFG---GQetseteeeGN----IATSQKAIESVCQPTDYK  279
            K   IIGVSS++LVAMV+A+  G    Q+ +     GN    I++S KAI+++CQPTDYK
Sbjct  12   KRYAIIGVSSMLLVAMVVAVTVGVNLNQDETSDPATGNKSHEISSSMKAIKAICQPTDYK  71

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            Q CV SL K+   NS+DPK L+QA F   +  I+ A + S  L  L  D R+  AL  CK
Sbjct  72   QECVASL-KATGNNSSDPKELVQAGFKAAMKLIQAAANKSVALNQLEKDPRASKALAGCK  130

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            EL   A+ +LK ++ K   FD+   +D  L D++ W+S
Sbjct  131  ELMDFAIDELKYSMNKLGEFDI-SKLDEMLIDIRIWLS  167



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 104/162 (64%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIESVCQPTD  273
            K K + IIGVS+L+LVAMV+A+  G           +E  ++ ++ +S KA++++C PT+
Sbjct  8    KGKRIAIIGVSALLLVAMVVAITVGVNLNENGSNNDTEDNKKNHVVSSIKAVQTLCHPTN  67

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            YK+ C  SL  + AGN+TDPK LI+  FN+TI  I   +  + +L  + ++ R+KMAL+T
Sbjct  68   YKKECEESLI-AGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEVEEEPRAKMALET  126

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            CK+L   ++ +L R++     F+L+ ++D  L +LK W+SGA
Sbjct  127  CKQLMDLSIGELTRSLDGIGEFNLI-NVDKILMNLKVWLSGA  167



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 97/155 (63%), Gaps = 6/155 (4%)
 Frame = +1

Query  127  MTIIGVSSLILVAMVLALAFG----GQetseteeeGNIATSQKAIESVCQPTDYKQTCVN  294
            + IIG S+ IL+ MV+    G          + +     T+ KAI+S+CQPTDYK+ C +
Sbjct  25   LAIIGGSAAILLCMVVGAVIGVSRYNSSKGGSSDSRGFTTTSKAIKSICQPTDYKEICES  84

Query  295  SLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGR  474
            SL+K+ AGN++DPKVL++AAFNVTI+ IR A  +S++L+    D R+  AL  CK+L   
Sbjct  85   SLTKA-AGNASDPKVLVEAAFNVTISYIRDAFDHSSVLQATAKDPRTSDALDDCKKLLDY  143

Query  475  AVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            A+ +L+ +  KF   D M+ +D  + DLK W+S A
Sbjct  144  AIDELRNSFTKFGQLD-MNHVDDVIDDLKIWLSAA  177



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 103/162 (64%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIESVCQPTD  273
            K K + IIGVS+L+LVAMV+A+  G            E  ++ ++A+S KA++++C PT+
Sbjct  8    KGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLCHPTN  67

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            Y++ C  SL  + AGN+TDPK LI+  FN+TI  I   +  + +L  + ++ R+KMAL T
Sbjct  68   YEKECEESLI-AGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMALDT  126

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            CK+L   ++ +L R++     F+L+ ++D  L +LK W+SGA
Sbjct  127  CKQLMDLSIGELTRSLDGINEFNLI-NVDKILMNLKVWLSGA  167



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 103/162 (64%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIESVCQPTD  273
            K K + IIGVS+L+LVAMV+A+  G            E  ++ ++A+S KA++++C PT+
Sbjct  8    KGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLCHPTN  67

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            Y++ C  SL  + AGN+TDPK LI+  FN+TI  I   +  + +L  + ++ R+KMAL T
Sbjct  68   YEKECEESLI-AGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMALDT  126

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            CK+L   ++ +L R++     F+L+ ++D  L +LK W+SGA
Sbjct  127  CKQLMDLSIGELTRSLDGINEFNLI-NVDKILMNLKVWLSGA  167



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 103/162 (64%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIESVCQPTD  273
            K K + IIGVS+L+LVAMV+A+  G            E  ++ ++A+S KA++++C PT+
Sbjct  8    KGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLCHPTN  67

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            Y++ C  SL  + AGN+TDPK L++  FN+TI  I   +  + +L  + ++ R+KMAL T
Sbjct  68   YEKECEESLI-AGAGNTTDPKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMALDT  126

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            CK+L   ++ +L R++     F+L+ ++D  L +LK W+SGA
Sbjct  127  CKQLMDLSIGELTRSLDGINEFNLI-NVDKILMNLKVWLSGA  167



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 103/162 (64%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIESVCQPTD  273
            K K + IIGVS+L+LVAMV+A+  G            E  ++ ++A+S KA++++C PT+
Sbjct  8    KGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKDHVASSIKAVQTLCHPTN  67

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            Y++ C  SL  + AGN+TDPK LI+  FN+TI  I   +  + +L  + ++ R+KMAL T
Sbjct  68   YEKECEESLI-AGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEVEEEPRAKMALDT  126

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            CK+L   ++ +L R++     F+L+ ++D  L +LK W+SGA
Sbjct  127  CKQLMDLSIGELTRSLDGINEFNLI-NVDKILMNLKVWLSGA  167



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 107/164 (65%), Gaps = 11/164 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGN------IATSQKAIESVCQP  267
            + + + +IG+SS +LVAMV+A++ G   G + +E   + N      ++ S KA++++CQP
Sbjct  9    RKRRIAVIGISSFLLVAMVVAVSVGVGLGNDGNEDLNDSNHKSTNQVSASMKAVKAICQP  68

Query  268  TDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMAL  447
            TDY++TC  +L K+ AGN+TDP+ LI+ AF +    +  A   S +L  L+ D R++ AL
Sbjct  69   TDYRKTCEENLQKA-AGNTTDPRELIKMAFKIAEKHVNEASKKSKVLEELSKDPRTRGAL  127

Query  448  QTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            Q+C+EL   +V +LK+++ K   FD+  +++  +AD+KTW+S +
Sbjct  128  QSCRELMTMSVDELKQSLNKVTDFDIT-EIEKLMADVKTWLSAS  170



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 103/162 (64%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIESVCQPTD  273
            K K + IIGVS+L+LVAMV+A+  G            E  ++ ++A+S KA++++C PT+
Sbjct  13   KGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLCHPTN  72

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            Y++ C  SL  + AGN+TDPK L++  FN+TI  I   +  + +L  + ++ R+KMAL T
Sbjct  73   YEKECEESLI-AGAGNTTDPKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMALDT  131

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            CK+L   ++ +L R++     F+L+ ++D  L +LK W+SGA
Sbjct  132  CKQLMDLSIGELTRSLDGINEFNLI-NVDKILMNLKVWLSGA  172



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 98/159 (62%), Gaps = 11/159 (7%)
 Frame = +1

Query  127  MTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKA---IESVCQPTDYKQTCVNS  297
            + +  VSSL+LVAMV+AL + G+         ++A SQKA   I+++C  TDYK+ CV++
Sbjct  2    VAVAAVSSLLLVAMVVALMYNGRGDDAGGGGVDVAASQKAMVTIDTLCSSTDYKKACVDT  61

Query  298  LSKSDAGNST-DPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGR  474
            L   D+GNST DPK L++ AF  T+  I  A  NS++LR +  D R + A+  C ELA R
Sbjct  62   LR--DSGNSTSDPKELMEIAFRATMDRIAAAGRNSSVLREVQRDPRGREAVDACAELAER  119

Query  475  AVSDLKRTIAK----FRTFDLMDDMDIWLADLKTWISGA  579
            AV+DL RT  K    F  FDL  + D  + DLK W+SGA
Sbjct  120  AVADLNRTFEKFSKEFSEFDLT-NADEVVGDLKIWLSGA  157



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 105/164 (64%), Gaps = 11/164 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG------GQet---seteeeGNIATSQKAIESVCQP  267
            + + + +IG+SS +LVAMV+A++ G      G E    S  +    ++ S KA++++CQP
Sbjct  9    RKRRIAVIGISSFLLVAMVVAVSVGVGLGNNGNEDLNDSSHKSTNQVSASMKAVKAICQP  68

Query  268  TDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMAL  447
            TDY++TC  +L K+ AGN+TDP+ LI+ AF +    +  A   S +L  L+ D R++ AL
Sbjct  69   TDYRKTCEENLQKA-AGNTTDPRELIKMAFKIAEKHLNEASKKSKVLEELSKDPRTRGAL  127

Query  448  QTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            Q+CKEL   +V +LK+++ K   FD+  +++  +AD+KTW+S +
Sbjct  128  QSCKELMTMSVDELKQSLNKVTDFDIT-EIEKLMADVKTWLSAS  170



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 99/165 (60%), Gaps = 12/165 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLA----LAFGGQetseteeeG------NIATSQKAIESVCQ  264
            + K + IIGVSS +LVAMV+A    + F     SE +  G       ++ S KAI+++CQ
Sbjct  9    RKKRLAIIGVSSFLLVAMVVAVTVSIGFNNDGESEDDINGKNHKSKEVSASMKAIKTLCQ  68

Query  265  PTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMA  444
            PT YKQTC  SL+KS AGN+TDPK LI+ AF +    I  A   S  L  L  D R++ A
Sbjct  69   PTYYKQTCERSLAKS-AGNTTDPKELIKIAFKLAEKQIDSASKKSLTLLELEKDPRTRGA  127

Query  445  LQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L +CKEL   ++++L+ ++ K   FD    +D  +AD+KTW+S A
Sbjct  128  LNSCKELMTMSINELRSSLEKVADFDF-SQLDELMADIKTWLSAA  171



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 101/161 (63%), Gaps = 4/161 (2%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVL--ALAFGGQetseteeeGNIATSQKAIESVCQPTDY  276
            M E   K + I G++S++LVA V+  A+ F  +    T   G I++S K+++++CQPT Y
Sbjct  1    MAEAGKKKIVIAGIASILLVACVVGAAVTFTKKNDDSTSNGGEISSSTKSVQAMCQPTQY  60

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTC  456
            K+TC  SL    A N+T+PK LI+AAF+ T+ +I  +I NS   +   +D R+K AL+ C
Sbjct  61   KETCAKSLG--SAKNTTNPKELIKAAFDNTLTEITNSIKNSAPFKEAANDPRTKNALKVC  118

Query  457  KELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             E+  R++ ++KR+ +K  + DL   +  ++ D+++W+S A
Sbjct  119  DEVLDRSIEEIKRSFSKIDSNDLDKLIKEYIYDVRSWLSSA  159



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 97/166 (58%), Gaps = 13/166 (8%)
 Frame = +1

Query  103  MGETKSKNMTII--GVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIES  255
            MG++      II  G++S++LVAMV+ +  G       G   +     G ++TS KA+++
Sbjct  1    MGDSDGNKKKIIVGGMASVLLVAMVVCVTIGVSGRNSGGDAAASNSGGGGVSTSTKAVQA  60

Query  256  VCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRS  435
            +C PTDYK+TC +SLS +   N+TDPK LI+ AFN  + +I  AI NSTL ++   D  +
Sbjct  61   ICSPTDYKETCESSLSGA---NTTDPKELIRLAFNAAVNNIGDAIKNSTLFKDAAADSST  117

Query  436  KMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            K A   C ++ G A+ DLKR   K   FD    +D ++ DLK W+S
Sbjct  118  KDAFDICDDVLGSAIDDLKRAGDKVGEFDAT-KVDEYVEDLKVWLS  162



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 105/164 (64%), Gaps = 11/164 (7%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFG-----GQet--seteeeGNIATSQKAIESVCQP  267
            ++K K M + G+ S++LVAMV+A+A G     G ET  + T   G ++ + KA++++C P
Sbjct  4    DSKKKKMAVAGLCSILLVAMVVAVAVGIPKKNGDETDDAPTNGGGGVSATTKAVQAICSP  63

Query  268  TDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMAL  447
            TDYKQTC  SLS     NSTDPK LI+ AF  T+ +I+ +I NSTL ++   D+R+K AL
Sbjct  64   TDYKQTCTESLS---GANSTDPKELIKVAFEYTVKNIKESIKNSTLYKDAAADERTKGAL  120

Query  448  QTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              C E+   ++ DL+R+  K   FD M  +D  + D+KTW+SGA
Sbjct  121  DVCSEVLNTSIEDLERSFEKIGEFD-MSKVDDLVDDVKTWLSGA  163



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 96/158 (61%), Gaps = 9/158 (6%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFG---GQetseteeeGN----IATSQKAIESVCQPTDYK  279
            K   IIGVSS++LVAMV+A+  G    Q+ +     GN    I++S KAI+++CQPTDYK
Sbjct  12   KRYAIIGVSSMLLVAMVVAVTVGVNLNQDETSDPATGNKSHEISSSMKAIKAICQPTDYK  71

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            Q C+ SL K+   NS+DP+ L+QA F   +  I+ A + S  L+ L  D R+  AL  CK
Sbjct  72   QECIASL-KATGNNSSDPQELVQAGFKAAMKLIQAAANKSVDLKQLEKDPRTSKALAGCK  130

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            EL   A+ +LK ++ K   FD+   +D  L D++ W+S
Sbjct  131  ELMDFAIDELKYSMNKLGEFDIT-KLDEMLIDIRIWLS  167



>ref|XP_006349952.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Solanum tuberosum]
Length=430

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALA--FGGQetseteeeGNIATSQKAIESVCQPTDY  276
            M ET  K + I G++S++LVA V+ +A  F  +    T   G I++S K+++++CQPT Y
Sbjct  1    MAETSKKKIVIAGIASILLVACVVGVAVTFTKKNDDSTSNGGEISSSSKSVQAMCQPTQY  60

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTC  456
            K+ C  SL    A N++DPK LI+ AF+ T+ +I  +I NS   +   +D R+K AL+ C
Sbjct  61   KEACEKSLG--SAKNTSDPKELIKTAFDNTMTEISNSIKNSAPFKEAANDPRTKNALKVC  118

Query  457  KELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             E+  R++ + KR+ ++  + DL   +  ++ D+++W+S A
Sbjct  119  DEVLDRSIEEFKRSFSQIDSNDLNKLIKEYIYDVRSWLSSA  159



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 105/168 (63%), Gaps = 11/168 (7%)
 Frame = +1

Query  103  MGETKSKNMT---IIGVSSLILVAMVLALAFGGQetseteeeGN------IATSQKAIES  255
            M E KS+  T   IIG+S+ +LVAMV+A+       +  ++  N      IA++ K+++S
Sbjct  1    MIEEKSQKRTRIVIIGMSTFLLVAMVVAVTVSVDINTRNDDSTNNNDKTRIASTIKSVKS  60

Query  256  VCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRS  435
             CQPTDYK+ C  +L +  AGN+T+P+ LI+ AFNVTI  I   I  + LL  +  + R+
Sbjct  61   FCQPTDYKKECEENLIEI-AGNTTEPRELIKLAFNVTIKKIGDGIKKTNLLHEVEKEPRA  119

Query  436  KMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            K+AL TCK+L   ++ + +R++   +TFDL ++++  L  LK W+SGA
Sbjct  120  KLALDTCKQLMDLSIGEFERSLEGIKTFDL-NNLENILVSLKVWLSGA  166



>ref|XP_003553713.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 102/166 (61%), Gaps = 9/166 (5%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALAF-------GGQetseteeeGNIATSQKAIESVC  261
            MG    K   IIGVS+ +LVAMV+A+         G    S+ E + ++A+S KA++++C
Sbjct  1    MGGDAQKRNVIIGVSTFLLVAMVVAVTVNVNFNNKGSSSDSKEESKSHVASSMKAVKTLC  60

Query  262  QPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKM  441
             PTDYK+ C ++L +  A N TDP+ LI+ AF+VTI+ I   +  + L+  + +D  +K 
Sbjct  61   APTDYKKECEDNLIEH-ASNITDPRELIKIAFHVTISKIGEGLEKTQLMHEVENDPITKE  119

Query  442  ALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            AL TCK+L   ++ +  R++ KF  FDL +++D  L  LK W+SGA
Sbjct  120  ALDTCKQLMNLSIGEFTRSLDKFAKFDL-NNLDNILTSLKVWLSGA  164



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 97/166 (58%), Gaps = 13/166 (8%)
 Frame = +1

Query  103  MGETKSKNMTII--GVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIES  255
            MG++      II  G++S++LVAMV+ +  G       G   +     G ++TS KA+++
Sbjct  1    MGDSDGNKKKIIVGGMASVLLVAMVVCVTIGVSGRNSGGDAAASNSGGGGVSTSTKAVQA  60

Query  256  VCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRS  435
            +C PTDYK+TC +SL+ +   N+TDPK LI+ AFN  + +I  AI NSTL ++   D  +
Sbjct  61   ICSPTDYKETCESSLAGA---NTTDPKELIRLAFNAAVNNIGDAIKNSTLFKDAAADSST  117

Query  436  KMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            K A   C ++ G A+ DLKR   K   FD    +D ++ DLK W+S
Sbjct  118  KDAFDICDDVLGSAIDDLKRAGDKVGEFDAT-KVDEYVEDLKVWLS  162



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 100/156 (64%), Gaps = 7/156 (4%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFG-----GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            K   IIGVSS+ILVAMV+A+A G     G    E+  +G I+T+ K+I+++CQPTDY++T
Sbjct  13   KKFAIIGVSSIILVAMVVAVAVGIGGSPGDSKQESSPKGQISTTSKSIKAICQPTDYRET  72

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C  SLSK+ AGN+TDP  L+QA F VTI  ++ AI+ ST L+ L  D  +  AL  C+EL
Sbjct  73   CEESLSKA-AGNTTDPSKLVQAGFKVTIEALQNAINRSTTLKELAKDPMASQALDNCREL  131

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
               A+++L+ +     +F      D ++ +LK W+S
Sbjct  132  MDDAIAELEHSFDLIESFQ-ASQFDEYVNNLKVWLS  166



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 100/156 (64%), Gaps = 7/156 (4%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFG-----GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            K   IIGVSS+ILVAMV+A+A G     G    E+  +G I+T+ K+I+++CQPTDY++T
Sbjct  13   KKFAIIGVSSIILVAMVVAVAVGIGGSHGDSKQESSPKGQISTTSKSIKAICQPTDYRET  72

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C  SLSK+ AGN+TDP  L+QA F VTI  ++ AI+ ST L+ L  D  +  AL  C+EL
Sbjct  73   CEESLSKA-AGNTTDPSKLVQAGFKVTIEALQNAINRSTTLKELAKDPMASQALDNCREL  131

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
               A+++L+ +     +F      D ++ +LK W+S
Sbjct  132  MDDAIAELEHSFDLIESFQ-ASQFDEYVNNLKVWLS  166



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN--IATSQKAIESVCQPTDYKQTC  288
            + K + IIGVS+L+LVAMV+A+  G   +       +  IA+S KA++++C PT+YK+ C
Sbjct  8    RGKRIAIIGVSTLLLVAMVVAVTVGVNVSENGSNNEDTKIASSVKAVQTLCHPTNYKKEC  67

Query  289  VNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELA  468
              SL  + AGN+TDPK LI+  FN+TI  I   +  + LL  + +D R+KMAL TCK+L 
Sbjct  68   EESLI-ARAGNTTDPKELIKIVFNITITKIGDKLKKTNLLHEVEEDPRAKMALDTCKQLM  126

Query  469  GRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              ++ +L R++     FDL  ++D  L +LK W+SGA
Sbjct  127  DLSIEELTRSLDGIGEFDL-KNIDKILMNLKVWLSGA  162



>ref|XP_003516937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=576

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN--IATSQKAIESVCQPTDYKQTC  288
            + K + IIGVS+L+LVAMV+A+  G   +       +  IA+S KA++++C PT+YK+ C
Sbjct  8    RGKRIAIIGVSTLLLVAMVVAVTVGVNVSENGSNNEDTKIASSVKAVQTLCHPTNYKKEC  67

Query  289  VNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELA  468
              SL  + AGN+TDPK LI+  FN+TI  I   +  + LL  + +D R+KMAL TCK+L 
Sbjct  68   EESLI-ARAGNTTDPKELIKIVFNITITKIGDKLKKTNLLHEVEEDPRAKMALDTCKQLM  126

Query  469  GRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              ++ +L R++     FDL  ++D  L +LK W+SGA
Sbjct  127  DLSIEELTRSLDGIGEFDL-KNIDKILMNLKVWLSGA  162



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 95/160 (59%), Gaps = 5/160 (3%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN---IATSQKAIESVCQPTDYK  279
            E K K + I+ VSSLILV  V+A+  G   +    ++G    ++ S KAIE++CQP DYK
Sbjct  4    EGKKKKLAIVAVSSLILVVAVVAVVAGVTMSKGDSKQGETKEVSASMKAIEAMCQPADYK  63

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            ++CV SL ++   N TDPK LI+A FNV +  I  A   S  L+ L  D R+  ALQ CK
Sbjct  64   ESCVKSL-ETAGPNVTDPKELIKAGFNVAMKKISEAAEKSVTLKELAKDPRTSQALQNCK  122

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            EL   A+ DL+ +  K    D M  +D +LADLKTW+  +
Sbjct  123  ELMEYAIDDLQSSFDKLGGLD-MSKVDDFLADLKTWLGAS  161



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   110 bits (276),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 63/167 (38%), Positives = 98/167 (59%), Gaps = 13/167 (8%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQets-----------eteeeGNIATSQKAIESVC  261
            K   + IIGVS+L+LVAMV+A+    ++                ++  +A++ KA++++C
Sbjct  8    KGSRIAIIGVSTLLLVAMVVAVTISIKQNQNDVKDDFKDDLADNKKNYVASTLKAVQTIC  67

Query  262  QPTDYKQTCVNSLS-KSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSK  438
             PT YK+ CV SL  +++AGN TDPK LI+ AFNVTI  I   +  + + R +  D RSK
Sbjct  68   HPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFREIEKDPRSK  127

Query  439  MALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             AL TCK+L   ++ +  R++     FDL   M+  L +LK W++GA
Sbjct  128  DALDTCKQLMHLSIGEFTRSLDGISEFDL-KHMNQILMNLKVWLNGA  173



>gb|KJB45338.1| hypothetical protein B456_007G302000 [Gossypium raimondii]
Length=588

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 98/161 (61%), Gaps = 10/161 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG--------GQetseteeeGNIATSQKAIESVCQPT  270
            ++K +TII V S +LVAMV+ +A G         ++  +  +      S+KAIES+CQPT
Sbjct  7    RAKRITIIAVCSCLLVAMVIVVAVGVNIDDDDSNEKNDKDNKNSRAYVSKKAIESICQPT  66

Query  271  DYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQ  450
            D+K+TC   +  ++AGN+TD   LIQAAF   +  + RA  NST LRNL  D R+K AL 
Sbjct  67   DFKETCEEEIG-AEAGNATDTNDLIQAAFKAAMKFLSRAAQNSTTLRNLQKDPRTKKALD  125

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             C +L   ++++L+++  K   F+L    +I LAD++ W+S
Sbjct  126  ICIQLMTYSINELQKSFNKIDRFELPMLHEI-LADIRIWLS  165



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 99/167 (59%), Gaps = 13/167 (8%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-----------GQetseteeeGNIATSQKAIESVC  261
            K + + IIGVS+L+LVAMV+A+               ++     ++ ++A++ KA++++C
Sbjct  8    KGRRIAIIGVSTLLLVAMVVAVTISINQNQNDVKDDFKDDLADNKKNHVASTLKAVQTIC  67

Query  262  QPTDYKQTCVNSLS-KSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSK  438
             PT YK+ CV SL  +++AGN TDPK LI+ AFNVTI  I   +  + +   +  D RSK
Sbjct  68   HPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKDPRSK  127

Query  439  MALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             AL TCK+L   ++ +  R++     FDL   M+  L +LK W++GA
Sbjct  128  DALDTCKQLMHLSIGEFTRSLDGISEFDL-KHMNQILMNLKVWLNGA  173



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 92/156 (59%), Gaps = 9/156 (6%)
 Frame = +1

Query  127  MTIIGVSSLILVAMVLALAFG-------GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + II VSS ILV +  A+ FG        Q +  +E+   ++ S KAIE +CQPTDYK+ 
Sbjct  13   IAIIVVSSFILVVIGAAVTFGMYTASVSSQASKASEKTSEVSASIKAIEGICQPTDYKEA  72

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            CV SL ++ A N+ DPK LI+A+F   +  I  A   ST+L+ L    R++ AL  CK+L
Sbjct  73   CVRSLREAGA-NTADPKELIKASFKAAMKHIAEAAKKSTVLKELEKTPRAQQALSNCKKL  131

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             G A++DL+R+  K    +    +D  LADLK W+S
Sbjct  132  MGFAINDLERSFDKLGELEF-SKLDDALADLKVWLS  166



>ref|XP_003555613.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=585

 Score =   109 bits (272),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 63/162 (39%), Positives = 105/162 (65%), Gaps = 9/162 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAF-------GGQetseteeeGNIATSQKAIESVCQPTD  273
            K + + IIGVS++ LVA+V+A+A        GG      + + ++A+S KA++++C+PTD
Sbjct  8    KKRRIVIIGVSAIFLVAVVVAVAVGVNLNIKGGSNDDAQDNKSHVASSVKAVKTLCKPTD  67

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            Y + C  SLS ++AGN+TDP+ LI+ AFN+TI  I   +  + ++  + +D  SKMAL T
Sbjct  68   YPKECEKSLS-AEAGNTTDPRELIKIAFNITIKKIGNGLKKTDIMHKVENDPISKMALDT  126

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            CK+L   ++ + KR++ +   FDL +++D  L  L+ W+SGA
Sbjct  127  CKQLMDLSIDEFKRSLERMGKFDL-NNLDNILNSLRVWLSGA  167



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            + +S KAI+S+CQ TDYK+TC +SLSK  A N++DP+ L++ AF  T+ ++   I NS+L
Sbjct  51   VTSSSKAIQSLCQHTDYKETCEDSLSK--AKNTSDPRELVKVAFQTTVDNLGEVIKNSSL  108

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L+N   D R+  AL  CKE+   A+ D KR+  K + FD+   +D + ADLKTW+SGA
Sbjct  109  LQNAAKDPRTSDALDICKEVLNTAIDDFKRSFDKVQDFDI-SKLDDYAADLKTWLSGA  165



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 103/166 (62%), Gaps = 12/166 (7%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFG---------GQetseteeeGNIATSQKAIESVC  261
            E K K + IIGVS+L  +A+V  + FG         G + +   ++ ++A++ KA++S+C
Sbjct  6    ENKGKRI-IIGVSALFFMAIVGVVIFGINLIDNGSNGDKENIDNKKNHVASTVKAVQSLC  64

Query  262  QPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKM  441
             PT+Y++ C  SL  + AGN+TDP+ L++ AFN+TI  I   +  + LL ++  + R+KM
Sbjct  65   HPTNYEKECEESLI-AGAGNTTDPRELVKIAFNITITKIGDKLKETNLLHDVEKEPRAKM  123

Query  442  ALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            AL TCK+L   ++ +L R+I     F+L++   I L ++K W+SGA
Sbjct  124  ALDTCKQLMDLSIGELSRSIDGISEFELINIEKI-LMNIKVWLSGA  168



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   108 bits (271),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 65/169 (38%), Positives = 108/169 (64%), Gaps = 12/169 (7%)
 Frame = +1

Query  103  MGE--TKSKNMTIIGVSSLILVAMVLALAF--------GGQetseteeeGNIATSQKAIE  252
            MGE     + + IIGVS++ LVAMV+A+A         GG      +++  IA+S KA++
Sbjct  1    MGEDGQSKRRIAIIGVSTIFLVAMVVAVAVGVNYFNLNGGSNDDAHDDKSQIASSVKAVK  60

Query  253  SVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKR  432
            ++C+PTDY++ C  SL +++AGN+TDP+ LI+ AF +TI  +   +  +  +  + +D R
Sbjct  61   TLCKPTDYQKECEKSL-RAEAGNTTDPRELIKIAFKITIKKMGNGLKKTDFMHEVENDPR  119

Query  433  SKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            SKMAL+TCK+L   ++ + KR++ +   FDL +++D  L  L+ W+SGA
Sbjct  120  SKMALETCKQLMNLSIDEFKRSLERMGKFDL-NNLDNILNSLRVWLSGA  167



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 97/158 (61%), Gaps = 8/158 (5%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFG----GQetseteeeGNIATSQKAIESVCQPTDYKQTC  288
            K + I  V+S++LVA V+A A       ++ S    + +++TS K+++++CQPTDYK+TC
Sbjct  4    KKLAIASVASILLVACVVAAAISFTKRNEDHSSNSTDSHLSTSTKSVQAICQPTDYKETC  63

Query  289  VNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS-TLLRNLNDDKRSKMALQTCKEL  465
              SL  ++A N  DPK LI+ AFN TI D+   I NS +L+     D R+K ALQTC+ L
Sbjct  64   EKSL--ANAKNINDPKELIKVAFNATINDLSNVIKNSASLIDEAKKDPRTKDALQTCQGL  121

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ DL R+  KF  F++    D +  DLKTW+S A
Sbjct  122  LDVAIDDLTRSFDKFDKFEVSKIKD-YTDDLKTWLSSA  158



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 11/166 (7%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeG---------NIATSQKAIESVC  261
            E  +K + II  SSLILVAMV+A+  G  +      +G          I TS KAI+++C
Sbjct  5    EGTNKRIAIISASSLILVAMVVAVTVGVNQHPTAGSDGTKTVSNDDEQIQTSMKAIKAIC  64

Query  262  QPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKM  441
            QPTDYK+TC+ SLS S AGN+TDPK L++ AF +    I+ A++ S +L+ L  D R+  
Sbjct  65   QPTDYKETCIKSLS-SAAGNTTDPKDLVKIAFKIATKQIKEAVNRSVVLKELEKDPRASK  123

Query  442  ALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            AL  C+EL   A+ +L  +  +  + D+ D  D  L +LK W+S +
Sbjct  124  ALANCRELMDYAIDELNSSFDELGSIDIDDIDDA-LENLKIWLSAS  168



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 99/161 (61%), Gaps = 10/161 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQ--------KAIESVCQPT  270
            + K + II V S +LVAMV+A+  G      + ++G   +S+        KAI+SVCQPT
Sbjct  9    RKKRIAIIAVCSFLLVAMVVAVTVGVSINDTSSDDGTSNSSKSSQVSASVKAIKSVCQPT  68

Query  271  DYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQ  450
            D+++TC   L +++AG++TD K L+QAAF   +    +A+ NST LR+L  D R+K AL 
Sbjct  69   DFRKTCEEQL-RAEAGDTTDIKELVQAAFKAAMKSASQAVQNSTTLRDLEKDPRTKKALD  127

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             CK+L   ++ +LK+++ +    D+ +  D  LADLK W+S
Sbjct  128  VCKQLMTYSIKELKKSLDQIDKLDI-NKFDRMLADLKIWLS  167



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 75/113 (66%), Gaps = 4/113 (4%)
 Frame = +1

Query  241  KAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLN  420
            K+++++C PTDYKQTC  SL+     NSTDPK LI+ AF  T+  IR AI NSTL R   
Sbjct  50   KSVQAICSPTDYKQTCEESLA---GANSTDPKYLIKLAFQNTVKGIRSAILNSTLYREAA  106

Query  421  DDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             D  +K ALQ C+E+   +V DL+R+  +   FD+ + MD ++ D+KTW+SGA
Sbjct  107  ADPNTKGALQVCEEVLDNSVDDLQRSFDQVEAFDV-NRMDEYIDDIKTWLSGA  158



>ref|XP_007144962.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16956.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=566

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 98/157 (62%), Gaps = 6/157 (4%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAF----GGQetseteeeGNIATSQKAIESVCQPTDYKQTC  288
            + + +IGVS++ LVAMV+A+AF         +++++  ++ +S KA+ ++C+PT Y++ C
Sbjct  10   RRIAVIGVSTIFLVAMVVAIAFSVNYNSDSNNDSQQNNHVVSSVKAVRTLCKPTYYQKEC  69

Query  289  VNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELA  468
              SL + +AGN+TD + LI+  FN+T+  I +  H    +     + R++MAL TCK+L 
Sbjct  70   EKSL-REEAGNTTDSRELIKIVFNITMKKIGKGQHKIDHMLGAERNPRARMALATCKQLM  128

Query  469  GRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              +V + KR + K   FDL D+++  L  LK W+SGA
Sbjct  129  NLSVGEFKRALEKMGKFDL-DNLNNILTSLKVWLSGA  164



>gb|KJB45965.1| hypothetical protein B456_007G340800 [Gossypium raimondii]
Length=1261

 Score =   109 bits (273),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 66/160 (41%), Positives = 95/160 (59%), Gaps = 8/160 (5%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN------IATSQKAIESVCQPTDY  276
            + K + II V S+ILV +V+ ++ G  E S  +E  N      I+ S KAI+S+CQPTD+
Sbjct  9    QKKRIIIIAVCSVILVGIVVTVSIGFTEKSSKKESTNTKKNYQISDSLKAIKSICQPTDF  68

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTC  456
            KQTC   L K +AGNSTD K L+QAAF   +    +A  NS  LR +  D +SKMAL+ C
Sbjct  69   KQTCEEQLRK-EAGNSTDVKELMQAAFKAGVNFATQAADNSATLREVEQDPKSKMALENC  127

Query  457  KELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
            K L   ++ + +++I+K    D +    I+  DLK W+S 
Sbjct  128  KNLLTFSIYEFQKSISKINELDAVVFNKIY-GDLKIWLSA  166



>ref|XP_007144961.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16955.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=578

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 98/157 (62%), Gaps = 6/157 (4%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAF----GGQetseteeeGNIATSQKAIESVCQPTDYKQTC  288
            + + +IGVS++ LVAMV+A+AF         +++++  ++ +S KA+ ++C+PT Y++ C
Sbjct  10   RRIAVIGVSTIFLVAMVVAIAFSVNYNSDSNNDSQQNNHVVSSVKAVRTLCKPTYYQKEC  69

Query  289  VNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELA  468
              SL + +AGN+TD + LI+  FN+T+  I +  H    +     + R++MAL TCK+L 
Sbjct  70   EKSL-REEAGNTTDSRELIKIVFNITMKKIGKGQHKIDHMLGAERNPRARMALATCKQLM  128

Query  469  GRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              +V + KR + K   FDL D+++  L  LK W+SGA
Sbjct  129  NLSVGEFKRALEKMGKFDL-DNLNNILTSLKVWLSGA  164



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 96/158 (61%), Gaps = 8/158 (5%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFG----GQetseteeeGNIATSQKAIESVCQPTDYKQTC  288
            K + I  V+S++LVA V+A A       ++ S    +  ++TS K+++++CQPTDYK+TC
Sbjct  4    KKLAIASVASILLVACVVAAAISFTKKNEDKSSNSTDSRLSTSTKSVQAICQPTDYKETC  63

Query  289  VNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS-TLLRNLNDDKRSKMALQTCKEL  465
              SL  ++A N  DPK LI+ AFN TI D+   I NS +L+     D R+K ALQTC+ L
Sbjct  64   EKSL--ANAKNINDPKELIKVAFNATINDLSDVIKNSASLIDEAKKDPRTKDALQTCQGL  121

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ DL R+  KF  F++    D +  DLKTW+S A
Sbjct  122  VDVAIDDLTRSFDKFDKFEVSKIKD-YTDDLKTWLSSA  158



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 94/154 (61%), Gaps = 4/154 (3%)
 Frame = +1

Query  124  NMTI--IGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNS  297
            NM +  + VS+++LVA+V  +A           +   ++SQK I+  C PTDY++TC ++
Sbjct  3    NMKVAALSVSAIVLVAIVATVAVTISNLDSEPAKTQFSSSQKNIKDFCNPTDYQETCEST  62

Query  298  LSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRA  477
            LS + AGNSTDPK L+  AF +TI  I+ A ++ST+L     + R+  AL+ C+EL   A
Sbjct  63   LSAA-AGNSTDPKELVNLAFQITIDQIKEAFNHSTVLSEAAKNPRTSDALENCRELLDYA  121

Query  478  VSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            + DL+ +I +   F L+  +D +L DLK WIS +
Sbjct  122  IDDLRSSIDQLEGFSLI-KLDKFLDDLKVWISAS  154



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 104/168 (62%), Gaps = 13/168 (8%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLAL----------AFGGQetseteeeGNIATSQKAIESV  258
            + K+K   +IGVSSL LVAMV+A+          A GG +++ T     I+TS KA++++
Sbjct  4    QGKNKKAALIGVSSLFLVAMVVAVAVGVNRNSPNASGGGDSAATAATAEISTSTKAVKAL  63

Query  259  CQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSK  438
            CQPTDY++TC  +LS++   N++DP+ LI+A FNV + +I+ AI NST L+    D  +K
Sbjct  64   CQPTDYQETCEKALSEAGT-NTSDPRELIKAGFNVAVNEIKWAIGNSTTLKEAASDPMAK  122

Query  439  MALQTCKELAGRAVSDLKRTIAKFR-TFDLMDDMDIWLADLKTWISGA  579
             AL  C EL   A+ DL  +  +    FD M  +D ++ DLK W+SGA
Sbjct  123  QALDACGELMDYAIDDLVISFQRITDNFD-MQKLDDYIEDLKVWLSGA  169



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 99/160 (62%), Gaps = 3/160 (2%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALAFG-GQetseteeeGNIATSQKAIESVCQPTDYK  279
            M +   K + I G+SS++LVA ++  A    ++ ++      ++TS K ++++CQPT YK
Sbjct  1    MADAGKKKIAIAGISSILLVACIVGAAVTLTKKGNDDSSNSQVSTSTKNVQAMCQPTQYK  60

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            +TC  SLS   A N++DPK LI+ AF+ TI +I  +I NS   +   +D R+K AL+ C 
Sbjct  61   ETCEKSLS--SAKNTSDPKELIKTAFDSTINEIASSIKNSAPFKEAANDPRTKDALKVCD  118

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            E+  R++ ++KR+  KF + D+   +  ++ DL++W+S A
Sbjct  119  EVLDRSIEEIKRSFNKFDSSDVKSLVKDYIYDLRSWLSSA  158



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 97/156 (62%), Gaps = 8/156 (5%)
 Frame = +1

Query  133  IIGVSSLILVAMVLALAFGGQetsete------eeGNIATSQKAIESVCQPTDYKQTCVN  294
            IIGVS+L+LVAM++ +  G +     +      ++ ++A++ KAI ++CQPTDYK+ C  
Sbjct  14   IIGVSTLLLVAMIIVVMVGARNKYSFKDDIEDNKKNHVASTMKAIRTICQPTDYKKECEE  73

Query  295  SL-SKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAG  471
            SL ++++A N TDPK LI+ AFNVTI  I   +  + +L  L  D RSK AL TCK+L  
Sbjct  74   SLRAEAEADNVTDPKELIKIAFNVTIKKIGEKLKETDMLCELEKDPRSKDALDTCKQLMD  133

Query  472  RAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             ++ +  R++      ++ +  +I L +LK W++GA
Sbjct  134  LSIDEFTRSLDGIGKLNIQNIENI-LMNLKVWLNGA  168



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 80/120 (67%), Gaps = 3/120 (3%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G I+TS K+++++CQPTDYK+ C  SL+   A N++DPK LI+ AF  TI DI+ AI N+
Sbjct  41   GGISTSTKSVQAMCQPTDYKEACEKSLAS--AKNTSDPKELIKVAFESTITDIKNAIKNT  98

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L+++  +D R+K AL TC  L   ++ DL+R+  K  TFD+    D +  DLKTWIS +
Sbjct  99   DLIKDAANDPRTKEALNTCDGLLDVSIDDLRRSFDKVGTFDINKIKD-YTDDLKTWISAS  157



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 92/161 (57%), Gaps = 8/161 (5%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG------GQetseteeeGNIATSQKAIESVCQPTDY  276
            K K   II +SS++L++MV+A+  G           +T   G I  S KAI+ VC PTDY
Sbjct  11   KRKRYVIISISSVLLISMVVAVTVGVSMNKSDNADKKTGGNGEITASVKAIKEVCAPTDY  70

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTC  456
            K+TC  +L+K +A N+TDP  L++ AF+VT+  I  A   S  L  L  D R+KMAL  C
Sbjct  71   KKTCEETLTK-NAKNTTDPMELVKTAFDVTMKQIAEAAKKSQTLVELQKDPRTKMALDQC  129

Query  457  KELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +EL   A+ +LK +  +   F+    +D  L +L+ W+S A
Sbjct  130  RELMNYAIDELKSSFEELGKFEF-HKLDEALINLRIWLSAA  169



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++TS K+++++CQPTDYK+TC  SL+   A N++DPK LI+ AF  TI DI+ AI N+ L
Sbjct  47   VSTSTKSVKAICQPTDYKETCEKSLAS--AKNTSDPKELIKVAFESTITDIKNAIKNTDL  104

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +++   D R+K AL TC+ L   ++ DL+R+  K  TFD+    D +  DLKTWIS +
Sbjct  105  IKDAAKDPRTKEALHTCEGLLDVSIDDLRRSFDKVGTFDINKIKD-YTDDLKTWISAS  161



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 91/158 (58%), Gaps = 3/158 (2%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFGGQetse-teeeGNIATSQKAIESVCQPTDYKQT  285
            E+K K + II V  ++LVAM++A+  G +   +  ++   +   +KAIE++CQ T YK+T
Sbjct  5    ESKKKKIAIIAVLVVLLVAMIVAVTVGVKMAKKGNKKPAKVGAKKKAIETICQATTYKET  64

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C +SL K + G++TDPK LI+A F V    +   I NS  L+    D  +  AL  CKEL
Sbjct  65   CQSSLEK-ETGDTTDPKDLIKAEFQVAADKVNEVIKNSNTLKEYAKDPMASQALGVCKEL  123

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
               AV DL   + K   FD+    D +LADLK W+S A
Sbjct  124  LETAVEDLLGAVDKMGPFDVSKISD-YLADLKVWLSAA  160



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 95/146 (65%), Gaps = 6/146 (4%)
 Frame = +1

Query  154  ILVAMVLALAF----GGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGN  321
            ++VA+ + + +    GG      +++  IA+S KA++++C+PTDY++ C  SL +++AGN
Sbjct  1    MVVAVAVGVNYFNLNGGSNDDAHDDKSQIASSVKAVKTLCKPTDYQKECEKSL-RAEAGN  59

Query  322  STDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTI  501
            +TDP+ LI+ AF +TI  +   +  +  +  + +D RSKMAL+TCK+L   ++ + KR++
Sbjct  60   TTDPRELIKIAFKITIKKMGNGLKKTDFMHEVENDPRSKMALETCKQLMNLSIDEFKRSL  119

Query  502  AKFRTFDLMDDMDIWLADLKTWISGA  579
             +   FDL +++D  L  L+ W+SGA
Sbjct  120  ERMGKFDL-NNLDNILNSLRVWLSGA  144



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 100/159 (63%), Gaps = 9/159 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN----IATSQKAIESVCQPTDYKQ  282
            K K + II VS+LILVAMV+A+A      +++ + GN     AT+ KAIE+VCQPTDYK+
Sbjct  9    KKKKIAIISVSALILVAMVVAVA---VGVTKSHKGGNDEKKPATTSKAIETVCQPTDYKE  65

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
            TC N+LS+  AGN TDPK L++  F + I  ++  I+NS  L+ +  D     ALQ C+E
Sbjct  66   TCQNALSEK-AGNVTDPKELVKIGFQIAIEKLQEVINNSDTLKEIAKDNLGNQALQNCRE  124

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L   ++ DLKR+  K   F++   +  ++ DLK W+S +
Sbjct  125  LIEYSIDDLKRSADKIGPFEVT-KLKEYVEDLKVWLSAS  162



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 76/118 (64%), Gaps = 3/118 (3%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G + TS K++E++CQPT YKQTC  +LS   A N TDPK  I+ AF  T+ DI+ AI N+
Sbjct  37   GQVTTSTKSVEAMCQPTPYKQTCEKTLS--SAKNVTDPKDFIKVAFEATVTDIKNAIMNT  94

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             L+     D ++K AL  C+EL   A+ DL+ +++K  +FDL    DI + DLKTW+S
Sbjct  95   DLIMKAASDPKTKDALHACEELFDLAIEDLRTSVSKLESFDLTKIKDI-VDDLKTWLS  151



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 77/118 (65%), Gaps = 3/118 (3%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G + TS K++ES+CQPT YKQTC  +LS   A N++DPK  I+ AF  T+ DI+ AI N+
Sbjct  37   GQVTTSTKSVESMCQPTPYKQTCEKTLSS--AKNASDPKDFIKVAFEATVTDIKNAIMNT  94

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             L+     D ++K AL  C+EL   A+ DL+ +++K  +FDL    DI + DLKTW+S
Sbjct  95   DLIMQAASDPKTKDALHACEELFDLAIEDLRTSVSKLDSFDLSKIKDI-VDDLKTWLS  151



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            I+TS K+++++CQPTDYK+ C  SL+   A N++DPK LI+ AF  TI DI+ A+ N++L
Sbjct  48   ISTSTKSVQAMCQPTDYKEACEKSLAS--AKNTSDPKELIKVAFESTITDIKNAMKNTSL  105

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++    D R+K ALQTC+ L   ++ DL+R+  K  TFD+    D +  DLKTWIS +
Sbjct  106  IQEAAKDPRTKDALQTCESLLNVSIDDLRRSFDKVGTFDINKIKD-YTDDLKTWISAS  162



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 93/165 (56%), Gaps = 10/165 (6%)
 Frame = +1

Query  112  TKSKNMTIIGVSSLILVAMVLALAFGG------QetseteeeG---NIATSQKAIESVCQ  264
            T  + + II VS   LV+MV+AL  G            +++ G   + + S KAI+++CQ
Sbjct  10   TSKRRIAIIVVSGFFLVSMVVALTVGAGIDKGFHLNPFSDKRGSSIDKSASTKAIKAICQ  69

Query  265  PTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMA  444
            PTDYKQ C++SL+ S AGN+TDP  LI+  F  T+  I  A   S LL+ L  D R+ MA
Sbjct  70   PTDYKQECLSSLT-SAAGNTTDPIQLIKIGFQATMKQIYEATKKSNLLQKLEKDPRTSMA  128

Query  445  LQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L TCKEL   AV +L+++  +    +       ++ DLK W+S +
Sbjct  129  LDTCKELMELAVDELRQSFNRVGDIENFSKYKTFIMDLKVWLSAS  173



>ref|XP_004487827.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=624

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 96/161 (60%), Gaps = 6/161 (4%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFG----GQetseteeeGNIATSQKAIESVCQPTD  273
            G  + K  T++GVSS++LVAMV A+A G    G   SE  + G I+++Q+ +E +C+ T 
Sbjct  12   GGDQRKRFTLLGVSSVLLVAMVGAVAVGLTSKGDTNSEQGQNGQISSTQRNVEIICESTQ  71

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            Y++TC  SL K+ +  ++D K LI+AAFN T  ++ + IHN+TL   L  D  +K A+  
Sbjct  72   YQETCHKSLDKA-SNETSDMKELIKAAFNATAEELIKQIHNTTLYDELAKDNMTKQAMNI  130

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
            C E+   AV  + R+I     +D  + +  +  DLK W++G
Sbjct  131  CNEVLDYAVDGIHRSIDTMDKYDF-NKLSEYAYDLKVWLTG  170



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            I+TS K+++++CQPTDYK+ C  SL+   A N++DPK LI+ AF  TI DI+ A+ N++L
Sbjct  48   ISTSTKSVKAMCQPTDYKEACEKSLAS--AKNTSDPKELIKVAFESTITDIKNAMKNTSL  105

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++    D R+K ALQTC+ L   ++ DL+R+  K  TFD+    D +  DLKTWIS +
Sbjct  106  IQEAAKDPRTKDALQTCESLLNVSIDDLRRSFDKVGTFDINKIKD-YTDDLKTWISAS  162



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 89/165 (54%), Gaps = 10/165 (6%)
 Frame = +1

Query  112  TKSKNMTIIGVSSLILVAMVLALAFGG---------QetseteeeGNIATSQKAIESVCQ  264
            T  + + II VS   LV+MV+AL  G            + +     + + S KAI+++CQ
Sbjct  10   TSKRRIAIIAVSGFFLVSMVVALTVGAGIDKGFHLNPFSDKRGSSTDKSASTKAIKAICQ  69

Query  265  PTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMA  444
            PTDYKQ C++SL+ S AGN+TDP  LI+  F   +  I  A   S LL+ L  D R+ MA
Sbjct  70   PTDYKQECLSSLT-SAAGNTTDPIQLIKIGFQAAMKQIYEATKKSNLLQKLEKDHRTSMA  128

Query  445  LQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L TCKEL   AV +L ++  +    +       ++ DLK W+S +
Sbjct  129  LDTCKELMELAVDELNQSFNRLGDTENFYKYKTFIMDLKVWLSAS  173



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/118 (42%), Positives = 76/118 (64%), Gaps = 2/118 (2%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            IA   KAI+S+CQPT YKQ C ++L+ S  GN+ DPK L++ AF V   ++ +A+  S  
Sbjct  45   IAAGTKAIQSICQPTRYKQACESTLTNS-GGNTNDPKELVKTAFRVAKEEVAKALEKSKT  103

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++   DD R+   ++ C+E+ G A++DL+RT+     F  MD++D +L DL+ WI GA
Sbjct  104  IQAAKDDPRAAEGIEICREVVGYAINDLERTVESVGAFS-MDNIDDFLEDLRVWIGGA  160



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 77/118 (65%), Gaps = 3/118 (3%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G + TS K+++++CQPT YKQTC  +LS   A N+++PK  I+ AF  T+ DIR AI N+
Sbjct  37   GQVTTSTKSVKAMCQPTPYKQTCEKTLS--SAKNASEPKDFIKVAFEATVTDIRNAIMNT  94

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             L+     D ++K AL  C+EL   A+ DL+ +++K  +FDL    DI + DLKTW+S
Sbjct  95   DLIMQAASDPKTKDALHACEELFDLAIEDLRTSVSKLESFDLTKIKDI-VDDLKTWLS  151



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 99/160 (62%), Gaps = 3/160 (2%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALAFG-GQetseteeeGNIATSQKAIESVCQPTDYK  279
            M +   K + I G++S+++VA ++  A    ++ ++      ++TS K ++++CQPT YK
Sbjct  1    MADAGKKKIAIAGIASILVVACIVGAAVTLTKKGNDDSSNSQVSTSTKNVQAMCQPTQYK  60

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            +TC  SLS   A N++DPK LI+ AF+ ++ +I  +I NS   +   +D R+K AL+ C 
Sbjct  61   ETCEKSLS--SAKNTSDPKELIKTAFDSSVNEIASSIKNSAPFKEAANDPRTKDALKVCD  118

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            E+  R++ ++KR+  KF + DL   +  ++ DL++W+S A
Sbjct  119  EVLDRSIEEIKRSFNKFDSSDLKSLVKDYIYDLRSWLSSA  158



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 101/165 (61%), Gaps = 10/165 (6%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeG-------NIATSQKAIESVCQP  267
            + K+K   +IGVSSL LVAMV+A+A G    S     G        I+TS KA++++CQP
Sbjct  4    QGKNKKAALIGVSSLFLVAMVVAVAVGVNRNSPNASGGGDSAATAEISTSTKAVKALCQP  63

Query  268  TDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMAL  447
            TDY++TC  +LS++   N++DP+ LI+A FNV + +I+ AI NST L+    D  +K AL
Sbjct  64   TDYQETCEKALSEAGT-NTSDPRELIKAGFNVAVNEIKWAIGNSTTLKEAASDPMAKQAL  122

Query  448  QTCKELAGRAVSDLKRTIAKFR-TFDLMDDMDIWLADLKTWISGA  579
              C EL   A+ DL  +  +    FD M  +D ++ DLK W+SGA
Sbjct  123  DACGELMDYAIDDLVISFQRITDNFD-MQKLDDYIEDLKVWLSGA  166



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 85/144 (59%), Gaps = 3/144 (2%)
 Frame = +1

Query  151  LILVAMVLALAFGGQetse-teeeGNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNST  327
            ++LVAM++A+  G +   +  ++   +   +KAIE++CQPT YK+TC +SL K +AG++T
Sbjct  19   VLLVAMIVAVTVGVKMAKKGNKKPAKVGAKKKAIETICQPTTYKETCQSSLEK-EAGDTT  77

Query  328  DPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAK  507
            DPK LI+A F V    +   I NS  L+    D  +  AL  CKEL   AV DL   + K
Sbjct  78   DPKDLIKAGFKVAADKVNEVIKNSNTLKEHAKDPMTSQALGVCKELLETAVEDLLGAVDK  137

Query  508  FRTFDLMDDMDIWLADLKTWISGA  579
               FD    +D +LADLK W+S A
Sbjct  138  MGPFD-ASKIDDYLADLKVWLSAA  160



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 77/113 (68%), Gaps = 4/113 (4%)
 Frame = +1

Query  241  KAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLN  420
            KA++++C PTDYKQTC  SL+     N+TDPK LI+ AF+ T+  +R AI NSTL ++  
Sbjct  49   KAVQAICSPTDYKQTCEESLA---GANTTDPKELIKLAFDNTVKKVRAAILNSTLYKDAA  105

Query  421  DDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             D R+K AL+ C+E+    + DL+R+  +   F++ + MD ++ D+KTW+SGA
Sbjct  106  ADPRTKGALKVCEEVLDNCIDDLQRSFDQVNDFNV-NQMDEYIDDIKTWLSGA  157



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-GQetseteeeGNIATSQKAIESVCQPTDYKQTCV  291
            + K   II +SS++L++MV+A+  G     S+   EG I TS KAI+ VC PTDYK+TC 
Sbjct  11   RKKRYVIISISSVLLISMVVAVTIGVSVNKSDNGGEGEITTSVKAIKDVCAPTDYKETCE  70

Query  292  NSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAG  471
            ++L K DA N++DP  L++ AFN T+  I      S  +  L  D R+KMAL  CKEL  
Sbjct  71   DTLRK-DAKNTSDPLELVKTAFNATMKQISDVAKKSQTMIELQKDPRTKMALDQCKELMD  129

Query  472  RAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             A+ +L ++  +   F+    +D  L  L+ W+S
Sbjct  130  YAIGELSKSFEELGRFEF-HKVDEALIKLRIWLS  162



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   104 bits (259),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 62/154 (40%), Positives = 88/154 (57%), Gaps = 3/154 (2%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVN  294
            + K   II VSS++L++MV+A+  G        EE  I TS KAI+ VC PTDYK+TC +
Sbjct  12   RRKRYIIISVSSVLLISMVVAVTIGVSVNKNEGEE-EITTSVKAIKEVCAPTDYKKTCED  70

Query  295  SLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGR  474
            +L K DA N++DP  L++ AFNVT+  I      S  +  L  D R+KMAL  CKEL   
Sbjct  71   TLRK-DAQNTSDPLELVKTAFNVTMKQISDVAKKSQTMIELQKDPRAKMALDQCKELMDY  129

Query  475  AVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
            A+ +L  +  +   F+    +D  L  L+ W+S 
Sbjct  130  AIGELSNSFEELGKFEF-HKIDEALVKLRLWLSA  162



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 96/164 (59%), Gaps = 13/164 (8%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeG---------NIATSQKAIESVC  261
            + K K + I G++S++LVAMV+ +  G Q+ S  +             I+T+ KA+ ++C
Sbjct  4    DGKKKKILIGGLASVLLVAMVVCVTVGVQKNSAGDAAAPSTGGGSGGGISTANKAVHAIC  63

Query  262  QPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKM  441
             PTDYK+TC +SLS     N+TDPK LI+ AFN  + +I  AI NS LL++   D  +K 
Sbjct  64   SPTDYKETCESSLS---GANTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAAADNSTKD  120

Query  442  ALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            AL  C ++   A+ DLKR   K  +FD    +D ++ DLK W+S
Sbjct  121  ALDICNDVLESAIDDLKRAGDKVGSFD-ASKVDEYVEDLKVWLS  163



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 90/156 (58%), Gaps = 5/156 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteee---GNIATSQKAIESVCQPTDYKQT  285
            K K   +I VSS++L++MV+A+  G    +        G I  S KAI+ VC PTDYK+T
Sbjct  12   KKKRYVVISVSSVLLISMVVAVTIGVNVNNNDNGGDSDGEITASVKAIKDVCAPTDYKKT  71

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L K DA N++DP  L++ AFN T+  I      S  + +L  D R+KMAL  CKEL
Sbjct  72   CEDTLKK-DAKNTSDPLELVKTAFNATMKQISDVAKKSQTMIDLQKDPRTKMALDQCKEL  130

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
               AV +L ++  +   F+L + +D  L  LK W+S
Sbjct  131  MDYAVGELSKSFEELGKFEL-NKVDEALVKLKIWLS  165



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 93/164 (57%), Gaps = 25/164 (15%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQ  282
            MG+ K K + +  +SS++LVAMVL LA G               S KA  ++C   DYK 
Sbjct  1    MGD-KMKKIAMASLSSILLVAMVLPLATGDSP----------TNSNKAAHALCTSVDYKI  49

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
            TC  SLS     NS+DP+ LI+ AFN  I DI+ AI NSTL +    D R+K AL+ C+E
Sbjct  50   TCEKSLS---GANSSDPQELIKVAFNHAITDIQEAIKNSTLYKQAALDHRTKGALEVCEE  106

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDI-----WLADLKTWISGA  579
            +   ++ DL+      R+FD + ++DI     ++ D+K W+SGA
Sbjct  107  VLDTSIDDLR------RSFDRVGNLDITKLKQYIEDVKVWLSGA  144



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G I+TS KAI+++CQPTDY++TC  SLS   + N+TDPK LI+  F   I++I++ I NS
Sbjct  164  GEISTSTKAIKAICQPTDYRETCEKSLS---SANTTDPKELIKIGFQAAISEIKKVIANS  220

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            + ++ +  D  ++ AL+ C EL   A+ DLK +  +   FD    +D ++ +LK W+ GA
Sbjct  221  STVKEVAKDPMARQALENCHELMDYAIDDLKNSFNQLGEFDF-SKLDEYIENLKIWLGGA  279



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   103 bits (257),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 58/155 (37%), Positives = 86/155 (55%), Gaps = 3/155 (2%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN-IATSQKAIESVCQPTDYKQTCV  291
            + K   II +SS++L++MV+A+  G             I TS KAI+ VC PTDYK+TC 
Sbjct  12   RKKRYVIISISSVLLISMVVAVTIGVSVNKNDNGGDEEITTSVKAIKDVCAPTDYKKTCE  71

Query  292  NSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAG  471
            ++L K DA N++DP  L++ AFN T+  I      S  +  L  D R+KMAL  CKEL  
Sbjct  72   DTLRK-DAQNTSDPLELVKTAFNATMKQITEVAKKSQTMIELQKDPRTKMALDQCKELMD  130

Query  472  RAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
             A+ +L ++  +   F+    +D  L  L+ W+S 
Sbjct  131  YAIGELSKSFEELGRFEF-HKVDEALVKLRVWLSA  164



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 92/168 (55%), Gaps = 21/168 (13%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIAT-------------SQKAI  249
            + K K + I G++S++LVAMV+ +  G     E    GN A              + KA+
Sbjct  4    DGKKKKILIGGLASVLLVAMVICVTVG----VERNSGGNAAAPSTGGGSGGGISTANKAV  59

Query  250  ESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDK  429
             ++C PTDYK+TC +SLS     N+TDPK LI+ AFN  + +I  AI NS LL++   D 
Sbjct  60   HAICSPTDYKETCESSLS---GANTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAAADN  116

Query  430  RSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             +K AL  C ++   A+ DLKR   K   FD    +D ++ DLK W+S
Sbjct  117  STKDALDICNDVLESAIDDLKRAGDKVGAFDAT-KVDEYVEDLKVWLS  163



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 87/160 (54%), Gaps = 9/160 (6%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQ------KAIESVCQPTD  273
            K + II VS+ +LVAMV+A+  G    +    +   GN   S       KAI+++CQPTD
Sbjct  13   KRVVIISVSAFLLVAMVVAVTVGFAMEKSFYNSPYSGNKGRSHDKPASMKAIKAICQPTD  72

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            YKQ C++SLS +    +TDP  LI   F V +  +  A   S  LR L  D R+  AL T
Sbjct  73   YKQECLDSLSYASGNTTTDPVQLIGYGFKVAMKYVYDAAKKSDFLRKLEKDPRTSNALDT  132

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            C+EL   A+ +L++++ +    D +   +  L DLK W+S
Sbjct  133  CEELMELALGELRQSLVRLGFIDDLTKFNDMLMDLKVWLS  172



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 95/159 (60%), Gaps = 13/159 (8%)
 Frame = +1

Query  103  MGETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQ  282
            MG    K   I+GVSS++LVA V+           T     ++TS K++ESVC+  DYKQ
Sbjct  1    MGSEGKKKAAILGVSSILLVAAVVG----------TVTYSVVSTSSKSVESVCKHVDYKQ  50

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKE  462
            TC  SLS   A N++DP+ LI+ AF   + +I   I NSTLL+N   D R+  AL+TCK 
Sbjct  51   TCEQSLS--GAKNTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQALETCKY  108

Query  463  LAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
                ++ DL+R+     TFD+ + +D ++ADLKTW+S A
Sbjct  109  ALNTSIEDLQRSFETVGTFDI-NKIDDYVADLKTWLSAA  146



>gb|EMS65303.1| putative pectinesterase/pectinesterase inhibitor 21 [Triticum 
urartu]
Length=360

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
             + TS K++++ CQP DYK+TC   L+K   GN+T P  L +A F VT   IR+AI  S 
Sbjct  74   ELTTSVKSVKAFCQPMDYKETCETELTKV-GGNATSPTELAKAIFEVTSEKIRKAISESA  132

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L  L  D R+  AL+ CKEL   A+ DLK T  +   F+ M D +   ADLKTW+S A
Sbjct  133  TLEELKSDPRTSGALENCKELLEYAIEDLKTTFDRLGGFE-MTDFNKAAADLKTWLSAA  190



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 95/161 (59%), Gaps = 26/161 (16%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIAT-SQKAIESVCQPTDYKQTCV  291
            K K + +  +SS++LVAMVL LA            G+I T S KA +++C   DYK TC 
Sbjct  4    KMKKIAMASLSSVLLVAMVLPLA-----------TGDIPTISNKAAQALCTSVDYKITCE  52

Query  292  NSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAG  471
             SLS +   +S++P+ LI+ AFN  I DI+ AI NSTL +    D R+K AL+ C+E+  
Sbjct  53   KSLSDA---HSSNPQELIKVAFNHAITDIQEAIKNSTLYKQAATDHRTKGALEVCEEVLD  109

Query  472  RAVSDLKRTIAKFRTFDLMDDMDI-----WLADLKTWISGA  579
             ++ DL+      R+FD + ++DI     ++ D+K W+SGA
Sbjct  110  TSIDDLR------RSFDRVGNLDITKLKQYIEDVKVWLSGA  144



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 87/160 (54%), Gaps = 9/160 (6%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFG---------GQetseteeeGNIATSQKAIESVCQPTD  273
            K + II +S+ +L+AMV+A+A G            +       + + S KAI+++CQPTD
Sbjct  13   KRIVIISLSAFLLMAMVMAVAAGFIMEKGFYNSPVSGSKGSSHDKSASMKAIKTICQPTD  72

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            YKQ C++SLS +    +TDP  LI+  F V +  +  A   S  LR L  D R+  AL  
Sbjct  73   YKQECLDSLSYASGNTTTDPIELIEYGFKVAMKYVTDAAKKSDFLRKLEKDPRTSNALDA  132

Query  454  CKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            C+EL   A+S+L++++ +    D     +  L DLK W+S
Sbjct  133  CEELMDLALSELRQSLVRLGYIDDFTKFNEMLVDLKVWLS  172



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   100 bits (250),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 55/164 (34%), Positives = 100/164 (61%), Gaps = 11/164 (7%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFGGQetseteee-------GNIATSQKAIESVCQP  267
            E K + + ++GV S++L+AMV+A+  G + T  T+           +ATS KA+ S+CQ 
Sbjct  11   ERKKERVAVLGVFSVMLLAMVVAVTVGIKGTGHTDTSYEEEEDDDGLATSSKAVRSICQM  70

Query  268  TDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMAL  447
             +Y++ C  +L+ +   ++T+PK L+Q  FN  +  +  A+ NS+ ++   DD+R+  AL
Sbjct  71   VEYQRACERTLAHA---HTTNPKKLVQTTFNAAMEKLEGALTNSSTIKAAKDDRRNAGAL  127

Query  448  QTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +TCK++   A++DLKR+I +   FD M   +  + +++ W+SGA
Sbjct  128  ETCKQVVEYAITDLKRSIDQMDHFD-MHKKEEHVENMRIWLSGA  170



>gb|KEH37214.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=376

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 90/152 (59%), Gaps = 4/152 (3%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSL  300
            K   ++GVS ++LVAMV A+A    +  + E+   I+ SQK ++ +CQ T+YK+TC  SL
Sbjct  14   KKYALLGVSCILLVAMVGAVAVSLTKGDDKEQTAQISNSQKNVDMLCQSTEYKETCHKSL  73

Query  301  SKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAV  480
              +   +STD K LI+AAF+ T  ++R+ I+NS L + L  D  +K A++ C E+   AV
Sbjct  74   ENA---SSTDTKELIKAAFSATAEELRKHINNSALYQELGKDSMTKQAMEICNEVLDYAV  130

Query  481  SDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
              + +++     FD    +  +  D+K W++G
Sbjct  131  DGIHKSVGTLDQFDF-HKLSEYAFDIKVWLTG  161



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 74/118 (63%), Gaps = 4/118 (3%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G ++TS KA+ ++C PTDYK+TC +SL+     N+TDPK LI+ AFN  + +I  AI NS
Sbjct  26   GGVSTSTKAVHAICTPTDYKETCESSLA---GANTTDPKELIKVAFNAAVNNIADAIKNS  82

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            TL+++   D  +K AL  C ++   AV DL+R   K   FD    MD ++ DLK W+S
Sbjct  83   TLMKDAAADNSTKDALDVCNDVLESAVDDLRRAGDKVGEFDAT-KMDEYVEDLKVWLS  139



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 72/116 (62%), Gaps = 3/116 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            +ATS K++ES+CQPT YKQTC  +LS   A N +DPK  I+ AF  T+ DI+ AI N   
Sbjct  38   VATSTKSVESMCQPTPYKQTCEKTLSA--AKNVSDPKDYIKVAFEATVTDIKNAIMNIEP  95

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            ++    D  +K AL  C+EL   AV DL+ ++AK   FD     D+ + DLKTW+S
Sbjct  96   IKKAASDPYTKDALHACEELFDLAVEDLRGSVAKIENFDFSKIKDV-VDDLKTWLS  150



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            +ATS K++ES+CQPT YKQTC  +LS   A N +DPK  I+ AF  T+ADI+ A+ N+  
Sbjct  38   VATSTKSVESMCQPTPYKQTCEKTLSA--AKNVSDPKDYIKVAFEATVADIKNALKNTEP  95

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            ++    D  +K AL  C+EL   AV DL+ ++AK   FD     DI + DLK+W+S
Sbjct  96   IKKAASDPYTKDALLACEELFDLAVEDLRGSVAKIENFDFSKIKDI-VDDLKSWLS  150



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 95/158 (60%), Gaps = 3/158 (2%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeG-NIATSQKAIESVCQPTDYKQT  285
            ++K K + +I V S+I VAM++A+A G   + ++ ++    ++S+KAIE++CQ T YK+T
Sbjct  4    DSKKKKIALIIVFSVIGVAMIVAVAVGVTCSRKSAKQNKGTSSSKKAIETICQTTSYKET  63

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C +SL K+ AG+++DPK LI+  F V    +   I NS  L++L  D  +  AL  CKE+
Sbjct  64   CQSSLEKA-AGDTSDPKELIKTGFQVAADKLDEVIKNSNTLKDLAKDPMASQALDVCKEM  122

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
               A  DL   + K   FD    M+ ++ DLK W+S A
Sbjct  123  LDTAAEDLLGAVDKMGPFD-ASKMNEYVEDLKVWLSAA  159



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            A S KA++S+C PTDYK+TC +SLS +   N+TDPK L++AAF  T  +I   I NS+L 
Sbjct  37   AGSTKAVQSICAPTDYKETCESSLSHA---NTTDPKELVKAAFEFTEKNIGEVIKNSSLF  93

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            +    D  +K AL+ C+E+   A+ DLKR+   F  FD     + ++ DLKTW+S
Sbjct  94   QEAAKDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANE-YVEDLKTWLS  147



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 98/163 (60%), Gaps = 14/163 (9%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN-----IATSQKAIESVCQPTDYK  279
            + K+M II +SS++L++MV+A+  G    ++++  GN     I  S KA++ VC PTDYK
Sbjct  11   RKKSMVIISISSVLLISMVVAVTVG-VTLNKSDSNGNSEDTEITPSVKAVKDVCAPTDYK  69

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            +TC ++L K +  N+TDP  L++ AF +T+  I  A   S  +R L  D R++MAL  CK
Sbjct  70   KTCEDTLIK-NGKNTTDPVELVKTAFRITMNQITDAAKKSQTMRELQKDPRTRMALDQCK  128

Query  460  ELAGRAVSDLKRT---IAKFRTFDLMDDMDIWLADLKTWISGA  579
            EL   A+ +L  +   + KF  F L+D+    L +L+ W+S A
Sbjct  129  ELMDYALGELSNSFEELGKFE-FHLLDEA---LINLRIWLSAA  167



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 72/117 (62%), Gaps = 2/117 (2%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            A S+KAIE++CQPT YK+TC +SL K  AG++TDPK L++A F V    +   I NS  L
Sbjct  43   AKSKKAIEAICQPTSYKETCQSSLEKV-AGDTTDPKELVKAGFQVAADKVNEVIQNSDTL  101

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++L  D  +  AL  CKEL   AV DL   + K   F++   +D +L DLK W+S A
Sbjct  102  KDLAKDPMASQALDICKELLNTAVEDLLGAVDKMGPFEI-SKVDDYLEDLKVWLSAA  157



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            A S KA++S+C PTDYK+TC +SLS +   N+TDPK L++AAF  T  +I   I NS+L 
Sbjct  37   AGSTKAVQSICAPTDYKETCESSLSDA---NTTDPKELVKAAFEFTEKNIGEVIKNSSLF  93

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            +    D  +K AL+ C+E+   A+ DLKR+   F  FD     + ++ DLKTW+S
Sbjct  94   QEAAKDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANE-YVEDLKTWLS  147



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 91/158 (58%), Gaps = 5/158 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + K + +I +SS++L+ +V+AL  G    +     + EG I  S KA++ VC PTDYK+T
Sbjct  11   RKKRLVLISISSVLLITLVVALTVGFSLKKGEVNGDSEGQINASVKAVKDVCAPTDYKKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L K +  N+TDP  L++ AF+VT+  I  A   S  +  L  D R++MAL  CKEL
Sbjct  71   CEDTLIK-NGNNTTDPMELVKTAFSVTMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +  +   F+    +D  L +L+ W+S A
Sbjct  130  MDYALGELSNSFEELGKFEF-HKLDEALINLRIWLSAA  166



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 71/115 (62%), Gaps = 4/115 (3%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            A S KA++SVC PTDYK TC  SLS +   N+TDPK LI+AAF  T  +I   I NS L 
Sbjct  38   AGSTKAVQSVCAPTDYKDTCEQSLSHA---NTTDPKELIKAAFEFTEKNIGDVIKNSPLF  94

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            +   +D  +K AL  C+E+   A+ DLKR+  K   FD +   + +L DLKTW+S
Sbjct  95   KEAANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANE-YLEDLKTWLS  148



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 92/155 (59%), Gaps = 7/155 (5%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN--IATSQKAIESVCQPTDYKQTC  288
            + ++  II +SS +L++M++A+       ++ +  GN  I TS KAI+ VC PTDYK+TC
Sbjct  12   RKRSYVIISISSAVLISMIVAVTV---SVNKNDNGGNEEITTSVKAIKDVCAPTDYKKTC  68

Query  289  VNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELA  468
             ++L K DA N +DP  L++ AFN T+  I      S  + +L  D R+KMAL  CKEL 
Sbjct  69   EDTLRK-DAKNISDPLELVKTAFNATMKQISNVAKKSQTMIDLQKDPRTKMALDQCKELM  127

Query  469  GRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
              A+ +L ++  +  +F+L   MD  L  LK W+S
Sbjct  128  DYAIVELTKSFDEIGSFEL-HKMDEALIKLKIWLS  161



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 89/154 (58%), Gaps = 3/154 (2%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-GQetseteeeGNIATSQKAIESVCQPTDYKQTCV  291
            + K   II +SS++L++MV+A+  G     S+   +  I TS KAI+ VC PTDYK+TC 
Sbjct  12   RKKRYVIISISSVLLISMVVAVTIGVSVNKSDNAGDEEITTSVKAIKDVCAPTDYKETCE  71

Query  292  NSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAG  471
            ++L K DA +++DP  L++ AFN T+  I      S  +  L  D R+KMAL  CKEL  
Sbjct  72   DTLRK-DAKDTSDPLELVKTAFNATMKQISDVAKKSQTMIELQKDPRAKMALDQCKELMD  130

Query  472  RAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             A+ +L ++  +   F+    +D  L  L+ W+S
Sbjct  131  YAIGELSKSFEELGKFEF-HKVDEALVKLRIWLS  163



>ref|NP_001060715.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAC83510.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 dbj|BAF22629.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAG92656.1| unnamed protein product [Oryza sativa Japonica Group]
Length=566

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G ++TS K++++ CQPTDY+QTC   L K+    ++ P  L +A F VT   I +AI  S
Sbjct  36   GELSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSEKISKAISES  95

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            + L  L +DKR+  ALQ CKEL   AV DLK +  K   F+ M +    + DL+TW+S A
Sbjct  96   STLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFE-MTNFHKAVDDLRTWLSAA  154



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 76/118 (64%), Gaps = 2/118 (2%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++TS K I+  C+PTDY+ TC +SLS + AGN+TDPK L+  AF VTI  ++ A ++ST+
Sbjct  39   LSTSNKNIKDFCRPTDYQATCESSLS-AVAGNTTDPKELVNLAFQVTIDHMKEAFNHSTV  97

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L     D R+  AL+ C+EL   A+ DLK +I +   F L   +D +L DLK WIS +
Sbjct  98   LSEAAKDSRTSDALENCRELLDYAIYDLKSSIDRLDGFSLT-KLDKFLDDLKVWISAS  154



>gb|EAZ05229.1| hypothetical protein OsI_27427 [Oryza sativa Indica Group]
Length=570

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G ++TS K++++ CQPTDY+QTC   L K+    ++ P  L +A F VT   I +AI  S
Sbjct  36   GELSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSEKISKAISES  95

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            + L  L +DKR+  ALQ CKEL   AV DLK +  K   F+ M +    + DL+TW+S A
Sbjct  96   STLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFE-MTNFHKAVDDLRTWLSAA  154



>gb|EAZ41174.1| hypothetical protein OsJ_25671 [Oryza sativa Japonica Group]
Length=570

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G ++TS K++++ CQPTDY+QTC   L K+    ++ P  L +A F VT   I +AI  S
Sbjct  36   GELSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSEKISKAISES  95

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            + L  L +DKR+  ALQ CKEL   AV DLK +  K   F+ M +    + DL+TW+S A
Sbjct  96   STLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFE-MTNFHKAVDDLRTWLSAA  154



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 90/155 (58%), Gaps = 13/155 (8%)
 Frame = +1

Query  151  LILVAMVLALAFGGQets-----------eteeeGNIATSQKAIESVCQPTDYKQTCVNS  297
            L+LVAMV+A+    ++                ++ ++A++ KA++++C PT YK+ CV S
Sbjct  2    LLLVAMVVAVTISIKQNQNDVKDDFKDDLADNKKNHVASTLKAVQTICHPTTYKKECVES  61

Query  298  LS-KSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGR  474
            L  +++AGN TDPK LI+ AFNVTI  I   +  + +   +  D RSK AL TCK+L   
Sbjct  62   LVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKDSRSKDALDTCKQLMHL  121

Query  475  AVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++ +  R++     FDL   M+  L +LK W++GA
Sbjct  122  SIGEFTRSLDGISEFDL-KHMNQILMNLKVWLNGA  155



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 56/155 (36%), Positives = 90/155 (58%), Gaps = 13/155 (8%)
 Frame = +1

Query  151  LILVAMVLALAFGGQets-----------eteeeGNIATSQKAIESVCQPTDYKQTCVNS  297
            L+LVAMV+A+    ++                ++ ++A++ KA++++C PT YK+ CV S
Sbjct  2    LLLVAMVVAVTISIKQNQNDVKDDFKDDLADNKKNHVASTLKAVQTICHPTTYKKECVES  61

Query  298  LS-KSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGR  474
            L  +++AGN TDPK LI+ AFNVTI  I   +  + +   +  D RSK AL TCK+L   
Sbjct  62   LVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKDSRSKDALDTCKQLMHL  121

Query  475  AVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++ +  R++     FDL   M+  L +LK W++GA
Sbjct  122  SIGEFTRSLDGISEFDL-KHMNQILMNLKVWLNGA  155



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G ++TS K+I+S CQP DY++TC ++L  S AGN+++P  L +A F  T   I +A+  S
Sbjct  37   GELSTSVKSIKSFCQPVDYRETCESTLEAS-AGNASNPTDLAKAIFKATSEKIEQAVRES  95

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            T+L +L +D+R+  AL+ CKEL   A+ DLK T  K   F+ M +    + DLKTW+S A
Sbjct  96   TVLNDLKNDQRTSGALKDCKELLDYAIDDLKTTFDKLGGFE-MSNFKHAVDDLKTWLSSA  154



>gb|KJB38561.1| hypothetical protein B456_006G260700 [Gossypium raimondii]
Length=564

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G I++S KA+++VCQPT +K+ C  SL  S   NSTDPK LI+ +F   I +IR+ + NS
Sbjct  38   GEISSSTKAVQTVCQPTQFKEACEKSLESS---NSTDPKELIRTSFQAAIEEIRKVLANS  94

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              +++LN D  +K AL+ CKE+   +++DL+ +  K   ++ M  +  +L +L+ W+SGA
Sbjct  95   ATIQDLNKDDNNKAALKVCKEVLDLSIADLQLSFDKLGGYE-MSKIGDYLLNLRVWLSGA  153



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/120 (41%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSL-SKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            ++A++ KA++++C PTDYK+ C  +L ++++A N TDPK LI+ AFNVT+  I   I  +
Sbjct  51   HVASTMKAVQTICHPTDYKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKET  110

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             LL  +  D RSK AL TCK+L   ++ +  R++     FDL  ++D  L +LK W++GA
Sbjct  111  DLLHEVEKDPRSKDALDTCKQLMDLSIDEFTRSLDGINEFDL-QNIDKILMNLKVWLNGA  169



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            +ATS K++ES+CQPT YKQTC  +LS   A N +DPK  I+ AF  T+ADI+ AI N+  
Sbjct  38   VATSTKSVESMCQPTPYKQTCEKTLSA--AKNVSDPKDYIKVAFEATVADIKNAIKNTEP  95

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            ++    D  +K AL  C+E+   AV +L+ +IA+   FD     DI + DLK+W+S
Sbjct  96   VKKAASDPYTKDALLACEEVFDLAVEELRGSIARIENFDFSKMKDI-VDDLKSWLS  150



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 88/153 (58%), Gaps = 2/153 (1%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVN  294
            + +   +I +SS++LV+MV+A+  G    S+   +  I  S KAI+ VC PTDYK+TC +
Sbjct  12   RKRRYVVISISSVLLVSMVVAVTIGVSVNSDNGTKEEITASVKAIKDVCAPTDYKKTCED  71

Query  295  SLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGR  474
            +L K DA +++DP  L++ AFN T+  I      S  +  L  D R+KMAL  C EL   
Sbjct  72   TLRK-DAKDTSDPLELVRTAFNATMKQISNVAKKSLTMIELQKDPRTKMALDQCTELMDF  130

Query  475  AVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            A+ +L ++  +   F+L   +D  L  LK W+S
Sbjct  131  AIGELSKSFDELGRFEL-HKVDDALIKLKVWLS  162



>gb|KHN43318.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=561

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
            ++A+S KA++++C PTDYK+ C ++L +  A N TDP+ LI+ AF+VTI+ I   +  + 
Sbjct  27   HVASSMKAVKTLCAPTDYKKECEDNLIEH-ASNITDPRELIKIAFHVTISKIGEGLEKTQ  85

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L+  + +D  +K AL TCK+L   ++ +  R++ KF  FDL +++D  L  LK W+SGA
Sbjct  86   LMHEVENDPITKEALDTCKQLMNLSIGEFTRSLDKFAKFDL-NNLDNILTSLKVWLSGA  143



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 88/160 (55%), Gaps = 7/160 (4%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-----GQetseteeeGNIATSQKAIESVCQPTDYK  279
            K K   II +SS++L++MV+A+  G               G +  S KAI+ VC PTDYK
Sbjct  12   KRKRYVIITISSVLLISMVVAVTVGVSLNKEDNGDGEGGNGQVTASVKAIKEVCAPTDYK  71

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            +TC ++L K +A N++DP  L++ AF VT+  I  A   S  L  +  D R+KMAL  CK
Sbjct  72   KTCEDTLRK-NANNTSDPLELVKTAFEVTMKQIAEAAAKSKTLIEIQKDPRTKMALDQCK  130

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            EL   A  +LK +  +   F+    +D  L +L+ W+S A
Sbjct  131  ELMDYAFDELKSSFDELGKFEF-HKLDEALINLRIWLSAA  169



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            +ATS K++ES+CQPT YKQTC  +LS   A N +DPK  I+ AF  T+ADI+ AI N+  
Sbjct  38   VATSTKSVESMCQPTPYKQTCEKTLSA--AKNVSDPKDYIKVAFEATVADIKNAIKNTEP  95

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            ++    D  +K AL  C+E+   AV +L+ +IA+   FD     DI + DLK+W+S
Sbjct  96   VKKAASDPYTKDALLACEEVFDLAVEELRGSIARIENFDFSKMKDI-VDDLKSWLS  150



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 81/124 (65%), Gaps = 15/124 (12%)
 Frame = +1

Query  220  GNIAT-SQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHN  396
            G+I+T S KA++S+C PTDYK+TC +SLS +   NST+P  LI+AAF+ T+ +I   I N
Sbjct  43   GSISTGSTKAVQSICAPTDYKETCESSLSHA---NSTNPNELIKAAFDFTVKNIGDIITN  99

Query  397  STLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDI-----WLADLK  561
            S L +   +D  +K AL+ C+E+   A+ DLK      R+FD +D+ DI     ++ +LK
Sbjct  100  SPLFKEAANDDGTKQALEICQEVLDTAIDDLK------RSFDSVDEFDITNASEYVENLK  153

Query  562  TWIS  573
            TW+S
Sbjct  154  TWLS  157



>ref|XP_006651293.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like, 
partial [Oryza brachyantha]
Length=307

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G ++TS K+I+S CQP DY++TC ++L  S AGN+++P  L +A F  T   I +A   +
Sbjct  37   GELSTSVKSIKSFCQPVDYRETCESTLEAS-AGNASNPTDLAKAIFKATSEKIEQAGRGA  95

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            T+L +L +D+R+  AL+ CKEL   A+ DLK T  K   F+ M +    + DLKTW+S A
Sbjct  96   TVLNDLKNDQRTSGALKDCKELLDYAIDDLKTTFDKLGGFE-MSNFKHAVDDLKTWLSSA  154



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 88/153 (58%), Gaps = 2/153 (1%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVN  294
            + +   +I +SS++LV+MV+A+  G    ++   +  I  S KAI+ VC PTDYK+TC +
Sbjct  12   RKRRYVVISISSVLLVSMVVAVTIGVSFNNDNGTKEEITASVKAIKDVCAPTDYKKTCED  71

Query  295  SLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGR  474
            +L K DA +++DP  L++ AFN T+  I      S  +  L  D R+KMAL  C EL   
Sbjct  72   TLRK-DAKDTSDPLELVRTAFNATMKQISNVGKKSLTMIELQKDPRTKMALDQCTELMDY  130

Query  475  AVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            A+ +L ++  +   F+L   +D  L  LK W+S
Sbjct  131  AIGELSKSFDELGRFEL-HKVDDALIKLKVWLS  162



>gb|KHN04169.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=494

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 80/119 (67%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
            ++A+S KA++++C PT+Y++ C  SL  + AGN+TDPK LI+  FN+TI  I   +  + 
Sbjct  27   HVASSIKAVQTLCHPTNYEKECEESLI-AGAGNTTDPKELIKIFFNITITKIGDKLKETN  85

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +L  + ++ R+KMAL TCK+L   ++ +L R++     F+L+ ++D  L +LK W+SGA
Sbjct  86   ILHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLI-NVDKILMNLKVWLSGA  143



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 88/154 (57%), Gaps = 3/154 (2%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetse-teeeGNIATSQKAIESVCQPTDYKQTCV  291
            + +   +I +SS++LV+MV+A+  G    +     +  I  S KAI+ VC PTDYK+TC 
Sbjct  12   RKRRYAMISISSVLLVSMVVAVTIGVNVNNHDNGSKEEITASVKAIKEVCAPTDYKKTCE  71

Query  292  NSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAG  471
            ++L K DA +++DP  L++AAFNVT+  I      S  +  L  D R+KMAL  CKEL  
Sbjct  72   DTLRK-DAKDTSDPLELVRAAFNVTMKQITNVARKSQTMIELQKDPRTKMALDQCKELMD  130

Query  472  RAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             A+ +L  +  +   F+    +D  L  +K W+S
Sbjct  131  YAIGELSNSFVELGKFEF-HKVDEVLIKVKVWLS  163



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 88/154 (57%), Gaps = 3/154 (2%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetse-teeeGNIATSQKAIESVCQPTDYKQTCV  291
            + +   +I +SS++LV+MV+A+  G    +     +  I  S KAI+ VC PTDYK+TC 
Sbjct  12   RKRRYAMISISSVLLVSMVVAVTIGVNVNNHDNGSKEEITASVKAIKEVCAPTDYKKTCE  71

Query  292  NSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAG  471
            ++L K DA +++DP  L++AAFNVT+  I      S  +  L  D R+KMAL  CKEL  
Sbjct  72   DTLRK-DAKDTSDPLELVRAAFNVTMKQITNVARKSQTMIELQKDPRTKMALDQCKELMD  130

Query  472  RAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             A+ +L  +  +   F+    +D  L  +K W+S
Sbjct  131  YAIGELSNSFVELGKFEF-HKVDEVLIKVKVWLS  163



>ref|XP_003559753.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=575

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 69/118 (58%), Gaps = 1/118 (1%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++TS K++++ CQP DYK+TC   LSK      T P  L +A F  T A I +A+  S  
Sbjct  42   LSTSVKSVKAFCQPMDYKETCEAELSKMSGDKPTSPTELAKAIFEATSAKINKAVAESAT  101

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L  L +DKR+  ALQ CKEL   AV DLK +  K   F+ M D +  + DLKTW+S A
Sbjct  102  LEELKNDKRTSGALQNCKELLEYAVEDLKTSFDKLGGFE-MTDFNKAVDDLKTWLSAA  158



>ref|XP_004958780.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=565

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 2/133 (2%)
 Frame = +1

Query  181  AFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFN  360
            +F G  +S+ E + N++ S K++++ CQPTDY+QTC   LSK+ AGN++ P  L +  F 
Sbjct  25   SFKGNSSSKGEGDDNLSMSVKSVKAFCQPTDYQQTCEAELSKA-AGNASSPTELAKVIFG  83

Query  361  VTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMD  540
            VT   I +AI  S  L  L +DKR+  ALQ CKE+   A+ DLK +  K   F+ M +  
Sbjct  84   VTSDKIHKAISESATLTELKNDKRTSGALQNCKEMLEYAIDDLKSSFDKLGGFE-MTNFK  142

Query  541  IWLADLKTWISGA  579
              + DLKTW+S A
Sbjct  143  KAVDDLKTWLSAA  155



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            A S KA++S+C PTDYK+TC +SLS +   N+T+PK LIQAAF+ T+ +I   + NS L 
Sbjct  47   AGSTKAVQSICAPTDYKETCESSLSHA---NTTNPKELIQAAFDFTVKNIGDIVKNSPLF  103

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            +   +D  +K ALQ C+E+   A+ DL R+  K    D     + ++ DLKTW+S
Sbjct  104  KEAANDDDTKQALQICQEVLDVAIDDLTRSFDKVGELDAAKATE-YVEDLKTWLS  157



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 98/160 (61%), Gaps = 6/160 (4%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteee-----GNIATSQKAIESVCQPTDYK  279
            K K + IIGVSS+ILVAMV+A+A G    S +         ++  S KAI+++CQPTDYK
Sbjct  20   KKKRLAIIGVSSIILVAMVVAVAVGVSHHSGSGSSESGSDNHVQDSMKAIKTICQPTDYK  79

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            + CV+SL+     N+TDPK L++ +F V +  +++    S LL+ +  D  ++ AL  C 
Sbjct  80   EACVSSLTSVAGSNTTDPKELVKLSFEVALEKVKKVAGQSALLKEVEKDPGTRQALSICD  139

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            E+   A+ +LK +I +   FDL  +M+  + ++++W+S A
Sbjct  140  EIMDYAIDELKNSIDQVGGFDL-SNMEEIIENIRSWLSAA  178



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 89/147 (61%), Gaps = 3/147 (2%)
 Frame = +1

Query  142  VSSLILVAMVLALAFGGQetseteeeG-NIATSQKAIESVCQPTDYKQTCVNSLSKSDAG  318
            V S++ VAM++A+A G   + ++ ++    A+S+KAIE++CQ T YK+TC +SL K+ AG
Sbjct  15   VFSVMGVAMIVAVAVGVTCSRKSAKQNKGTASSKKAIETICQTTSYKETCQSSLEKA-AG  73

Query  319  NSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAVSDLKRT  498
            +++DPK LI+A F V    +   I NS  L++L  D  +  AL  CKE+   +  DL   
Sbjct  74   DTSDPKELIKAGFQVAADKLDEVIQNSNTLKDLAKDPMASQALDVCKEMLDTSTEDLLAA  133

Query  499  IAKFRTFDLMDDMDIWLADLKTWISGA  579
            + K   FD    M+ ++ DLK W+S A
Sbjct  134  VDKMGPFD-ASKMNEYVEDLKVWLSAA  159



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 96/161 (60%), Gaps = 11/161 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + +   +I +SS++L++MV+A+  G    +   ++E +G I  S KA++ VC PTDY++T
Sbjct  11   RKRRYVVITISSVLLISMVVAVTVGVSLNKNDGDSEGKGEITASVKAVKDVCAPTDYRKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L K +  N+TDP  L++ AF+VT+  I  A   S  +  L  D R++MAL  CKEL
Sbjct  71   CEDTLIK-NGKNTTDPMELVKTAFSVTMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  466  AGRAVSDLKRT---IAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +   + KF  F L+D+    L +L+ W+S A
Sbjct  130  MDYALGELSNSFEELGKFE-FHLLDEA---LINLRIWLSAA  166



>gb|KEH32301.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 100/162 (62%), Gaps = 10/162 (6%)
 Frame = +1

Query  109  ETKS----KNMTIIGVSSLILVAMVLALAFGGQetseteeeGN--IATSQKAIESVCQPT  270
            ET+S    K   I+GVSS++L+AMV A+A G  +  + E EG+  I  SQK ++ +C  T
Sbjct  7    ETQSHASKKKFAILGVSSILLIAMVAAVAVGVNDAGQVESEGDNQITKSQKNVKVLCGTT  66

Query  271  DYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQ  450
            +YKQTC  SL+K+  GN  D K LI+ AFN T  ++ + IHNSTL + L  +  +K A+ 
Sbjct  67   EYKQTCEKSLAKT--GNK-DMKELIKQAFNATAEELVKQIHNSTLYKELATNDMTKQAMD  123

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
             CKE+ G AV D+ ++I     FDL + +D    DLK W+SG
Sbjct  124  ICKEVLGYAVDDVHQSIHSLDKFDL-NKIDEIAYDLKVWLSG  164



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 96/161 (60%), Gaps = 11/161 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            K +   +I +SS++L++M++A+       +   +++  G +A S KA++ VC PTDYK+T
Sbjct  11   KKRRYAVILISSVLLISMIVAVTISLNKNEANGDSKSNGELAASVKAVKDVCAPTDYKKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L K +  N+TDP  L++ AF+VT+  I  A   S  + +L  D R++MAL  CKEL
Sbjct  71   CEDTLLK-NGHNTTDPMELVKTAFSVTMKQITDAAKKSQTMMDLQKDPRTRMALDQCKEL  129

Query  466  AGRAVSDLKRT---IAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +   + KF  F L+D+    L +L+ W+S A
Sbjct  130  MDYALGELSNSFEELGKFE-FHLLDEA---LINLRIWLSAA  166



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 70/115 (61%), Gaps = 4/115 (3%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            A S KA+++VC PTDYK TC  SLS +   N+TDPK LI+AAF  T  +I   I NS L 
Sbjct  38   AGSTKAVQNVCAPTDYKDTCEQSLSNA---NTTDPKELIKAAFEFTEKNIGDVIKNSPLF  94

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            +   +D  +K AL  C+E+   A+ DLKR+  K   FD     + +L DLKTW+S
Sbjct  95   KEAANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFD-ASKANEYLEDLKTWLS  148



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 80/119 (67%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
            ++A+S KA++++C PT+Y++ C  SL  + AGN+TDPK L++  FN+TI  I   +  + 
Sbjct  27   HVASSIKAVQTLCHPTNYEKECEESLI-AGAGNTTDPKELVKIFFNITITKIGDKLKETN  85

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +L  + ++ R+KMAL TCK+L   ++ +L R++     F+L+ ++D  L +LK W+SGA
Sbjct  86   ILHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLI-NVDKILMNLKVWLSGA  143



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 11/161 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + +   II +SS++L++MV+A+  G    +     + +  I +S KA++ VC PTD+K+T
Sbjct  11   RKRRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDFKKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C +SL+K +  N+TDP  L++ AF+ T+  I  A   S  +  L  D R+KMAL  CKEL
Sbjct  71   CEDSLNK-NGNNTTDPVELVKTAFSATMKQITAAAKKSQTMMELQKDPRTKMALDQCKEL  129

Query  466  AGRAVSDLKRT---IAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +   + KF  F L+D+    L +L+ W+S A
Sbjct  130  MDYALGELSNSFEELGKFE-FHLLDEA---LINLRIWLSAA  166



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 11/161 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + +   II +SS++L++MV+A+  G    +     + +  I +S KA++ VC PTD+K+T
Sbjct  11   RKRRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDFKKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C +SL+K +  N+TDP  L++ AF+ T+  I  A   S  +  L  D R+KMAL  CKEL
Sbjct  71   CEDSLNK-NGNNTTDPVELVKTAFSATMKQITAAAKKSQTMMELQKDPRTKMALDQCKEL  129

Query  466  AGRAVSDLKRT---IAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +   + KF  F L+D+    L +L+ W+S A
Sbjct  130  MDYALGELSNSFEELGKFE-FHLLDEA---LINLRIWLSAA  166



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 90/160 (56%), Gaps = 7/160 (4%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-----GQetseteeeGNIATSQKAIESVCQPTDYK  279
            + K   II +SS++L++MV+A+  G          ++E  G I  S KA++ +C PTDYK
Sbjct  11   RKKRYVIISISSVLLISMVVAVTVGVNLNKHDGKGDSESNGQITASVKAVKDICAPTDYK  70

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            +TC  SL K +  N+TDP  L++ AF+VT+  I  A   S  + +L  D R++MAL  CK
Sbjct  71   KTCEYSLIK-NGNNTTDPMELVKTAFSVTMKQITDAAKKSQTIIDLQKDPRTRMALDQCK  129

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            EL   A+ +L  +  +    +    +D  L +L+ W+S A
Sbjct  130  ELMDYALGELSNSFEELGKLEF-HKLDEVLINLRIWLSAA  168



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 11/161 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + +   II +SS++L++MV+A+  G    +     + +  I +S KA++ VC PTD+K+T
Sbjct  11   RKRRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDFKKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C +SL+K +  N+TDP  L++ AF+ T+  I  A   S  +  L  D R+KMAL  CKEL
Sbjct  71   CEDSLNK-NGNNTTDPVELVKTAFSATMKQITAAAKKSQTMMELQKDPRTKMALDQCKEL  129

Query  466  AGRAVSDLKRT---IAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +   + KF  F L+D+    L +L+ W+S A
Sbjct  130  MDYALGELSNSFEELGKFE-FHLLDEA---LINLRIWLSAA  166



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 90/160 (56%), Gaps = 7/160 (4%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-----GQetseteeeGNIATSQKAIESVCQPTDYK  279
            + K   II +SS++L++MV+A+  G          ++E  G I  S KA++ +C PTDYK
Sbjct  11   RKKRYVIISISSVLLISMVVAVTVGVNLNKHDGKGDSESNGQITASVKAVKDICAPTDYK  70

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            +TC  SL K +  N+TDP  L++ AF+VT+  I  A   S  + +L  D R++MAL  CK
Sbjct  71   KTCEYSLIK-NGNNTTDPMELVKTAFSVTMKQITDAAKKSQTIIDLQKDPRTRMALDQCK  129

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            EL   A+ +L  +  +    +    +D  L +L+ W+S A
Sbjct  130  ELMDYALGELSNSFEELGKLEF-HKLDEVLINLRIWLSAA  168



>ref|XP_004296866.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Fragaria vesca subsp. vesca]
Length=559

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVN  294
            K K + IIGVS++ILVAMV+A+A G  ++   +E+   ATS KAIE+VCQPTD+K TC  
Sbjct  9    KKKKIAIIGVSAIILVAMVVAVAVGVTKSKGHKEDNTPATSSKAIEAVCQPTDFKDTCKT  68

Query  295  SLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGR  474
            +L+ ++AGN TDPK LI+ A  +    ++  + NS  +  +  D     ALQ CKEL   
Sbjct  69   TLA-ANAGNVTDPKELIKVAMKIATDKLQEVVDNSQTMHEVVKDPLGDQALQNCKELIQY  127

Query  475  AVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +++D+K+       FD+   +  ++ +L+ W+S +
Sbjct  128  SINDIKKAFGNMGPFDV-SKVKNYVKELENWLSAS  161



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++TS K ++  C+PTDYK+TC N+LS S AG   DPK L+  AFN+T+  I  AI +ST+
Sbjct  39   LSTSVKNVQDFCRPTDYKETCENTLS-SVAGPDADPKELLNLAFNITVKHINDAIDHSTV  97

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            L     D  +  AL+ C+EL   A+ DL+R++ +   F +  ++D +L DLK W+S
Sbjct  98   LSEAAKDPSTSEALENCRELLDYAIDDLRRSVDRLGDFSVA-NLDKFLDDLKIWLS  152



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 91/160 (57%), Gaps = 7/160 (4%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG-----GQetseteeeGNIATSQKAIESVCQPTDYK  279
            + K   +I +SS++L++MV+A+  G          ++E  G I  S KA++ +C PTDYK
Sbjct  11   RKKRYAVISISSVLLISMVVAVTVGVNLSKNDGKGDSEGNGQITASVKAVKDICAPTDYK  70

Query  280  QTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCK  459
            +TC +SL K +  N+TDP  L++ AF+VT+  I  A   S  + +L  D R++MAL  CK
Sbjct  71   KTCEDSLIK-NGKNTTDPMELVKTAFSVTMKQITDAAKKSQTIIDLQKDPRTRMALDQCK  129

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            EL   A+ +L  +  +    +    +D  L +L+ W+S A
Sbjct  130  ELMDYALGELSNSFEELGKLEF-HKLDEVLINLRIWLSAA  168



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 71/115 (62%), Gaps = 4/115 (3%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            A S KA++++C PTDY+ TC  SLS +   N+TDPK LI+AAF  T  +I   I NS L 
Sbjct  38   AGSTKAVQNICAPTDYQDTCEQSLSNA---NTTDPKELIKAAFEFTEKNIGDVIKNSPLF  94

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            +   +D  +K AL  C+E+   A+ DLKR+  K   FD +   + +L DLKTW+S
Sbjct  95   KEAANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANE-YLEDLKTWLS  148



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 71/115 (62%), Gaps = 4/115 (3%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            A S KA++++C PTDY+ TC  SLS +   N+TDPK LI+AAF  T  +I   I NS L 
Sbjct  38   AGSTKAVQNICAPTDYQDTCEQSLSNA---NTTDPKELIKAAFEFTEKNIGDVIKNSPLF  94

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            +   +D  +K AL  C+E+   A+ DLKR+  K   FD +   + +L DLKTW+S
Sbjct  95   KEAANDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDAL-KANEYLEDLKTWLS  148



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 101/168 (60%), Gaps = 20/168 (12%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetsete-------eeGNIATSQKAIESVCQPTD  273
            K+K   +IGVSSL LVAMV+A+A G    + T            I+TS KA++++CQPTD
Sbjct  6    KNKKAALIGVSSLFLVAMVVAVAVGVNRKNPTTDSSGGDGATAEISTSTKAVQALCQPTD  65

Query  274  YKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQT  453
            YK+TC  +LS++   N++DP+ LI++ F+V + +I+ AI NST L+    D  +K AL  
Sbjct  66   YKETCEKALSEAGT-NTSDPRELIKSGFHVAVNEIKWAIGNSTQLKEAASDPMAKQALDA  124

Query  454  CKELAGRAVSDLKRTIAKFRTFD-LMDDMDI-----WLADLKTWISGA  579
            C EL   A+ DL        +FD + D+ D+     ++ DLK W+SGA
Sbjct  125  CGELMDYAIDDL------VISFDRITDNFDVQKLNDYVEDLKIWLSGA  166



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 91/158 (58%), Gaps = 5/158 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + K   +I +SS++L++MV+A+  G    +   +++  G I +S KA++ VC PTDYK+T
Sbjct  11   RKKRFIVITISSVLLISMVVAVTVGVSLNKSGDDSDGNGEITSSVKAVKDVCAPTDYKKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L K +  N++DP  L++ AF  T+  I  A   S  +  L  D R++MAL  CKEL
Sbjct  71   CEDTLIK-NGNNTSDPVELVKTAFRATMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +  +   F+    +D  L +++ W+S A
Sbjct  130  MDYALGELSNSFEELGKFEF-HKLDEALINMRIWLSAA  166



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 93/160 (58%), Gaps = 11/160 (7%)
 Frame = +1

Query  124  NMTIIG-VSSLILVAMVLALAFG------GQetseteeeGNIATSQKAIESVCQPTDYKQ  282
            N   IG ++SL+LVA V+A A           +S    +  I+TS K++  +CQ TDYK+
Sbjct  4    NKVAIGSIASLLLVACVVAAAISTTSKRNEDNSSNNNNDSQISTSAKSVNVICQQTDYKE  63

Query  283  TCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRN-LNDDKRSKMALQTCK  459
            TCV SL+K  A N+ DPK L++ AF  TI D+   I NS LL N  + D R+K AL+TC 
Sbjct  64   TCVKSLAK--ANNTNDPKDLLKVAFGATINDLFDVIKNSALLINEASKDPRTKDALKTCG  121

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +L   A+ D++R+  +   FD     D +  DLKTW+S +
Sbjct  122  DLLDVAIDDVRRSFDEIGVFDATKFKD-YADDLKTWLSAS  160



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 92/158 (58%), Gaps = 5/158 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + K   +I +SS++L++MV+A+  G    +  ++++  G I +S KA++ VC PTDYK+T
Sbjct  11   RKKRFIVITISSVLLISMVVAVTVGVSLNKGDNDSDGNGEITSSVKAVKDVCAPTDYKKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L K +  N++DP  L++ AF  T+  I  A   S  +  L  D R++MAL  CKEL
Sbjct  71   CEDTLIK-NGNNTSDPIELVKTAFKATMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +  +   F+    +D  L +++ W+S A
Sbjct  130  MDYALGELSNSFEELGKFEF-HKLDEALINMRIWLSAA  166



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 92/158 (58%), Gaps = 5/158 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + K   +I +SS++L++MV+A+  G    +  ++++  G I +S KA++ VC PTDYK+T
Sbjct  11   RKKRFIVITISSVLLISMVVAVTVGVSLNKGDNDSDGNGEITSSVKAVKDVCAPTDYKKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L K +  N++DP  L++ AF  T+  I  A   S  +  L  D R++MAL  CKEL
Sbjct  71   CEDTLIK-NGNNTSDPIELVKTAFKATMKQITDAAKKSQTMMELQKDPRTRMALDQCKEL  129

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +  +   F+    +D  L +++ W+S A
Sbjct  130  MDYALGELSNSFEELGKFEF-HKLDEALINMRIWLSAA  166



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 91/163 (56%), Gaps = 7/163 (4%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDY  276
            GE K K   I GV + +LV MV+A+          SE      I T+  A+E+VC PTDY
Sbjct  5    GELKKKKCIIAGVITALLVLMVVAVGITTSRNTSHSEKIVPVQIKTATTAVEAVCAPTDY  64

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST--LLRNLNDDKRSKMALQ  450
            K+TCVNSL K+   +ST P  LI+  FNVTI  I  +I  ++  L     +DK +K AL+
Sbjct  65   KETCVNSLMKASP-DSTQPLDLIKLGFNVTIRSIEDSIKKASVELTAKAANDKDTKGALE  123

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             C++L   A  DLK+ +  F  F +    D ++ DL+ W+SG+
Sbjct  124  LCEKLMNDATDDLKKCLDNFDGFSIPQIED-FVEDLRVWLSGS  165



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 95/161 (59%), Gaps = 11/161 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + +   +I +SS++L++MV+A+  G    +   +++ +  +  S KA++ VC PTDY++T
Sbjct  11   RKRRYIVITISSVLLISMVVAVTVGVSLNKHDGDSKGKAEVNASVKAVKDVCAPTDYRKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L K +  N+TDP  L++ AFNVT+  I  A   S  +  L  D R++MAL  CKEL
Sbjct  71   CEDTLIK-NGKNTTDPMELVKTAFNVTMKQITDAAKKSQTIMELQKDSRTRMALDQCKEL  129

Query  466  AGRAVSDLKRT---IAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +   + KF  F L+D+    L +L+ W+S A
Sbjct  130  MDYALDELSNSFEELGKFE-FHLLDEA---LINLRIWLSAA  166



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 95/161 (59%), Gaps = 11/161 (7%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + +   +I +SS++L++MV+A+  G    +   +++ +  +  S KA++ VC PTDY++T
Sbjct  11   RKRRYIVITISSVLLISMVVAVTVGVSLNKHDGDSKGKAEVNASVKAVKDVCAPTDYRKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L K +  N+TDP  L++ AFNVT+  I  A   S  +  L  D R++MAL  CKEL
Sbjct  71   CEDTLIK-NGKNTTDPMELVKTAFNVTMKQITDAAKKSQTIMELQKDSRTRMALDQCKEL  129

Query  466  AGRAVSDLKRT---IAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +   + KF  F L+D+    L +L+ W+S A
Sbjct  130  MDYALDELSNSFEELGKFE-FHLLDEA---LINLRIWLSAA  166



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G ++TS K+I+S CQP DY++TC  +L ++ AGN+T P  L +A F VT   I +A+  S
Sbjct  37   GEMSTSVKSIKSFCQPVDYRETCEKAL-RAAAGNATSPTDLAKAIFKVTSDRIEKAVRES  95

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             +L  L +D R+K AL  C+EL   A+ DLK T  +   F+ M +    + DL+TW+S A
Sbjct  96   AVLNELKNDPRTKGALDNCRELLDYAIDDLKTTFDRLGGFE-MTNFKSAVDDLRTWLSSA  154



>tpg|DAA44942.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=566

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 79/137 (58%), Gaps = 2/137 (1%)
 Frame = +1

Query  169  VLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQ  348
            +  ++F G       EEG ++TS K+I+S CQP DY++TC  +L ++ AGN+T P  L +
Sbjct  20   ICVVSFKGSGDGGRAEEGEMSTSVKSIKSFCQPVDYRETCEKAL-EAAAGNATSPTELAK  78

Query  349  AAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLM  528
            A F VT   I +A+  S LL  L  D+R+  AL  C EL   A+ DL+ T  +   F+ M
Sbjct  79   AIFKVTSDRIAKAVRESALLNELKHDRRTSGALHNCGELLDYAIDDLRTTFDRLGGFE-M  137

Query  529  DDMDIWLADLKTWISGA  579
             +    + DL+TW+S A
Sbjct  138  TNFKSAVDDLRTWLSSA  154



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 89/163 (55%), Gaps = 7/163 (4%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAF--GGQetseteeeG-NIATSQKAIESVCQPTDY  276
            GE K K   I G+ + +LV MV+A+A              G  I T+ KA++ VC PTDY
Sbjct  5    GELKKKKCIIAGIITALLVVMVIAVAIIMSRNTIGSETIAGVQIKTTTKAVQEVCAPTDY  64

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST--LLRNLNDDKRSKMALQ  450
            K+TCVNSL K+   +ST P  LI+  FN+TI  I+ +I  ++  L      D  +K AL+
Sbjct  65   KETCVNSLMKASP-DSTQPLELIKLGFNITIQSIKDSIKKASEELKAKAAKDNETKDALE  123

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             C+ L   A  DLK+ +  F  F +    D+ + DL+ W+SG+
Sbjct  124  LCESLMTDATDDLKKCLDNFDGFSITHIEDL-VEDLRVWLSGS  165



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            + T+ KAI ++C+PTDY + C +SL+ + AGN TDPK L++ +F   +  +R A ++S++
Sbjct  58   LTTTSKAIRAICRPTDYAEECQSSLA-ARAGNVTDPKKLVELSFTSAMDSLREAFNHSSV  116

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            L+    D R+  AL+ CKEL   A+ DLK ++A+F   D+    D+ + DLK W+S
Sbjct  117  LQEAAKDPRTSEALENCKELLDYAIDDLKNSVARFGGVDMAKMSDV-VDDLKVWLS  171



>gb|KHN03341.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=554

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 88/165 (53%), Gaps = 20/165 (12%)
 Frame = +1

Query  82   LTNSFPKMGETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVC  261
            + N      E K + + I+ VSSL+L         GG          +I  SQ+ ++ +C
Sbjct  1    MKNGLDTTHEKKKRKLAILSVSSLLLE--------GGD---------SIVKSQRNVQVIC  43

Query  262  QPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKM  441
            +  +YK+TC  SL+K  A  ++D K LI  AFN T  +I + I NSTL   L  D  +K 
Sbjct  44   ESAEYKETCHKSLAK--ASETSDLKELIITAFNATAEEIAKQIKNSTLYHELATDDMNKQ  101

Query  442  ALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
            A+  CKE+ G AV D+ +++ K   F+L + ++ +  DLK WI+G
Sbjct  102  AMDICKEVLGYAVDDMHQSVRKLEEFEL-NKLNDYAYDLKVWIAG  145



>ref|XP_003529556.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=582

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 5/156 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN--IATSQKAIESVCQPTDYKQTC  288
            K K + ++ VSS++LVAMV+A A G ++ +E  EEG   IA SQ+  + +C+  +YK+TC
Sbjct  11   KKKKIAVLSVSSILLVAMVVAAAVGIRDGAEVVEEGGDTIAKSQRNQQVICESAEYKETC  70

Query  289  VNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELA  468
              SL+K  A  ++D K LI  AFN T  +I   I NSTL   L  D  +K A   CKE+ 
Sbjct  71   HKSLAK--ASGTSDLKELIITAFNATAEEIANQIKNSTLYHELATDHMTKQATDICKEVL  128

Query  469  GRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
            G AV D++R++     FDL + ++ +  DLK WI+G
Sbjct  129  GYAVDDIRRSVHTLEKFDL-NKLNDYAYDLKVWIAG  163



>ref|NP_001151322.1| pectinesterase-1 precursor [Zea mays]
 gb|ACG42376.1| pectinesterase-1 precursor [Zea mays]
Length=567

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
            N++ S K++++ CQP DYK+TC   LSK+ AGN++ P  L +  F VT   I +AI  S 
Sbjct  38   NLSMSVKSVKAFCQPADYKETCEAELSKA-AGNASSPSDLAKVIFKVTSDKIHKAISESA  96

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L  L +D R+  AL  CKE+ G A+ +LK +  K   F+ M + +  + DLKTW+S A
Sbjct  97   TLEELKNDPRTSGALHDCKEMLGYAIDELKSSFDKLXGFE-MTNFNKAVDDLKTWLSAA  154



>ref|XP_002461260.1| hypothetical protein SORBIDRAFT_02g043780 [Sorghum bicolor]
 gb|EER97781.1| hypothetical protein SORBIDRAFT_02g043780 [Sorghum bicolor]
Length=571

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 81/133 (61%), Gaps = 2/133 (2%)
 Frame = +1

Query  181  AFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFN  360
            +F G  +S+ + + N++ S K++++ CQPTDYKQTC   LSK+ AGN++ P  L +  F 
Sbjct  25   SFKGNNSSKGDGDENMSMSVKSVKAFCQPTDYKQTCEAELSKA-AGNASTPSDLAKVIFG  83

Query  361  VTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMD  540
            VT   I +AI  S  L+ L +D+R+  AL+ C EL   A+ DLK +  K   F+ M +  
Sbjct  84   VTSDKIHKAISESETLKELKNDQRTSGALKDCNELLEYAIDDLKSSFDKLGGFE-MTNFK  142

Query  541  IWLADLKTWISGA  579
              + DLKTW+S A
Sbjct  143  KAVDDLKTWLSAA  155



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +1

Query  247  IESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDD  426
            IE++CQPT YK+TC +SL K  AG++TDPK L++A F V    +   I NS  L++L  D
Sbjct  51   IEAICQPTSYKETCQSSLEKV-AGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDLAKD  109

Query  427  KRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              +  AL  CKE+   AV DL   + K   F++   +D +L DLK W+S A
Sbjct  110  PMASQALDVCKEMLNTAVEDLLGAVDKMGPFEI-SKVDDYLEDLKVWLSAA  159



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G ++TS K+I+S CQP DYK+TC  +L ++ AGN+T P  L +  F VT   I +A   S
Sbjct  35   GEMSTSVKSIKSFCQPVDYKETCERAL-EATAGNATSPTDLAKVIFKVTSDRIEKAARES  93

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             +L +L +D R+  AL+ CKEL   A+ DLK T  +   F+ M +    + DLKTW+S A
Sbjct  94   AVLNDLKNDPRTSGALRNCKELLDYAIDDLKTTFDRLGGFE-MTNFKAAVDDLKTWLSSA  152



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 91/152 (60%), Gaps = 4/152 (3%)
 Frame = +1

Query  124  NMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSLS  303
            N  IIG+ ++ L+AMV+A+  G        +   I++S KA++++CQPT+YK+TC  SL+
Sbjct  3    NNAIIGICAVFLLAMVVAVVVGVTHIKNKNDGEEISSSNKAVQALCQPTNYKETCQKSLA  62

Query  304  KSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAVS  483
             S   NS+D K LI+  F   + +I+  + +S  ++ L  D+ +K AL  C+E+   A+ 
Sbjct  63   SS---NSSDVKELIRTGFQAGLVEIKNVLGHSVTVQELTKDENNKAALGVCQEVLDLAID  119

Query  484  DLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            D +++      +D M  +  +L +LKTW+SGA
Sbjct  120  DFQKSFDMLGEYD-MSKIGKYLLELKTWLSGA  150



>tpg|DAA64233.1| TPA: pectinesterase [Zea mays]
Length=566

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
            N++ S K++++ CQP DYK+TC   LSK+ AGN++ P  L +  F VT   I +AI  S 
Sbjct  38   NLSMSVKSVKAFCQPADYKETCEAELSKA-AGNASSPSDLAKVIFKVTSDKIHKAISESA  96

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L  L +D R+  AL  CKE+ G A+ +LK +  K   F+ M + +  + DLKTW+S A
Sbjct  97   TLEELKNDPRTSGALHDCKEMLGYAIDELKSSFDKLGGFE-MTNFNKAVDDLKTWLSAA  154



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 90/163 (55%), Gaps = 8/163 (5%)
 Frame = +1

Query  109  ETKSKNMTIIGVSSLILVAMVLALAF----GGQetseteeeGNIATSQKAIESVCQPTDY  276
            E K K   I GV + +LV MV+A+A          S+      I T+  A+E+VC PTDY
Sbjct  6    ELKKKKCIIAGVITALLVIMVVAVAIITSRNTSHNSDKIAPVQIKTTTNAVEAVCAPTDY  65

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST--LLRNLNDDKRSKMALQ  450
            K+TCVNSL K+   +ST P  LI+  FNVTI  I+  I  ++  L     +D  +K AL+
Sbjct  66   KETCVNSLMKASP-DSTQPLDLIKLGFNVTIRSIKDGIKKASAELKAKAANDNETKGALE  124

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             C++L   A  DLK+ +  F  F +    D ++ DL+ W+SG+
Sbjct  125  LCEKLMNDATDDLKKCLDNFDGFSITQIED-FVEDLRVWLSGS  166



>ref|XP_003550542.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=579

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 101/167 (60%), Gaps = 5/167 (3%)
 Frame = +1

Query  82   LTNSFPKMGETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeG--NIATSQKAIES  255
            + N      E K + + I+ VSSL+LVAMV+A A G +E ++  EEG  +I  SQ+ ++ 
Sbjct  1    MKNGLDTTHEKKKRKLAILSVSSLLLVAMVVAAAVGIREGADVVEEGGDSIVKSQRNVQV  60

Query  256  VCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRS  435
            +C+  +YK+TC  SL+K  A  ++D K LI  AFN T  +I + I NSTL   L  D  +
Sbjct  61   ICESAEYKETCHKSLAK--ASETSDLKELIITAFNATAEEIAKQIKNSTLYHELATDDMN  118

Query  436  KMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
            K A+  CKE+ G AV D+ +++ K   F+L + ++ +  DLK WI+G
Sbjct  119  KQAMDICKEVLGYAVDDMHQSVRKLEEFEL-NKLNDYAYDLKVWIAG  164



>ref|XP_004508195.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=576

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 95/166 (57%), Gaps = 6/166 (4%)
 Frame = +1

Query  91   SFPKMGETKSKNMTIIGVSSLILVAMVLALAFGG----QetseteeeGNIATSQKAIESV  258
             F      K K   ++G+SS++LVAMV A+A G     + + E+  +  +ATSQK ++ +
Sbjct  3    EFDNSQHEKKKKYAVVGLSSILLVAMVAAVAVGVSTTDEISGESGGDNQLATSQKNVKVI  62

Query  259  CQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSK  438
            C   +YKQTC  SL+   +  +TD K L+ AAFN T  ++   IHNSTL   L  D  +K
Sbjct  63   CDSAEYKQTCEKSLANV-SSETTDMKTLVIAAFNATAEELLSKIHNSTLYNELATDNMTK  121

Query  439  MALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
             A+  CKE+ G AV D+ ++I     F+L   +D +  D+K WI+G
Sbjct  122  QAMDICKEVLGYAVDDIHQSIHTLDRFEL-SKIDEYAYDIKIWIAG  166



>gb|KEH32300.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=585

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 91/157 (58%), Gaps = 12/157 (8%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAF----GGQetseteeeGN-IATSQKAIESVCQPTDYKQT  285
            K   I+GVSS++L+AMV A+A     GGQ  SE    GN I  SQK ++ +C  T YKQT
Sbjct  15   KKFAILGVSSILLIAMVAAVAVGVKDGGQVESEG---GNQIVKSQKIVQVLCGTTGYKQT  71

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C  SL+K+     TD K LI+A F  T  ++ + IHNS L + L  +  +K A+  CKE+
Sbjct  72   CEKSLAKT---GKTDMKELIKAVFKATAEELSKQIHNSKLYKELATNDMTKQAMDICKEV  128

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
             G AV D+ ++I     FD+   +D    DLK W+SG
Sbjct  129  LGYAVDDVHQSIHSLDKFDIR-KIDEIAYDLKVWLSG  164



>emb|CDY40720.1| BnaC03g34360D [Brassica napus]
Length=193

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 79/135 (59%), Gaps = 4/135 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + K   II +SS++L++MV+A+  G    +     + +  I +S KA++ VC PTD+K+T
Sbjct  11   RKKRYVIISISSVLLISMVVAVTVGVSLNKNEGNGDSDAQITSSVKAVKDVCAPTDFKKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C +SL+K +  N+TDP  L++ AF+ T+  I  A   S  +  L  D R+KMAL  CKEL
Sbjct  71   CEDSLNK-NGNNTTDPIELVKTAFSATMRQISAAAKKSQTIMELQKDPRTKMALDQCKEL  129

Query  466  AGRAVSDLKRTIAKF  510
               A+ +L  +  + 
Sbjct  130  MDYALGELSNSFEEL  144



>ref|XP_006658993.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=567

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++ S K++++ CQPTDY+QTC   L+++ A N + P  L +A F VT   I +AI  S  
Sbjct  41   LSMSVKSVKAFCQPTDYQQTCEAELTQA-AANGSSPTDLAKAIFAVTSEKISKAISESAT  99

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L  L +D+R+  ALQ CKEL   AV DLK +  K   F  M D +  + DL+TW+S A
Sbjct  100  LEELRNDQRTSGALQNCKELLEYAVEDLKTSFDKLGGFG-MTDFNKAVDDLRTWLSAA  156



>ref|XP_006433462.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46702.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=706

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++ S KAI++VCQPTDY++ CV SL ++++GN+TDPK LI+AAF V    +  A   S  
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESL-QTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMD--DMDIWLADLKTWIS  573
            L+ L  D R+ +AL+ C EL   A+ DL+R+  +    D      M   + +LKTW+S
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLS  172



>ref|XP_006433461.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46701.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=727

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++ S KAI++VCQPTDY++ CV SL ++++GN+TDPK LI+AAF V    +  A   S  
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESL-QTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMD--DMDIWLADLKTWIS  573
            L+ L  D R+ +AL+ C EL   A+ DL+R+  +    D      M   + +LKTW+S
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLS  172



>ref|XP_006433459.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46699.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=711

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++ S KAI++VCQPTDY++ CV SL ++++GN+TDPK LI+AAF V    +  A   S  
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESL-QTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMD--DMDIWLADLKTWIS  573
            L+ L  D R+ +AL+ C EL   A+ DL+R+  +    D      M   + +LKTW+S
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLS  172



>ref|XP_006433460.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46700.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=714

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++ S KAI++VCQPTDY++ CV SL ++++GN+TDPK LI+AAF V    +  A   S  
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESL-QTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMD--DMDIWLADLKTWIS  573
            L+ L  D R+ +AL+ C EL   A+ DL+R+  +    D      M   + +LKTW+S
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLS  172



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 76/123 (62%), Gaps = 8/123 (7%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G ++TS K+I+S CQP DY++TC  +L ++ AGN+T+P  L +A F  T   I +A+  S
Sbjct  37   GELSTSVKSIKSFCQPVDYRETCETTLEQT-AGNATNPTDLAKAIFKATSERIEKAVRES  95

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAK---FRTFDLMDDMDIWLADLKTWI  570
             +L +L +D R+  AL+ C+EL   A+ DLK T  K   F+T +    +D    D+KTW+
Sbjct  96   AVLNDLKNDPRTSDALKDCEELLDYAIDDLKTTFDKLGGFQTSNFKRAVD----DVKTWL  151

Query  571  SGA  579
            S A
Sbjct  152  SSA  154



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
            NI  + KA+E+VC PTD+K+TCVNS  K+   NST+P  LI+ +FN+TI  I+  +  S+
Sbjct  47   NIKMTNKAVEAVCAPTDFKETCVNSFMKASP-NSTEPLDLIKLSFNITIQAIKDGVKKSS  105

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +      D  +K +L+ C+ L   A+ DL +    F  F + D ++ ++ DL+ W+SG+
Sbjct  106  VELKAKADHETKGSLELCETLMNDAIDDLTKCFDNFAGFSV-DQIEKFVYDLRVWLSGS  163



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
            NI  + KA+E+VC PTD+K+TCVNS  K+   NST+P  LI+ +FN+TI  I+  +  S+
Sbjct  47   NIKMTSKAVEAVCAPTDFKETCVNSFMKASP-NSTEPLDLIKLSFNITIQAIKDGVKKSS  105

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            +      D  +K +L+ C+ L   A+ DL +    F  F + D ++ ++ DL+ W+SG+
Sbjct  106  VELKAKADHETKGSLELCETLMNDAIDDLTKCFDNFAGFSV-DQIEKFVYDLRVWLSGS  163



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 14/120 (12%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            A S KA++S+C PTDYK TC   LS +   N+T+P+ LI+AAF  T+ +I   + NS L 
Sbjct  48   AGSTKAVQSICAPTDYKDTCEKGLSHA---NTTNPQELIKAAFEFTVKNIGDVVKNSPLF  104

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDI-----WLADLKTWIS  573
            +  + DK +K AL+ C+ +   A+ DLK       +FD +D+ D+     ++ DLKTW+S
Sbjct  105  KEASHDKSTKEALEICQLVLEIAIDDLK------MSFDSVDEFDVTNASEYVEDLKTWLS  158



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++ S KAI++VCQPTDY++ CV SL ++++GN+TDPK LI+AAF V    +  A   S  
Sbjct  56   VSASMKAIKTVCQPTDYQKQCVESL-QTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMD--DMDIWLADLKTWIS  573
            L+ L  D R+ +AL+ C EL   A+ DL+R+  +    D      M   + +LKTW+S
Sbjct  115  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLS  172



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 3/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++ S KAI++VCQPTDY++ CV SL ++++GN+TDPK LI+AAF V    +  A   S  
Sbjct  52   VSASMKAIKTVCQPTDYQKQCVESL-QTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  110

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMD--DMDIWLADLKTWIS  573
            L+ L  D R+ +AL+ C EL   A+ DL+R+  +    D      M   + +LKTW+S
Sbjct  111  LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDRQARYKMGPMINNLKTWLS  168



>gb|KHN02946.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=555

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            IA SQ+  + +C+  +YK+TC  SL+K  A  ++D K LI  AFN T  +I   I NSTL
Sbjct  23   IAKSQRNQQVICESAEYKETCHKSLAK--ASGTSDLKELIITAFNATAEEIANQIKNSTL  80

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
               L  D  +K A   CKE+ G AV D++R++     FDL + ++ +  DLK WI+G
Sbjct  81   YHELATDHMTKQATDICKEVLGYAVDDIRRSVHTLEKFDL-NKLNDYAYDLKVWIAG  136



>emb|CAB65290.2| pectin methyl-esterase PER [Medicago truncatula]
Length=602

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 89/157 (57%), Gaps = 15/157 (10%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            G  +SK   ++GVSS++LVAMV  +A   Q              Q  ++ +C+ T Y+QT
Sbjct  9    GHDQSKRFALVGVSSILLVAMVATVADAQQ-------------GQPNVQILCESTQYQQT  55

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C  SL+K+ A  +   K LI+AAF+ T  ++ + I++S+L++ L  DK +K A++ C E+
Sbjct  56   CHQSLAKAPA-ETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDKMTKQAMEVCNEV  114

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
               AV  + +++     FD+ + +  +  DLK W++G
Sbjct  115  LDYAVDGIHKSVGAVDKFDI-NKIHEYSYDLKVWLTG  150



>gb|KEH37212.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=614

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 89/157 (57%), Gaps = 15/157 (10%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            G  +SK   ++GVSS++LVAMV  +A   Q              Q  ++ +C+ T Y+QT
Sbjct  9    GHDQSKRFALVGVSSILLVAMVATVADAQQ-------------GQPNVQILCESTQYQQT  55

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C  SL+K+ A  +   K LI+AAF+ T  ++ + I++S+L++ L  DK +K A++ C E+
Sbjct  56   CHQSLAKAPA-ETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDKMTKQAMEVCNEV  114

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
               AV  + +++     FD+ + +  +  DLK W++G
Sbjct  115  LDYAVDGIHKSVGAVDKFDI-NKIHEYSYDLKVWLTG  150



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            ++TS K+I+S C+P DYK+ C ++L K+ AGN+T    L +A F  T   I +A+  S++
Sbjct  39   LSTSVKSIKSFCEPVDYKEACESTLEKT-AGNATSTTELAKAIFKATSERIEQAVRESSV  97

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L  L  D+R+  AL  CKEL   A+ DLK T  +   F+ M +    L DLKTW+S A
Sbjct  98   LNELKHDQRTAGALNNCKELLNYAMDDLKTTFEQLGGFE-MTNFKHALDDLKTWLSSA  154



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST-  402
            I T+ KA+++VC+PTDYK+TCV+SL  +   NST P  LI+  FN+TI  I + I  +  
Sbjct  47   IKTTTKAVQAVCEPTDYKETCVHSLMAASP-NSTQPLDLIRLGFNLTINSIHQGIKKAAH  105

Query  403  -LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L      D  +K AL  C+EL   A+ DLK+   KF  F+L ++ + ++ DL+ W+SG+
Sbjct  106  ELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKFDGFNL-NEAEEFVEDLRVWLSGS  164



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST-  402
            I T+ KA+++VC+PTDYK+TCV+SL  +   NST P  LI+  FN+TI  I + I  +  
Sbjct  47   IKTTTKAVQAVCEPTDYKETCVHSLMAASP-NSTQPLDLIRLGFNLTINSIHQGIKKAAH  105

Query  403  -LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L      D  +K AL  C+EL   A+ DLK+   KF  F+L ++ + ++ DL+ W+SG+
Sbjct  106  ELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKFDGFNL-NEAEEFVEDLRVWLSGS  164



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 91/158 (58%), Gaps = 5/158 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFG---GQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            + +    I +SS++L++MV+A+  G    +  +++E++G I  S KA++ VC PTDY++T
Sbjct  11   RKRRFVAITISSVLLISMVVAVTIGVSLNKNDADSEDKGEITASVKAVKDVCAPTDYRKT  70

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C ++L + +  N+TDP  L++ AF+ T+  I      S  +  L  D R++MAL  C EL
Sbjct  71   CEDTLIQ-NGQNTTDPMELVKTAFSATMKQITDVAKKSQTMMELQKDPRTRMALDQCTEL  129

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
               A+ +L  +  +   F+    +D  L +L+ W+S A
Sbjct  130  MDYALGELSSSFEELGKFEF-HKLDEALINLRIWLSAA  166



>gb|KDP23452.1| hypothetical protein JCGZ_23285 [Jatropha curcas]
Length=174

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 13/103 (13%)
 Frame = +1

Query  118  SKNMTIIGVSSLILVAMVLALAFG------GQet----seteeeGNIATSQKAIESVCQP  267
            +K + IIG+SS++LVAMV+A+  G      G+         +  G I+ S KAI+S+CQP
Sbjct  7    NKRLAIIGISSILLVAMVVAVTIGVGFSENGESEDITGKSHKSTGEISASMKAIKSICQP  66

Query  268  TDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHN  396
             DYK+TC  SL KS AGN+TDPK LI+AAF   IA  + AIH 
Sbjct  67   ADYKKTCEKSLEKS-AGNTTDPKELIKAAFK--IAQKKFAIHE  106



>ref|XP_011462740.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=593

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 87/170 (51%), Gaps = 18/170 (11%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFG-----------------GQetseteeeGNIATSQKAI  249
            K +TII VSS++LVAMV+    G                  ++      + N + + K I
Sbjct  8    KRITIIAVSSVLLVAMVICGVVGVIQYKKQEQRGGGGGGGDEDGDTNSGDKNASHTSKTI  67

Query  250  ESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDK  429
             ++C+PT+YKQ C  SL     G+  DP+ L +    V I+ +   + NSTLL+N   D 
Sbjct  68   VAICEPTNYKQECEKSLENEATGDKKDPQDLARVGIQVAISKLDEVLKNSTLLKNKGKDP  127

Query  430  RSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             ++ AL  C++L   ++ DLK +  K    + M+ +D +  D++ W+SGA
Sbjct  128  MTQEALSICRQLLNASMYDLKISYNKMCALN-MEKVDQYAEDVRVWLSGA  176



>ref|XP_007154304.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
 gb|ESW26298.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
Length=588

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 94/157 (60%), Gaps = 5/157 (3%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGN---IATSQKAIESVCQPTDYKQT  285
            K K + I+ VSS++LVAMV A+A G ++  E  EEG    I  +Q+ ++ +CQ  +YK+T
Sbjct  12   KKKRLAILTVSSVLLVAMVAAVAVGIRDNEEMAEEGGDSGIVKNQRNVKVICQSAEYKET  71

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKEL  465
            C  SL K+   NS D K LI  AFN T  +I   I NSTL + L  D  +K A++ C+E+
Sbjct  72   CQKSLEKASDENS-DLKQLIITAFNATAEEIHSKIKNSTLFQELATDNMTKQAMEICQEV  130

Query  466  AGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
             G AV D+ ++ A    FDL   ++ +  DLK WI+G
Sbjct  131  LGYAVDDINKSSATLEKFDL-SMLNEYAYDLKVWIAG  166



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 84/160 (53%), Gaps = 9/160 (6%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAF---GGQetseteeeGNIATSQKAIESVCQPTDYKQT  285
            K K   I+GVSS ++V M +  A    G        + GN    + A+  +C  TDYK+T
Sbjct  19   KKKYAVIVGVSSFLVVTMFIGTAVMSSGSGGHERAIKAGNKLVVKTAVNVICSSTDYKET  78

Query  286  CVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL-LR-NLNDDKRSKMALQTCK  459
            CV SL   +   S DP+ LI++AF   I  I++ I+ + + LR     D+R++ AL+ C 
Sbjct  79   CVASL---ETVRSPDPRNLIKSAFEFAIKSIQKGINQAAIDLRMRAKSDRRTREALENCV  135

Query  460  ELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            EL   +V DL+++  KF  F      DI   DL  W+SGA
Sbjct  136  ELMENSVEDLRKSNEKFAGFAFTRLRDI-AEDLGVWLSGA  174



>gb|EMS57827.1| putative pectinesterase/pectinesterase inhibitor 21 [Triticum 
urartu]
Length=481

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
             +ATS K+I+S CQP DYK  C  +L ++ AGN+T    L +A F  T   I +A+  S+
Sbjct  37   ELATSVKSIKSFCQPVDYKVACEKTLEET-AGNATTTTELAKAIFKATSERIEKAVQESS  95

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            LL  L  D R+  AL+ CKE+   A+ DLK T  +   F+ M +    + DLKTW++ A
Sbjct  96   LLNELKHDPRTSGALKNCKEMLHYAIDDLKTTFDQLGGFE-MTNFKHAMDDLKTWLTSA  153



>ref|XP_003534836.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
 gb|KHN26531.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=579

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 96/163 (59%), Gaps = 6/163 (4%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVL----ALAFGGQetseteeeGNIATSQKA-IESVCQPT  270
            G+ + +   ++G+SS++LVAMV      +  GG +  E ++E  + T+Q+  +E +C  T
Sbjct  6    GKEQKRRFAVLGISSILLVAMVAAVAVTINRGGNKGEEGDDESRVQTAQRNNVEMICNST  65

Query  271  DYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQ  450
            +YK+TC  SL K+ +  + D K LI+AAFN +  ++   I NSTL + L  D  ++ A+ 
Sbjct  66   EYKETCKKSLEKASSDENADTKELIKAAFNASAVELLNHIKNSTLYKELAKDNMTRQAMD  125

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             CKE+   A+  ++++I     F+ +  +  ++ DLK W++G+
Sbjct  126  ICKEVFDYAIDGVQKSIETLDKFEFI-KLSEYVYDLKVWLTGS  167



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 89/163 (55%), Gaps = 7/163 (4%)
 Frame = +1

Query  106  GETKSKNMTIIGVSSLILVAMVLALAF---GGQetseteeeGNIATSQKAIESVCQPTDY  276
            GE   K   I G+ + +LVAMV+ +A          +     +I  + KAI +VC PTDY
Sbjct  5    GELIKKKSIIAGILTALLVAMVIVVAIIKTQNSSNPDKTTTVHITATTKAIRAVCAPTDY  64

Query  277  KQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST--LLRNLNDDKRSKMALQ  450
            K+TCVNSL K+   +ST P  LI+  FN+TI  I+ ++  ++  L     +D  +K AL 
Sbjct  65   KETCVNSLMKASP-DSTQPLELIKLGFNITIQSIKDSVKKASGELKAKAANDNETKGALD  123

Query  451  TCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             C++L   A  DL++ +  F  F +    D ++ DL+ W+SG+
Sbjct  124  LCEKLMTDATDDLEKCLHNFHGFSITHIED-FVEDLRVWLSGS  165



>dbj|BAK06954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 69/118 (58%), Gaps = 2/118 (2%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            + TS K+I+S CQP DYK  C  +L ++ AGN+T    L +A F  T   I +A+  S+L
Sbjct  38   LTTSLKSIKSFCQPVDYKVACEKTLEET-AGNATTTTELAKAIFKATSERIEKAVRESSL  96

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            L +L  D R+  AL+ CKEL   A+ DLK T  +   F+ M +    + DLKTW+S A
Sbjct  97   LNDLKHDPRTSGALKNCKELLHYAIDDLKTTFDQLGGFE-MTNFKHAMDDLKTWLSSA  153



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 74/118 (63%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            I++S KA++++CQPT+YK+TC  SL+ S   NS+D K LI+  F   + +I+  + +S  
Sbjct  21   ISSSNKAVQALCQPTNYKETCQKSLASS---NSSDVKELIRTGFQAGLVEIKNVLAHSVT  77

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++ L  DK +K AL  C+E+   A+ D +++      +D M  +  +L +LKTW+SGA
Sbjct  78   VQELIKDKNNKAALGVCQEVLDLAIDDFQKSFDMLGEYD-MSKIGKYLLELKTWLSGA  134



>ref|XP_010489679.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=353

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 69/120 (58%), Gaps = 2/120 (2%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G I +S KA++ VC PTDYK+TC ++L K +  N++DP  L++ AF  T+  I  A   S
Sbjct  22   GEITSSVKAVKDVCAPTDYKKTCEDTLIK-NGNNTSDPIELVKTAFKATMKQITDAAKKS  80

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              +  L  D R++MAL  CKEL   A+ +L  +  +   F+    +D  L +++ W+S A
Sbjct  81   QTMMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEF-HKLDEALINMRIWLSAA  139



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 67/117 (57%), Gaps = 2/117 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
             I  S KAI+ VC PTDYK+TC ++L K DA +++DP  L++A FNVT+  I      S 
Sbjct  35   EITASVKAIKEVCAPTDYKKTCEDTLRK-DAKDTSDPLELVRAGFNVTMKQITNVARKSQ  93

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
             +  L  D R+KMAL  CKEL   A+ +L  +  +   F+    +D  L  +K W+S
Sbjct  94   TMIELQKDPRTKMALDQCKELMDYAIGELSNSFVELGKFEFH-KVDEVLIKVKVWLS  149



>gb|EMT00224.1| Putative pectinesterase/pectinesterase inhibitor 21 [Aegilops 
tauschii]
Length=543

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
             + TS K+I+S CQP DYK  C  +L ++ AGN+T    L +A F  T   I +A+  S+
Sbjct  37   ELTTSMKSIKSFCQPVDYKAACEKTLGET-AGNATTTTELAKAIFKATSERIEKAVQESS  95

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            LL  L  D R+  AL+ CKE+   A+ DLK T  +   F+ M +    + DLKTW++ A
Sbjct  96   LLNELKHDPRTSGALKNCKEMLHYAIDDLKTTFDQLGGFE-MTNFKHAMDDLKTWLTSA  153



>gb|KJB38560.1| hypothetical protein B456_006G260600 [Gossypium raimondii]
Length=563

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = +1

Query  244  AIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLND  423
            A+++VCQPT +K  C  SL+ S   NSTD K LI+++F   I ++R+ + NST +++LN 
Sbjct  48   AVQAVCQPTHFKDACEKSLASS---NSTDTKELIRSSFQAAIEEVRKVLANSTTIQDLNK  104

Query  424  DKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            D  ++ AL+ C+E+   ++ DL+ +  K   +D M  +  +L +L+ W+SGA
Sbjct  105  DDNNREALKVCQEVLDLSIDDLQLSFDKMGEYD-MSKIGDYLLNLRVWLSGA  155



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 74/118 (63%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            I++S KA++++CQPT+YK+TC  SL+ S   NS+D K LI+  F   + +I+  + +S  
Sbjct  37   ISSSNKAVQALCQPTNYKETCQKSLASS---NSSDVKELIRTGFQAGLVEIKNVLAHSVT  93

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++ L  D+ +K AL  C+E+   A+ D +++      +D M  +  +L +LKTW+SGA
Sbjct  94   VQELIKDENNKAALGVCQEVLDLAIDDFQKSFDMLGEYD-MSKIGKYLLELKTWLSGA  150



>gb|KJB38562.1| hypothetical protein B456_006G260800 [Gossypium raimondii]
Length=561

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 74/118 (63%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            I++S KA++++CQPT+YK+TC  SL+ S   NS+D K LI+  F   + +I+  + +S  
Sbjct  37   ISSSNKAVQALCQPTNYKETCQKSLASS---NSSDVKELIRTGFQAGLVEIKNVLAHSVT  93

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++ L  D+ +K AL  C+E+   A+ D +++      +D M  +  +L +LKTW+SGA
Sbjct  94   VQELIKDENNKAALGVCQEVLDLAIDDFQKSFDMLGEYD-MSKIGKYLLELKTWLSGA  150



>gb|KJB38563.1| hypothetical protein B456_006G260900 [Gossypium raimondii]
Length=561

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 74/118 (63%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            I++S KA++++CQPT+YK+TC  SL+ S   NS+D K LI+  F   + +I+  + +S  
Sbjct  37   ISSSNKAVQALCQPTNYKETCQKSLASS---NSSDVKELIRTGFQAGLVEIKNVLAHSVT  93

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
            ++ L  D+ +K AL  C+E+   A+ D +++      +D M  +  +L +LKTW+SGA
Sbjct  94   VQELIKDENNKAALGVCQEVLDLAIDDFQKSFDMLGEYD-MSKIGKYLLELKTWLSGA  150



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 4/116 (3%)
 Frame = +1

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLL  408
            +TS KA+++VC PT Y++TC  +L+K+   N++DPK LI+  F V +  I  A+  S LL
Sbjct  31   STSNKAVQAVCSPTSYRETCEQTLAKA---NTSDPKELIRYGFGVAVDGIGEALKKSALL  87

Query  409  RNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
            +    D+ +K A   C+++   AV DL+++I +   F+    ++ ++ DL+TW+SG
Sbjct  88   KQAAADQSTKDAFYVCEDVLDLAVYDLQKSIDRIGEFNPQ-KLNDYVEDLRTWLSG  142



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 77/119 (65%), Gaps = 3/119 (3%)
 Frame = +1

Query  223  NIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST  402
            NI+TSQKAI+ +CQ T Y+QTC  +LS  +A NS+DP+ LIQ  F + I+ +   I  S 
Sbjct  42   NISTSQKAIQDLCQSTYYQQTCTETLS--NATNSSDPQTLIQTIFEIAISHLNNTIQQSG  99

Query  403  LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L+ +++D ++  A +TC ++   ++ DL++TI +  TFD  D     + D+KTW++GA
Sbjct  100  PLQQISNDPKTSQAYKTCTKVLDDSIQDLRKTIHRTETFDFFDFSIF-IDDIKTWLTGA  157



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            +ATS K+++S+CQPT YKQTC  +LS   A N +DPK  I+ AF  T+ +++  I +   
Sbjct  38   LATSTKSVQSMCQPTPYKQTCEKTLSI--AKNVSDPKDYIKVAFEATVTELKNIIKSIEP  95

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWIS  573
            ++    D  +K AL  C++L   A  DL+ +I K + FD+    D+ + DLKTW+S
Sbjct  96   IKKAASDPYTKDALLACEQLFDLAAEDLRTSITKIQNFDISMIKDV-VDDLKTWLS  150



>gb|KHN26532.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=645

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 96/178 (54%), Gaps = 25/178 (14%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVA-MVLALAFG---------------------GQetseteeeGNI  228
            + ++  I  +SS++LVA M +A+AFG                     G+   ET  + N+
Sbjct  10   QQRSFAIFIISSILLVATMPVAMAFGLNPNPVGLNTNPNPNPNPNPGGETKGETGHQSNV  69

Query  229  ATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIAD-IRRAIHNSTL  405
             ++  +  ++CQ T+Y++ C  SL  S   N TDPK LI+  F V I + +   I+NSTL
Sbjct  70   LSTHSSGITICQGTEYEEKCKQSLGNSLFVN-TDPKKLIETQFKVAIGELVDNIINNSTL  128

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             + +  D+R+++A+  CKE+ G AV  + ++ +    FD    M+I + DLK W++G+
Sbjct  129  YKQIVTDERTRLAMDDCKEILGYAVDAIMKSTSLLIQFDFSKLMEI-VYDLKVWLTGS  185



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST-  402
            I T+ KA+++VC PTD+K TCVNSL ++   NST+P  LI+ +F+VTI  I+  I  S+ 
Sbjct  43   IKTTTKAVQAVCSPTDFKDTCVNSLMEASP-NSTEPLDLIKLSFDVTIRSIKDGIKRSST  101

Query  403  -LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L      D+ +K AL+ C+ L   A  DLK+    F  F +    D ++ DL+ W+SG+
Sbjct  102  ELKAKAAKDEETKGALELCENLMNDATDDLKKCFDNFDGFSITQIED-FVEDLRVWLSGS  160



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 4/120 (3%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNST-  402
            I  + KAI +VC PTDYK+TCVNSL K+   +ST P  LI+  FN+TI  I+ ++  ++ 
Sbjct  48   IKATTKAIRAVCAPTDYKETCVNSLMKASP-DSTQPLELIKLGFNITIQSIKDSVKKASG  106

Query  403  -LLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             L     +D  +K AL  C++L   A  DL++ +  F  F +    D ++ DL+ W+SG+
Sbjct  107  ELKAKAANDNETKGALDLCEKLMTDATDDLEKCLHNFHGFSITHIED-FVEDLRVWLSGS  165



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  175  ALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSLS--KSDAGNSTDPKVLIQ  348
            A+AFG       + +  +A S KA++++C PTDYK  CV SL+  K+D     DPK L++
Sbjct  20   AVAFGFVTNWGNKLDQKLAASSKAVQAICNPTDYKDACVKSLATVKTD-----DPKELVR  74

Query  349  AAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLM  528
            AAF   +A+++    NST+L+ L  D ++  A++ CKEL   A+ D +R+  +    D  
Sbjct  75   AAFASAMAELKEIASNSTILKVLEMDPKTAQAVKDCKELFQDAIDDFQRSFDEIGKLD-W  133

Query  529  DDMDIWLADLKTWIS  573
            + ++  L +LK WIS
Sbjct  134  NQVNSVLENLKIWIS  148



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 71/120 (59%), Gaps = 2/120 (2%)
 Frame = +1

Query  220  GNIATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNS  399
            G   TS KAI++VC+PTDYK  C  +LS S + N++DP  L+  AFN ++  +  A   S
Sbjct  43   GQPNTSIKAIKAVCEPTDYKDACEKTLS-SMSHNTSDPMELVNVAFNASMKYVTDAFDKS  101

Query  400  TLLRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
             LL++++ D  S  AL+TC EL   A  DLK++I +  +    +  +  + DLK W+S A
Sbjct  102  ELLKDVSKDPASAEALRTCSELLEYATDDLKKSIEQLGSVQ-TNRYEQAVEDLKVWLSAA  160



>gb|KEH37213.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=565

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 84/152 (55%), Gaps = 4/152 (3%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSL  300
            K   ++GVS ++LVAMV  +A    +  + E++ +I+ SQK ++ +CQ T +K+TC  +L
Sbjct  14   KKHALLGVSCILLVAMVGVVAVSLTKGGDGEQKAHISNSQKNVDMLCQSTKFKETCHKTL  73

Query  301  SKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAV  480
             K+   N    K  I+ A   T  ++R+ I+NS L + L  D  +K A++ C E+   AV
Sbjct  74   EKASFSNM---KNRIKGALGATEEELRKHINNSALYQELATDSMTKQAMEICNEVLDYAV  130

Query  481  SDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
              + +++     FD    +  +  D+K W++G
Sbjct  131  DGIHKSVGTLDQFDF-HKLSEYAFDIKVWLTG  161



>emb|CAB65291.1| pectin methyl-esterase PEF1 [Medicago truncatula]
Length=565

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 84/152 (55%), Gaps = 4/152 (3%)
 Frame = +1

Query  121  KNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVNSL  300
            K   ++GVS ++LVAMV  +A    +  + E++ +I+ SQK ++ +CQ T +K+TC  +L
Sbjct  14   KKHALLGVSCILLVAMVGVVAVSLTKGGDGEQKAHISNSQKNVDMLCQSTKFKETCHKTL  73

Query  301  SKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKRSKMALQTCKELAGRAV  480
             K+   N    K  I+ A   T  ++R+ I+NS L + L  D  +K A++ C E+   AV
Sbjct  74   EKASFSNM---KNRIKGALGATEEELRKHINNSALYQELATDSMTKQAMEICNEVLDYAV  130

Query  481  SDLKRTIAKFRTFDLMDDMDIWLADLKTWISG  576
              + +++     FD    +  +  D+K W++G
Sbjct  131  DGIHKSVGTLDQFDF-HKLSEYAFDIKVWLTG  161



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 91/157 (58%), Gaps = 8/157 (5%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVN  294
            K K   I GV S +LV MV+++A     +  +  E  I  + KA+++VC PTDYK+TC+ 
Sbjct  7    KKKKCIIAGVVSGLLVIMVVSVAI--IASKNSPNENEIRQNTKAVKTVCAPTDYKETCLK  64

Query  295  SLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKR--SKMALQTCKELA  468
            SL  +    ST+P  LI+ +FNVTI  I+  +  ++       DK   +K A + C+++ 
Sbjct  65   SLMDASP-KSTEPLALIKLSFNVTIKSIQEGLKKASEDVKHKADKHPEAKDAFELCEKVM  123

Query  469  GRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              A++DLK+ +    +   +D+++ ++ DL+ WISG+
Sbjct  124  NDAIADLKKCVDHKVS---VDEIERFIKDLRVWISGS  157



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 91/157 (58%), Gaps = 8/157 (5%)
 Frame = +1

Query  115  KSKNMTIIGVSSLILVAMVLALAFGGQetseteeeGNIATSQKAIESVCQPTDYKQTCVN  294
            K K   I GV S +LV MV+++A     +  +  E  I  + KA+++VC PTDYK+TC+ 
Sbjct  7    KKKKCIIAGVVSGLLVIMVVSVAI--IASKNSPNENEIRQNTKAVKTVCAPTDYKETCLK  64

Query  295  SLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTLLRNLNDDKR--SKMALQTCKELA  468
            SL  +    ST+P  LI+ +FNVTI  I+  +  ++       DK   +K A + C+++ 
Sbjct  65   SLMDASP-KSTEPLALIKLSFNVTIKSIQEGLKKASEDVKHKADKHPEAKDAFELCEKVM  123

Query  469  GRAVSDLKRTIAKFRTFDLMDDMDIWLADLKTWISGA  579
              A++DLK+ +    +   +D+++ ++ DL+ WISG+
Sbjct  124  NDAIADLKKCVDHKVS---VDEIERFIKDLRVWISGS  157



>gb|KJB26381.1| hypothetical protein B456_004G238800 [Gossypium raimondii]
Length=883

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 75/122 (61%), Gaps = 14/122 (11%)
 Frame = +1

Query  226  IATSQKAIESVCQPTDYKQTCVNSLSKSDAGNSTDPKVLIQAAFNVTIADIRRAIHNSTL  405
            + +S+KAI+ +CQPT +K+TC   L + +AGN TD K LIQAAF   +  + +A  NSTL
Sbjct  56   VTSSKKAIKMICQPTTFKKTCEEQL-QHEAGNKTDVKDLIQAAFKAAMKYVEQAQANSTL  114

Query  406  LRNLNDDKRSKMALQTCKELAGRAVSDLKRTIAKF-RTFDLMDDMDI-----WLADLKTW  567
            LR+L  D+ ++ AL  CK L       L  T+ +F ++ +L+D +++      L D+K W
Sbjct  115  LRDLEKDEGTRSALDACKIL-------LNSTMREFNKSLELVDKIEVNTVNKLLGDMKIW  167

Query  568  IS  573
            +S
Sbjct  168  LS  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220