BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004I05

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086171.1|  PREDICTED: thiamine thiazole synthase 2, chl...    205   3e-61   Sesamum indicum [beniseed]
gb|EYU33910.1|  hypothetical protein MIMGU_mgv1a009148mg                204   1e-60   Erythranthe guttata [common monkey flower]
gb|KDO52969.1|  hypothetical protein CISIN_1g018414mg                   202   2e-60   Citrus sinensis [apfelsine]
gb|ABI84250.1|  thiamine biosynthetic enzyme                            197   3e-60   Arachis hypogaea [goober]
emb|CDO99712.1|  unnamed protein product                                202   4e-60   Coffea canephora [robusta coffee]
ref|NP_001275783.1|  thiamine thiazole synthase, chloroplastic          202   4e-60   Citrus sinensis [apfelsine]
ref|XP_006452193.1|  hypothetical protein CICLE_v10008765mg             202   4e-60   Citrus clementina [clementine]
gb|KDO52968.1|  hypothetical protein CISIN_1g018414mg                   202   5e-60   Citrus sinensis [apfelsine]
ref|XP_011096106.1|  PREDICTED: thiamine thiazole synthase 2, chl...    199   8e-59   Sesamum indicum [beniseed]
ref|XP_008463440.1|  PREDICTED: thiamine thiazole synthase, chlor...    196   7e-58   Cucumis melo [Oriental melon]
ref|XP_004152916.1|  PREDICTED: thiamine thiazole synthase, chlor...    196   1e-57   Cucumis sativus [cucumbers]
ref|XP_004496776.1|  PREDICTED: thiamine thiazole synthase 2, chl...    195   2e-57   Cicer arietinum [garbanzo]
ref|XP_010267751.1|  PREDICTED: thiamine thiazole synthase 2, chl...    195   3e-57   Nelumbo nucifera [Indian lotus]
gb|KJB67127.1|  hypothetical protein B456_010G176000                    194   6e-57   Gossypium raimondii
gb|KHG29710.1|  Thiamine thiazole synthase 2, chloroplastic             194   7e-57   Gossypium arboreum [tree cotton]
gb|KJB57702.1|  hypothetical protein B456_009G176400                    192   8e-57   Gossypium raimondii
gb|ACV52582.1|  thiazole biosynthetic enzyme                            187   8e-57   Nicotiana benthamiana
ref|XP_002317206.1|  hypothetical protein POPTR_0011s00500g             193   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_003536550.1|  PREDICTED: thiamine thiazole synthase 2, chl...    192   2e-56   Glycine max [soybeans]
ref|XP_002305603.1|  hypothetical protein POPTR_0004s01990g             192   2e-56   Populus trichocarpa [western balsam poplar]
gb|AFK49080.1|  unknown                                                 187   2e-56   Medicago truncatula
gb|KJB57700.1|  hypothetical protein B456_009G176400                    192   2e-56   Gossypium raimondii
ref|XP_011037712.1|  PREDICTED: thiamine thiazole synthase 2, chl...    192   2e-56   Populus euphratica
ref|XP_006449089.1|  hypothetical protein CICLE_v10015727mg             192   3e-56   Citrus clementina [clementine]
ref|XP_007213805.1|  hypothetical protein PRUPE_ppa007657mg             192   4e-56   Prunus persica
ref|XP_007143207.1|  hypothetical protein PHAVU_007G052900g             192   5e-56   Phaseolus vulgaris [French bean]
ref|XP_010545204.1|  PREDICTED: thiamine thiazole synthase, chlor...    191   6e-56   Tarenaya hassleriana [spider flower]
gb|EPS63253.1|  hypothetical protein M569_11533                         191   6e-56   Genlisea aurea
gb|AFM35683.1|  thiamin biosynthetic protein                            191   6e-56   Vitis pseudoreticulata
ref|XP_008244366.1|  PREDICTED: thiamine thiazole synthase, chlor...    191   7e-56   Prunus mume [ume]
ref|XP_003563001.1|  PREDICTED: thiamine thiazole synthase 2, chl...    191   8e-56   Brachypodium distachyon [annual false brome]
gb|KEH43920.1|  thiazole biosynthetic enzyme                            191   9e-56   Medicago truncatula
ref|XP_002267414.1|  PREDICTED: thiamine thiazole synthase 2, chl...    191   1e-55   Vitis vinifera
ref|XP_003556028.1|  PREDICTED: thiamine thiazole synthase 2, chl...    191   1e-55   Glycine max [soybeans]
gb|AFK44470.1|  unknown                                                 190   1e-55   Medicago truncatula
ref|XP_004294669.1|  PREDICTED: thiamine thiazole synthase, chlor...    190   2e-55   Fragaria vesca subsp. vesca
ref|XP_002281769.1|  PREDICTED: thiamine thiazole synthase 1, chl...    190   2e-55   Vitis vinifera
ref|XP_006467989.1|  PREDICTED: thiamine thiazole synthase 2, chl...    190   2e-55   Citrus sinensis [apfelsine]
ref|XP_010105570.1|  Thiamine thiazole synthase 2                       190   2e-55   
ref|XP_004244150.1|  PREDICTED: thiamine thiazole synthase, chlor...    190   2e-55   Solanum lycopersicum
gb|EPS63028.1|  thiazole biosynthetic enzyme, chloroplastic             187   3e-55   Genlisea aurea
ref|XP_004294348.1|  PREDICTED: thiamine thiazole synthase, chlor...    190   3e-55   Fragaria vesca subsp. vesca
gb|KHG06769.1|  Thiamine thiazole synthase 1, chloroplastic             189   3e-55   Gossypium arboreum [tree cotton]
ref|XP_007025992.1|  Thiazole biosynthetic enzyme                       190   4e-55   
gb|KHG02821.1|  Thiamine thiazole synthase 2, chloroplastic             189   4e-55   Gossypium arboreum [tree cotton]
gb|AAP03875.1|  putative chloroplast thiazole biosynthetic protein      189   7e-55   Nicotiana tabacum [American tobacco]
ref|XP_009774029.1|  PREDICTED: thiamine thiazole synthase, chlor...    189   7e-55   Nicotiana sylvestris
ref|XP_009590342.1|  PREDICTED: thiamine thiazole synthase, chlor...    189   7e-55   Nicotiana tomentosiformis
gb|EMS66450.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         188   8e-55   Triticum urartu
emb|CDY42479.1|  BnaA10g08550D                                          185   1e-54   Brassica napus [oilseed rape]
gb|AAW66657.1|  thiamine biosynthetic enzyme                            188   1e-54   Picrorhiza kurrooa
ref|XP_010062976.1|  PREDICTED: thiamine thiazole synthase 1, chl...    188   1e-54   
ref|XP_011000691.1|  PREDICTED: thiamine thiazole synthase 2, chl...    187   1e-54   Populus euphratica
ref|XP_003607681.1|  Thiazole biosynthetic enzyme                       187   2e-54   Medicago truncatula
ref|XP_009408664.1|  PREDICTED: thiamine thiazole synthase 2, chl...    187   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF85034.1|  unknown                                                 185   4e-54   Zea mays [maize]
ref|XP_009358110.1|  PREDICTED: thiamine thiazole synthase, chlor...    186   6e-54   
ref|XP_001767548.1|  predicted protein                                  186   6e-54   
ref|XP_010448624.1|  PREDICTED: thiamine thiazole synthase, chlor...    186   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010443053.1|  PREDICTED: thiamine thiazole synthase, chlor...    186   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004504342.1|  PREDICTED: thiamine thiazole synthase, chlor...    186   7e-54   Cicer arietinum [garbanzo]
gb|AFK46185.1|  unknown                                                 186   7e-54   Medicago truncatula
ref|XP_001755171.1|  predicted protein                                  186   8e-54   
ref|XP_002864354.1|  hypothetical protein ARALYDRAFT_918614             186   8e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_008366026.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    186   8e-54   
ref|XP_011030844.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    186   8e-54   Populus euphratica
ref|XP_009120006.1|  PREDICTED: thiamine thiazole synthase, chlor...    186   9e-54   Brassica rapa
ref|XP_008386070.1|  PREDICTED: thiamine thiazole synthase, chlor...    184   1e-53   
gb|KJB13600.1|  hypothetical protein B456_002G083700                    186   1e-53   Gossypium raimondii
ref|XP_006845176.1|  hypothetical protein AMTR_s00005p00239290          185   1e-53   Amborella trichopoda
gb|ADG27845.1|  thiazole biosynthetic enzyme                            185   1e-53   Gossypium hirsutum [American cotton]
ref|XP_010670818.1|  PREDICTED: thiamine thiazole synthase 2, chl...    185   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670817.1|  PREDICTED: thiamine thiazole synthase, chlor...    185   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001767495.1|  predicted protein                                  185   2e-53   
gb|KDP39066.1|  hypothetical protein JCGZ_00823                         185   2e-53   Jatropha curcas
ref|XP_010670808.1|  PREDICTED: thiamine thiazole synthase 2, chl...    185   2e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|AGT17015.1|  thiazole biosynthetic enzyme                            185   2e-53   Saccharum hybrid cultivar R570
gb|EYU19221.1|  hypothetical protein MIMGU_mgv1a009132mg                185   2e-53   Erythranthe guttata [common monkey flower]
gb|AGT16507.1|  Thiazole biosynthetic enzyme Thi4 family                184   2e-53   Saccharum hybrid cultivar R570
gb|AGT16062.1|  Thiazole biosynthetic enzyme Thi4 family                184   2e-53   Saccharum hybrid cultivar R570
gb|AGT16846.1|  Thiazole biosynthetic enzyme Thi4 family                184   3e-53   Saccharum hybrid cultivar R570
ref|XP_009378870.1|  PREDICTED: thiamine thiazole synthase, chlor...    184   3e-53   Pyrus x bretschneideri [bai li]
gb|KCW70139.1|  hypothetical protein EUGRSUZ_F03433                     187   4e-53   Eucalyptus grandis [rose gum]
gb|AGT15954.1|  Thiazole biosynthetic enzyme Thi4 family                184   4e-53   Saccharum hybrid cultivar R570
ref|XP_004505443.1|  PREDICTED: thiamine thiazole synthase, chlor...    184   5e-53   Cicer arietinum [garbanzo]
ref|XP_002458014.1|  hypothetical protein SORBIDRAFT_03g025520          184   5e-53   Sorghum bicolor [broomcorn]
ref|XP_001753819.1|  predicted protein                                  184   5e-53   
ref|XP_004957903.1|  PREDICTED: thiamine thiazole synthase 2, chl...    184   5e-53   Setaria italica
ref|XP_001753698.1|  predicted protein                                  184   5e-53   
ref|NP_001236812.1|  thiamin biosynthetic enzyme                        183   6e-53   Glycine max [soybeans]
ref|XP_002522858.1|  electron transfer flavoprotein-ubiquinone ox...    183   9e-53   Ricinus communis
ref|XP_006401539.1|  hypothetical protein EUTSA_v10013978mg             183   9e-53   Eutrema salsugineum [saltwater cress]
ref|XP_002316981.2|  hypothetical protein POPTR_0011s13820g             183   9e-53   Populus trichocarpa [western balsam poplar]
ref|XP_004965741.1|  PREDICTED: thiamine thiazole synthase 2, chl...    183   1e-52   Setaria italica
gb|AHA84206.1|  thiamin biosynthetic enzyme                             183   1e-52   Phaseolus vulgaris [French bean]
ref|XP_007132954.1|  hypothetical protein PHAVU_011G139100g             182   1e-52   Phaseolus vulgaris [French bean]
emb|CDY47441.1|  BnaC09g31160D                                          182   1e-52   Brassica napus [oilseed rape]
ref|NP_001105697.1|  thiamine thiazole synthase 2, chloroplastic ...    182   2e-52   
dbj|BAA88225.1|  thiamin biosynthetic enzyme                            182   2e-52   Glycine max [soybeans]
emb|CDY52570.1|  BnaC03g71780D                                          182   2e-52   Brassica napus [oilseed rape]
emb|CDY28754.1|  BnaA02g09460D                                          182   3e-52   Brassica napus [oilseed rape]
ref|XP_006360084.1|  PREDICTED: thiamine thiazole synthase 1, chl...    182   3e-52   Solanum tuberosum [potatoes]
emb|CDY43024.1|  BnaA03g11710D                                          182   3e-52   Brassica napus [oilseed rape]
dbj|BAA88226.1|  thiamin biosynthetic enzyme                            181   3e-52   Glycine max [soybeans]
ref|XP_009132425.1|  PREDICTED: thiamine thiazole synthase, chlor...    181   3e-52   Brassica rapa
ref|NP_200288.1|  thiazole biosynthetic enzyme                          181   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485129.1|  PREDICTED: thiamine thiazole synthase, chlor...    186   4e-52   
gb|ABK22862.1|  unknown                                                 181   5e-52   Picea sitchensis
ref|NP_001236824.1|  thiamin biosynthetic enzyme                        181   6e-52   
ref|XP_006280726.1|  hypothetical protein CARUB_v10026695mg             181   6e-52   Capsella rubella
gb|ACF87708.1|  unknown                                                 181   7e-52   Zea mays [maize]
ref|XP_002463222.1|  hypothetical protein SORBIDRAFT_02g040060          181   7e-52   Sorghum bicolor [broomcorn]
ref|XP_007021022.1|  Thiazole biosynthetic enzyme, chloroplast (A...    181   8e-52   Theobroma cacao [chocolate]
dbj|BAC79982.1|  putative thiamine biosynthesis protein                 179   9e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105696.1|  thiamine thiazole synthase 1, chloroplastic ...    180   1e-51   Zea mays [maize]
gb|AFO59577.1|  thiamine biosynthetic enzyme                            180   1e-51   Saccharum hybrid cultivar GT28
ref|XP_010930933.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    180   1e-51   
ref|XP_002973063.1|  hypothetical protein SELMODRAFT_271002             180   1e-51   Selaginella moellendorffii
gb|ABK23376.1|  unknown                                                 180   1e-51   Picea sitchensis
ref|XP_009388868.1|  PREDICTED: thiamine thiazole synthase 2, chl...    180   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW83047.1|  hypothetical protein ZEAMMB73_797739                    180   2e-51   
ref|XP_006657781.1|  PREDICTED: thiamine thiazole synthase 2, chl...    179   2e-51   Oryza brachyantha
ref|XP_002994429.1|  hypothetical protein SELMODRAFT_163429             179   2e-51   
ref|XP_009127069.1|  PREDICTED: thiamine thiazole synthase, chlor...    179   2e-51   Brassica rapa
ref|NP_001059841.1|  Os07g0529600                                       179   3e-51   
gb|AAZ93636.1|  pathogen-induced defense-responsive protein 8           179   3e-51   Oryza sativa Indica Group [Indian rice]
dbj|BAC45141.1|  putative thiamine biosynthesis protein                 179   3e-51   Oryza sativa Japonica Group [Japonica rice]
pdb|1RP0|A  Chain A, Crystal Structure Of Thi1 Protein From Arabi...    177   3e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAV92535.1|  thiazole biosynthetic enzyme                            179   3e-51   Pseudotsuga menziesii var. menziesii
gb|EAZ04139.1|  hypothetical protein OsI_26282                          179   3e-51   Oryza sativa Indica Group [Indian rice]
gb|AFK48432.1|  unknown                                                 179   3e-51   Lotus japonicus
gb|KFK27084.1|  hypothetical protein AALP_AA8G331900                    179   3e-51   Arabis alpina [alpine rockcress]
gb|AAV92529.1|  thiazole biosynthetic enzyme                            179   4e-51   Pseudotsuga menziesii var. menziesii
gb|AAV92539.1|  thiazole biosynthetic enzyme                            179   4e-51   Pseudotsuga menziesii var. menziesii
gb|AAV92537.1|  thiazole biosynthetic enzyme                            178   4e-51   Pseudotsuga menziesii var. menziesii
gb|AAV92531.1|  thiazole biosynthetic enzyme                            178   4e-51   Pseudotsuga menziesii var. menziesii
gb|AAV92538.1|  thiazole biosynthetic enzyme                            178   4e-51   Pseudotsuga menziesii var. menziesii
gb|AFK49632.1|  unknown                                                 179   4e-51   Lotus japonicus
gb|AAV92552.1|  thiazole biosynthetic enzyme                            178   5e-51   Pseudotsuga menziesii var. menziesii
emb|CBI23176.3|  unnamed protein product                                178   5e-51   Vitis vinifera
gb|AAV92554.1|  thiazole biosynthetic enzyme                            178   6e-51   Pseudotsuga menziesii var. menziesii
sp|Q38709.1|THI4_ALNGL  RecName: Full=Thiamine thiazole synthase,...    177   1e-50   Alnus glutinosa
ref|XP_010923945.1|  PREDICTED: thiamine thiazole synthase, chlor...    176   3e-50   Elaeis guineensis
ref|XP_008809851.1|  PREDICTED: thiamine thiazole synthase 1, chl...    176   4e-50   Phoenix dactylifera
ref|XP_008803216.1|  PREDICTED: thiamine thiazole synthase 2, chl...    174   4e-49   Phoenix dactylifera
gb|EMT30436.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         169   2e-47   
gb|KFH67165.1|  thiazole biosynthetic enzyme, chloroplastic             163   1e-45   Mortierella verticillata NRRL 6337
emb|CDM85402.1|  unnamed protein product                                164   2e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005648929.1|  thiazole biosynthetic enzyme                       162   5e-45   Coccomyxa subellipsoidea C-169
ref|XP_004496859.1|  PREDICTED: thiamine thiazole synthase, chlor...    159   9e-44   Cicer arietinum [garbanzo]
gb|EPB86412.1|  thiazole biosynthetic enzyme, chloroplastic             157   2e-43   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN03507.1|  thiamin biosynthetic enzyme                            156   5e-43   Mucor ambiguus
gb|ABK95834.1|  unknown                                                 155   5e-43   Populus trichocarpa [western balsam poplar]
gb|EIE83081.1|  thiazole biosynthetic enzyme, chloroplastic             155   2e-42   Rhizopus delemar RA 99-880
gb|KDO30626.1|  hypothetical protein SPRG_04526                         155   3e-42   Saprolegnia parasitica CBS 223.65
ref|XP_009844132.1|  thiazole biosynthesis enzyme                       154   7e-42   Aphanomyces astaci
emb|CEI86767.1|  Putative Thiamine thiazole synthase                    150   8e-42   Rhizopus microsporus
emb|CEI86769.1|  Putative Thiamine thiazole synthase                    152   1e-41   Rhizopus microsporus
emb|CEG62855.1|  Putative Thiamine thiazole synthase                    152   2e-41   Rhizopus microsporus
emb|CEG76808.1|  Putative Thiamine thiazole synthase                    151   2e-41   Rhizopus microsporus
emb|CDY41008.1|  BnaA02g27980D                                          152   2e-41   Brassica napus [oilseed rape]
ref|XP_008616182.1|  thiamine biosynthetic enzyme                       153   2e-41   Saprolegnia diclina VS20
ref|XP_008877253.1|  thiazole biosynthetic enzyme, chloroplastic,...    152   2e-41   Aphanomyces invadans
emb|CEP18429.1|  hypothetical protein                                   152   3e-41   Parasitella parasitica
emb|CDP05793.1|  unnamed protein product                                150   7e-41   Coffea canephora [robusta coffee]
gb|EPB91714.1|  thiazole biosynthetic enzyme, chloroplastic             150   1e-40   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002784437.1|  conserved hypothetical protein                     150   2e-40   Perkinsus marinus ATCC 50983
emb|CBI23938.3|  unnamed protein product                                147   2e-40   Vitis vinifera
gb|EYU27823.1|  hypothetical protein MIMGU_mgv1a009995mg                150   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_008336996.1|  PREDICTED: thiamine thiazole synthase, chlor...    144   1e-39   
ref|XP_005834399.1|  putative THI4, thiamine                            148   1e-39   Guillardia theta CCMP2712
emb|CAH25337.1|  thiazole biosynthetic enzyme                           148   1e-39   Guillardia theta
gb|AEO13833.1|  thiazole biosynthetic protein                           141   4e-39   Camellia sinensis [black tea]
gb|ABR01228.1|  thiazole biosynthetic enzyme                            146   7e-39   Chlorella vulgaris
ref|XP_005847930.1|  hypothetical protein CHLNCDRAFT_22703              145   1e-38   Chlorella variabilis
ref|XP_006441062.1|  hypothetical protein CICLE_v10024231mg             145   2e-38   
gb|KDO47270.1|  hypothetical protein CISIN_1g039605mg                   145   3e-38   Citrus sinensis [apfelsine]
ref|XP_007376158.1|  hypothetical protein SPAPADRAFT_51398              143   1e-37   Spathaspora passalidarum NRRL Y-27907
ref|XP_001386426.1|  hypothetical protein PICST_50942                   143   1e-37   Scheffersomyces stipitis CBS 6054
gb|KIY92671.1|  thiamine biosynthetic enzyme                            142   2e-37   Monoraphidium neglectum
emb|CAA57779.1|  nmt2                                                   140   5e-37   Schizosaccharomyces pombe
ref|NP_596642.1|  thiazole biosynthetic enzyme                          140   8e-37   Schizosaccharomyces pombe
ref|XP_004198891.1|  Piso0_002284                                       139   2e-36   
ref|XP_007591792.1|  thiazole biosynthetic enzyme                       139   2e-36   
gb|KIY99977.1|  thiamine biosynthetic enzyme                            140   2e-36   Monoraphidium neglectum
ref|XP_002951140.1|  hypothetical protein VOLCADRAFT_74900              140   3e-36   Volvox carteri f. nagariensis
ref|XP_002951138.1|  hypothetical protein VOLCADRAFT_74899              139   3e-36   Volvox carteri f. nagariensis
ref|XP_004199741.1|  Piso0_002284                                       139   3e-36   
gb|EMG50374.1|  hypothetical protein G210_4595                          138   6e-36   Candida maltosa Xu316
ref|XP_001483482.1|  conserved hypothetical protein                     138   7e-36   Meyerozyma guilliermondii ATCC 6260
gb|EDK40113.2|  conserved hypothetical protein                          138   8e-36   Meyerozyma guilliermondii ATCC 6260
gb|KHC63824.1|  thiazole biosynthesis enzyme                            138   2e-35   Candida albicans P75010
ref|XP_001698672.1|  full-length thiazole biosynthetic enzyme           137   2e-35   Chlamydomonas reinhardtii
ref|XP_007913237.1|  putative thiazole biosynthetic enzyme protein      136   3e-35   Phaeoacremonium minimum UCRPA7
gb|KDN61355.1|  putative Thi4 family protein                            137   3e-35   Colletotrichum sublineola
gb|KIW79545.1|  thiamine thiazole synthase                              136   3e-35   Fonsecaea pedrosoi CBS 271.37
gb|EFW21941.1|  thiazole biosynthetic enzyme                            136   4e-35   Coccidioides posadasii str. Silveira
ref|XP_003066032.1|  thiazole biosynthetic enzyme, mitochondrial ...    136   4e-35   Coccidioides posadasii C735 delta SOWgp
ref|XP_001247344.1|  thiazole biosynthetic enzyme, mitochondrial ...    136   4e-35   
gb|EQB43457.1|  hypothetical protein CGLO_17887                         136   5e-35   Colletotrichum gloeosporioides Cg-14
gb|AAF25444.1|AF217503_1  putative thiazole synthase                    136   5e-35   Aspergillus oryzae
ref|XP_001819323.1|  thiazole biosynthetic enzyme                       135   5e-35   Aspergillus oryzae RIB40
ref|XP_002375225.1|  thiazole biosynthesis enzyme Sti35                 135   6e-35   Aspergillus flavus NRRL3357
gb|EYE95075.1|  Thi4 family thiamine biosynthetic enzyme                136   6e-35   Aspergillus ruber CBS 135680
gb|AAL86771.2|  THI4 enzyme                                             136   6e-35   Candida albicans
ref|XP_009853231.1|  hypothetical protein NEUTE1DRAFT_95662             136   6e-35   Neurospora tetrasperma FGSC 2508
emb|CCK70574.1|  hypothetical protein KNAG_0E03150                      135   6e-35   Kazachstania naganishii CBS 8797
ref|XP_723197.1|  likely thiamine biosynthesis enzyme                   136   6e-35   Candida albicans SC5314
gb|KGQ88127.1|  thiazole biosynthesis enzyme                            136   7e-35   Candida albicans P94015
ref|XP_002419419.1|  thiamine biosynthesis enzyme, putative; thia...    136   7e-35   Candida dubliniensis CD36
gb|KHC37210.1|  thiazole biosynthesis enzyme                            136   7e-35   Candida albicans P76067
gb|KGR10168.1|  thiazole biosynthesis enzyme                            136   7e-35   Candida albicans P57072
gb|KIW92677.1|  thiamine thiazole synthase                              135   7e-35   Cladophialophora bantiana CBS 173.52
sp|C4YNP4.1|THI4_CANAW  RecName: Full=Thiamine thiazole synthase;...    136   7e-35   Candida albicans WO-1
ref|XP_002548228.1|  hypothetical protein CTRG_02525                    135   7e-35   Candida tropicalis MYA-3404
ref|XP_001394167.1|  thiazole biosynthetic enzyme                       135   8e-35   Aspergillus niger CBS 513.88
gb|AGO09853.1|  AaceriAAL137Wp                                          135   8e-35   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_661532.1|  THI4_ASPOR Thiazole biosynthetic enzyme, mitoch...    135   8e-35   Aspergillus nidulans FGSC A4
ref|XP_007835960.1|  Thiamine thiazole synthase                         135   9e-35   Pestalotiopsis fici W106-1
ref|XP_461084.2|  DEHA2F16654p                                          135   9e-35   Debaryomyces hansenii CBS767
ref|XP_750725.1|  thiazole biosynthesis enzyme                          135   1e-34   Aspergillus fumigatus Af293
ref|XP_002479053.1|  thiazole biosynthesis enzyme                       135   1e-34   Talaromyces stipitatus ATCC 10500
gb|KEY78369.1|  thiazole biosynthesis enzyme                            135   1e-34   Aspergillus fumigatus var. RP-2014
gb|KFX46359.1|  Thiamine thiazole synthase                              135   1e-34   Talaromyces marneffei PM1
ref|XP_007794010.1|  putative thiazole biosynthetic enzyme protein      135   1e-34   
ref|XP_007745751.1|  thiazole biosynthetic enzyme, mitochondrial        135   1e-34   Cladophialophora psammophila CBS 110553
ref|XP_002146762.1|  thiazole biosynthesis enzyme                       135   1e-34   Talaromyces marneffei ATCC 18224
ref|XP_006666857.1|  thiazole biosynthetic enzyme                       135   1e-34   Cordyceps militaris CM01
ref|XP_001257952.1|  thiazole biosynthesis enzyme                       135   1e-34   Aspergillus fischeri NRRL 181
dbj|GAA84055.1|  thiazole biosynthesis enzyme                           135   1e-34   Aspergillus kawachii IFO 4308
dbj|GAM35876.1|  thiazole biosynthetic enzyme                           134   2e-34   Talaromyces cellulolyticus
ref|XP_001214996.1|  hypothetical protein ATEG_05818                    134   2e-34   Aspergillus terreus NIH2624
ref|XP_003044703.1|  predicted protein                                  134   2e-34   [Nectria] haematococca mpVI 77-13-4
ref|XP_010759569.1|  thiazole biosynthetic enzyme, mitochondrial        134   2e-34   Paracoccidioides brasiliensis Pb18
ref|XP_002797266.1|  thiazole biosynthesis enzyme                       134   2e-34   
gb|EPY53594.1|  thiazole biosynthetic enzyme                            134   2e-34   Schizosaccharomyces cryophilus OY26
ref|XP_002172093.1|  thiazole biosynthetic enzyme                       134   2e-34   Schizosaccharomyces japonicus yFS275
gb|EEH19379.2|  thiazole biosynthetic enzyme, mitochondrial             134   2e-34   Paracoccidioides brasiliensis Pb03
ref|XP_009844134.1|  thiazole biosynthesis enzyme, variant 2            133   2e-34   Aphanomyces astaci
gb|EFQ30532.1|  Thi4 family protein                                     134   3e-34   Colletotrichum graminicola M1.001
ref|NP_982405.1|  AAL137Wp                                              134   3e-34   Eremothecium gossypii ATCC 10895
gb|ENH83973.1|  thiazole biosynthetic enzyme                            134   3e-34   
ref|XP_008026201.1|  hypothetical protein SETTUDRAFT_177413             134   3e-34   Exserohilum turcica Et28A
ref|XP_007821738.1|  thiazole biosynthetic enzyme variant 1             134   3e-34   Metarhizium robertsii ARSEF 23
ref|XP_009154920.1|  thiazole biosynthetic enzyme, mitochondrial        134   3e-34   Exophiala dermatitidis NIH/UT8656
gb|KID99833.1|  thiazole biosynthetic enzyme variant 1                  134   3e-34   Metarhizium majus ARSEF 297
gb|KIX99472.1|  thiamine thiazole synthase                              134   4e-34   Fonsecaea multimorphosa CBS 102226
gb|KIV92747.1|  thiamine thiazole synthase                              134   4e-34   Exophiala mesophila
ref|XP_499918.1|  YALI0A09768p                                          133   4e-34   Yarrowia lipolytica CLIB122
gb|EPX71211.1|  thiazole biosynthetic enzyme                            134   4e-34   Schizosaccharomyces octosporus yFS286
ref|XP_007721137.1|  thiazole biosynthetic enzyme, mitochondrial        134   4e-34   Capronia coronata CBS 617.96
ref|XP_007807526.1|  thiazole biosynthetic enzyme variant 1             134   4e-34   Metarhizium acridum CQMa 102
ref|XP_003868755.1|  Thi4 thiamine biosynthetic enzyme precursor        134   4e-34   Candida orthopsilosis Co 90-125
gb|KID90425.1|  thiazole biosynthetic enzyme variant 1                  133   4e-34   Metarhizium guizhouense ARSEF 977
gb|KIX08964.1|  thiamine thiazole synthase                              133   4e-34   Rhinocladiella mackenziei CBS 650.93
gb|KIW29175.1|  thiamine thiazole synthase                              133   5e-34   Cladophialophora immunda
gb|EHN02289.1|  Thi4p                                                   133   5e-34   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|KIW21130.1|  thiamine thiazole synthase                              133   5e-34   Exophiala spinifera
gb|EEH38204.2|  thiazole biosynthesis enzyme                            134   5e-34   Paracoccidioides lutzii Pb01
ref|XP_001267966.1|  thiazole biosynthesis enzyme                       133   6e-34   Aspergillus clavatus NRRL 1
gb|KDB14289.1|  thiazole biosynthetic enzyme variant 1                  133   6e-34   Ustilaginoidea virens
gb|ABN45968.1|  thiazole biosynthetic enzyme variant 1                  132   7e-34   Epichloe typhina
gb|KIV86535.1|  thiamine thiazole synthase, variant 2                   133   7e-34   Exophiala sideris
gb|KEZ45124.1|  Thiamine thiazole synthase                              132   8e-34   Scedosporium apiospermum
ref|XP_007728533.1|  thiazole biosynthetic enzyme, mitochondrial        133   9e-34   Capronia epimyces CBS 606.96
ref|XP_011273842.1|  Thiazole biosynthetic enzyme                       132   9e-34   Wickerhamomyces ciferrii
emb|CCE44732.1|  hypothetical protein CPAR2_405360                      133   1e-33   Candida parapsilosis
gb|KHN95056.1|  thiazole biosynthetic enzyme variant 1                  132   1e-33   Metarhizium album ARSEF 1941
ref|XP_002564812.1|  Pc22g07960                                         132   1e-33   Penicillium rubens Wisconsin 54-1255
gb|KGQ06713.1|  Thiamine thiazole synthase                              132   1e-33   Beauveria bassiana D1-5
ref|XP_002842761.1|  thiazole biosynthetic enzyme                       132   1e-33   Microsporum canis CBS 113480
gb|KIV86533.1|  thiamine thiazole synthase                              132   1e-33   Exophiala sideris
ref|XP_002551959.1|  KLTH0B03916p                                       132   1e-33   Lachancea thermotolerans CBS 6340
ref|XP_007701574.1|  hypothetical protein COCSADRAFT_38262              132   1e-33   Bipolaris sorokiniana ND90Pr
gb|KEQ59396.1|  Thi4-domain-containing protein                          132   1e-33   Aureobasidium melanogenum CBS 110374
ref|XP_008598283.1|  mitochondrial thiazole biosynthetic enzyme         132   1e-33   Beauveria bassiana ARSEF 2860
ref|XP_007692325.1|  hypothetical protein COCMIDRAFT_30031              132   1e-33   Bipolaris oryzae ATCC 44560
gb|EKV04849.1|  Thiazole biosynthesis enzyme                            132   1e-33   Penicillium digitatum PHI26
ref|XP_008714161.1|  thiazole biosynthetic enzyme, mitochondrial        132   1e-33   Cyphellophora europaea CBS 101466
gb|EUN24789.1|  hypothetical protein COCVIDRAFT_17857                   132   1e-33   
ref|XP_003842741.1|  similar to thiazole biosynthetic enzyme            132   1e-33   
gb|ABL63512.1|  mitochondrial thiazole biosynthetic enzyme              132   2e-33   
ref|XP_007713209.1|  hypothetical protein COCCADRAFT_27023              132   2e-33   
pdb|3JSK|A  Chain A, Thiazole Synthase From Neurospora Crassa           132   2e-33   
gb|KHE80990.1|  hypothetical protein GE21DRAFT_10110                    132   2e-33   
gb|KGO43516.1|  Thiazole biosynthetic enzyme Thi4 family                132   2e-33   
gb|KFX98431.1|  hypothetical protein O988_04337                         132   2e-33   
ref|XP_011395239.1|  thiazole biosynthetic enzyme, variant 2            132   2e-33   
gb|EMD85953.1|  hypothetical protein COCHEDRAFT_1160889                 132   2e-33   
emb|CCF45087.1|  thiazole biosynthetic enzyme                           132   2e-33   
gb|EGA62236.1|  Thi4p                                                   130   2e-33   
ref|XP_007289177.1|  thiazole biosynthetic enzyme                       131   2e-33   
pdb|3FPZ|A  Chain A, Saccharomyces Cerevisiae Thi4p Is A Suicide ...    131   2e-33   
ref|NP_011660.1|  thiamine thiazole synthase                            131   2e-33   
gb|AJR77233.1|  Thi4p                                                   131   2e-33   
gb|EDN61733.1|  thiamine metabolism-related protein                     131   2e-33   
gb|KCW75370.1|  hypothetical protein EUGRSUZ_E04118                     129   2e-33   
gb|KIL95952.1|  hypothetical protein FAVG1_00690                        131   2e-33   
gb|KDB24510.1|  thiazole biosynthetic enzyme, mitochondrial             132   2e-33   
gb|EGD98433.1|  Thi4 family protein                                     132   2e-33   
ref|XP_007586590.1|  putative thiazole biosynthetic enzyme protein      131   2e-33   
ref|XP_001526313.1|  hypothetical protein LELG_02871                    132   2e-33   
ref|XP_003169195.1|  thiazole biosynthesis enzyme                       131   3e-33   
gb|KIW39396.1|  thiamine thiazole synthase, variant 1                   131   3e-33   
ref|XP_003013828.1|  hypothetical protein ARB_07940                     131   3e-33   
emb|CDM36407.1|  Thiazole biosynthetic enzyme, mitochondrial            132   3e-33   
gb|KFZ11494.1|  hypothetical protein V502_07520                         131   3e-33   
gb|EZF72777.1|  thiazole biosynthetic enzyme, mitochondrial             131   3e-33   
ref|XP_001904665.1|  hypothetical protein                               130   3e-33   
gb|EHK27008.1|  hypothetical protein TRIVIDRAFT_215037                  131   3e-33   
gb|EPS32049.1|  hypothetical protein PDE_07008                          131   3e-33   
ref|XP_002498498.1|  ZYRO0G11726p                                       131   3e-33   
ref|XP_003235740.1|  Thi4 family protein                                131   3e-33   
gb|KFY84898.1|  hypothetical protein V500_08902                         131   3e-33   
gb|KFY94986.1|  hypothetical protein V498_03597                         131   3e-33   
gb|ACN39013.1|  thiazole synthase                                       130   4e-33   
ref|XP_003297921.1|  hypothetical protein PTT_08482                     131   4e-33   
ref|XP_006692218.1|  hypothetical protein CTHT_0017160                  131   4e-33   
gb|KFZ09843.1|  hypothetical protein V501_05470                         131   4e-33   
gb|ABN45974.1|  thiazole biosynthetic enzyme variant 1                  131   4e-33   
gb|ELR08851.1|  thiazole biosynthetic enzyme, mitochondrial             131   4e-33   
gb|KIW39395.1|  thiamine thiazole synthase                              131   4e-33   
ref|XP_003005955.1|  STI35 protein                                      130   4e-33   
ref|XP_008726400.1|  thiazole biosynthetic enzyme, mitochondrial        131   4e-33   
gb|KEF63437.1|  thiazole biosynthetic enzyme, mitochondrial             130   4e-33   
ref|XP_009253330.1|  hypothetical protein FPSE_01936                    130   4e-33   
ref|XP_001227644.1|  thiazole biosynthetic enzyme, mitochondrial ...    130   4e-33   
gb|KFY70117.1|  hypothetical protein V499_09439                         130   4e-33   
gb|KFY08103.1|  hypothetical protein V492_06538                         130   5e-33   
ref|XP_001796354.1|  hypothetical protein SNOG_05965                    130   5e-33   
ref|XP_011318395.1|  hypothetical protein FGSG_02469                    130   5e-33   
dbj|GAD93648.1|  thiazole biosynthetic enzyme                           130   5e-33   
gb|ABQ23424.1|  thiazole biosynthetic enzyme                            130   5e-33   
sp|P23618.2|THI4_FUSOX  RecName: Full=Thiamine thiazole synthase;...    130   6e-33   
gb|KFY24905.1|  hypothetical protein V493_04960                         130   6e-33   
gb|ABG46357.1|  mitochondrial thiazole biosynthetic enzyme              130   6e-33   
ref|XP_003851349.1|  hypothetical protein MYCGRDRAFT_44262              130   6e-33   
gb|EWG49587.1|  thiamine biosynthetic enzyme                            130   6e-33   
gb|EWH18379.1|  Thi4p                                                   130   6e-33   
gb|EPE04284.1|  thiazole biosynthetic enzyme                            130   6e-33   
ref|XP_003665159.1|  hypothetical protein MYCTH_2315910                 130   6e-33   
gb|KEQ99790.1|  hypothetical protein AUEXF2481DRAFT_35726               130   7e-33   
ref|XP_001647032.1|  hypothetical protein Kpol_1050p31                  130   7e-33   
ref|XP_006968797.1|  thiazole biosynthetic enzyme                       130   7e-33   
gb|KFY20175.1|  hypothetical protein V491_03934                         130   8e-33   
gb|KFY43107.1|  hypothetical protein V494_02101                         130   8e-33   
emb|CDG58547.1|  Thi4 protein                                           130   8e-33   
gb|ERT00649.1|  thiazole biosynthetic enzyme, mitochondrial             130   8e-33   
emb|CDG58548.1|  Thi4-1 protein                                         130   8e-33   
gb|EMT70803.1|  Thiazole biosynthetic enzyme, mitochondrial             130   8e-33   
emb|CDG58549.1|  Thi4-2 protein                                         130   9e-33   
ref|XP_001589094.1|  thiazole biosynthetic enzyme                       129   1e-32   
emb|CAY79903.1|  Thi4p                                                  129   1e-32   
gb|AJP38917.1|  Thi4p                                                   129   1e-32   
gb|KIH92073.1|  thiamine biosynthetic enzyme                            130   1e-32   
emb|CDP29968.1|  Putative mitochondrial thiazole biosynthetic enz...    130   1e-32   
gb|EXK40264.1|  thiamine biosynthetic enzyme                            130   1e-32   
gb|EGA78748.1|  Thi4p                                                   130   1e-32   
ref|XP_004181884.1|  hypothetical protein TBLA_0H00760                  129   1e-32   
sp|P23617.1|THI4_FUSSH  RecName: Full=Thiamine thiazole synthase;...    129   2e-32   
gb|EFW98890.1|  thiazole biosynthetic enzyme                            129   2e-32   
gb|EWG49586.1|  thiamine biosynthetic enzyme                            130   2e-32   
dbj|GAM85562.1|  hypothetical protein ANO11243_035690                   129   2e-32   
emb|CCE33143.1|  probable CyPBP37 protein (protein binding to CyP41)    129   2e-32   
ref|XP_009648318.1|  STI35 protein                                      129   2e-32   
gb|EHL02685.1|  putative Thiazole biosynthetic enzyme, mitochondrial    129   2e-32   
gb|KEQ70131.1|  putative thiazole synthase THI4_ASPOR thiazole bi...    129   2e-32   
gb|KGO71577.1|  Thiazole biosynthetic enzyme Thi4 family                129   2e-32   
ref|XP_008087498.1|  FAD/NAD(P)-binding protein                         129   3e-32   
ref|XP_002541542.1|  thiazole biosynthesis enzyme                       129   3e-32   
emb|CDO93401.1|  unnamed protein product                                129   3e-32   
gb|ESZ95478.1|  thiazole biosynthetic enzyme                            129   3e-32   
gb|ACB70465.1|  thiazole biosynthetic enzyme                            128   3e-32   
ref|XP_001549602.1|  thiazole biosynthetic enzyme                       129   3e-32   
gb|KIW54196.1|  thiamine thiazole synthase                              129   3e-32   
gb|KIN04678.1|  hypothetical protein OIDMADRAFT_17638                   128   3e-32   
ref|XP_007757037.1|  thiazole biosynthetic enzyme, mitochondrial        128   3e-32   
emb|CDG58546.1|  Thi4 protein                                           129   3e-32   
gb|EUC66166.1|  thiamine thiazole synthase                              128   3e-32   
ref|XP_001935439.1|  thiazole biosynthesis enzyme                       128   4e-32   
ref|XP_004179275.1|  hypothetical protein TBLA_0B09390                  128   4e-32   
ref|XP_007928692.1|  hypothetical protein MYCFIDRAFT_211863             128   4e-32   
ref|XP_003647237.1|  hypothetical protein Ecym_6012                     128   4e-32   
sp|C0NSF3.2|THI4_AJECG  RecName: Full=Thiamine thiazole synthase;...    128   4e-32   
ref|XP_001538310.1|  hypothetical protein HCAG_05915                    128   4e-32   
ref|XP_449395.1|  hypothetical protein                                  128   5e-32   
gb|EEH05819.1|  thiazole biosynthetic enzyme                            128   5e-32   
gb|EER41684.1|  thiazole biosynthetic enzyme                            128   5e-32   
gb|KDN34978.1|  hypothetical protein RSAG8_11984                        127   6e-32   
ref|XP_002626178.1|  thiazole biosynthesis enzyme                       127   7e-32   
gb|EEQ92538.1|  thiazole biosynthesis enzyme                            127   7e-32   
gb|AGT99181.1|  thiazole biosynthetic enzyme                            127   7e-32   
gb|KEQ82031.1|  Thi4-domain-containing protein                          127   8e-32   
emb|CEJ80029.1|  Putative Thiamine thiazole synthase                    127   9e-32   
gb|EGA86663.1|  Thi4p                                                   127   1e-31   
emb|CCO32846.1|  Thiamine thiazole synthase AltName: Full=Stress-...    127   1e-31   
emb|CDF87469.1|  BN860_07074g1_1                                        127   1e-31   
gb|ESW99744.1|  Thiamine thiazole synthase                              126   1e-31   
emb|CDH15474.1|  probable Thiamine thiazole synthase                    127   1e-31   
gb|EHK44880.1|  hypothetical protein TRIATDRAFT_299703                  127   1e-31   
gb|KIW68442.1|  thiamine thiazole synthase                              127   1e-31   
gb|KFX95262.1|  hypothetical protein V490_03958                         132   1e-31   
gb|KFY37341.1|  hypothetical protein V495_07232                         131   2e-31   
gb|ACN36998.1|  unknown                                                 124   2e-31   
emb|CEJ80028.1|  Putative Thiamine thiazole synthase                    127   2e-31   
dbj|BAO40649.1|  thiazole biosynthetic enzyme                           126   2e-31   
ref|XP_451008.1|  hypothetical protein                                  126   3e-31   
emb|CEP62770.1|  LALA0S06e03400g1_1                                     126   3e-31   
gb|KFY50717.1|  hypothetical protein V496_09214                         130   3e-31   
ref|XP_002492875.1|  Thiazole synthase, catalyzes formation of th...    125   6e-31   
gb|EQL00755.1|  thiazole biosynthetic enzyme variant 1                  125   7e-31   
ref|XP_007672530.1|  hypothetical protein BAUCODRAFT_62660              124   1e-30   
gb|ELQ36693.1|  hypothetical protein OOU_Y34scaffold00646g4             124   1e-30   
ref|XP_003720575.1|  thiazole biosynthetic enzyme                       124   2e-30   
gb|EIF46156.1|  thiazole biosynthetic enzyme                            123   2e-30   
gb|KJA21255.1|  hypothetical protein HYPSUDRAFT_42403                   123   3e-30   
ref|XP_003654402.1|  hypothetical protein THITE_2117402                 123   3e-30   
gb|KGK37032.1|  hypothetical protein JL09_g3847                         123   3e-30   
gb|EME42084.1|  hypothetical protein DOTSEDRAFT_73000                   123   4e-30   
gb|EMF12655.1|  thiazole biosynthetic enzyme, mitochondrial             123   4e-30   
ref|XP_007351669.1|  thiazole biosynthetic enzyme                       122   5e-30   
ref|XP_003676118.1|  hypothetical protein NCAS_0D01750                  122   5e-30   
gb|EJT96874.1|  thiazole biosynthetic enzyme                            122   6e-30   
ref|XP_003669189.1|  hypothetical protein NDAI_0C02860                  122   7e-30   
ref|XP_007416429.1|  hypothetical protein MELLADRAFT_53832              122   7e-30   
ref|XP_009228164.1|  thiazole biosynthetic enzyme                       122   7e-30   
ref|XP_003320392.1|  thiazole biosynthetic enzyme, mitochondrial        122   9e-30   
gb|EGU11956.1|  Thiazole biosynthetic enzyme                            122   1e-29   
gb|KIJ50951.1|  hypothetical protein M422DRAFT_101777                   117   1e-29   
dbj|GAK64104.1|  thi4-domain-containing protein                         121   1e-29   
ref|XP_009269436.1|  Thiamine thiazole synthase                         121   1e-29   
gb|EST05805.1|  flavin-binding monooxygenase-like                       121   2e-29   
gb|AFG52195.1|  hypothetical protein UMN_CL97Contig1_06                 114   2e-29   
dbj|GAC72397.1|  hypothetical protein PANT_7d00078                      120   2e-29   
gb|ETS60793.1|  hypothetical protein PaG_04705                          120   3e-29   
gb|KDN47179.1|  putative Thiamin biosynthetic enzyme                    120   3e-29   
gb|KFA66874.1|  hypothetical protein S40285_02303                       120   3e-29   
emb|CCF51739.1|  probable Thiamin biosynthetic enzyme                   120   4e-29   
gb|AEW09378.1|  hypothetical protein UMN_CL97Contig1_06                 113   5e-29   
gb|EMS18749.1|  thiamine biosynthetic enzyme                            120   6e-29   
dbj|GAC98786.1|  flavin-binding monooxygenase-like                      119   1e-28   
ref|XP_006462581.1|  hypothetical protein AGABI2DRAFT_72787             118   1e-28   
ref|XP_006957782.1|  Thi4-domain-containing protein                     119   1e-28   
gb|ELQ63963.1|  hypothetical protein OOW_P131scaffold00904g6            123   1e-28   
gb|KEY67925.1|  hypothetical protein S7711_02133                        119   1e-28   
emb|CDI56388.1|  probable Thiamin biosynthetic enzyme                   119   1e-28   
emb|CCX30406.1|  Similar to Thiamine thiazole synthase; acc. no. ...    118   2e-28   
emb|CBQ71006.1|  probable Thiamin biosynthetic enzyme                   118   2e-28   
ref|XP_003034505.1|  hypothetical protein SCHCODRAFT_84820              118   3e-28   
sp|Q9UVF8.1|THI4_UROFA  RecName: Full=Thiamine thiazole synthase;...    118   3e-28   
gb|KIP06210.1|  hypothetical protein PHLGIDRAFT_468135                  117   4e-28   
gb|KIJ24322.1|  hypothetical protein M422DRAFT_274931                   117   4e-28   
gb|KDQ62341.1|  hypothetical protein JAAARDRAFT_170661                  117   6e-28   
ref|XP_003683090.1|  hypothetical protein TDEL_0H00200                  116   7e-28   
ref|XP_007271222.1|  thiazole biosynthetic enzyme                       116   8e-28   
gb|KDQ25745.1|  hypothetical protein PLEOSDRAFT_1057999                 115   1e-27   
ref|XP_001835983.2|  thiazole biosynthetic enzyme                       115   2e-27   
ref|XP_007304939.1|  Thi4-domain-containing protein                     115   2e-27   
ref|XP_011388856.1|  putative Thiamin biosynthetic enzyme               116   2e-27   
ref|XP_009546328.1|  hypothetical protein HETIRDRAFT_440039             116   2e-27   
ref|XP_008037799.1|  Thi4-domain-containing protein                     115   2e-27   
sp|Q4PC85.1|THI4_USTMA  RecName: Full=Thiamine thiazole synthase;...    116   2e-27   
gb|KIK52064.1|  hypothetical protein GYMLUDRAFT_50135                   115   3e-27   
gb|KII90613.1|  hypothetical protein PLICRDRAFT_538929                  115   3e-27   
ref|XP_007399642.1|  hypothetical protein PHACADRAFT_177254             114   4e-27   
ref|XP_007882083.1|  hypothetical protein PFL1_06351                    115   4e-27   
ref|XP_007319542.1|  hypothetical protein SERLADRAFT_470126             114   4e-27   
gb|AGB85035.1|  thiamine biosynthesis thi4 protein                      114   5e-27   
ref|XP_007866883.1|  Thi4-domain-containing protein                     114   6e-27   
emb|CCV00434.1|  unnamed protein product                                114   7e-27   
gb|KIO02829.1|  hypothetical protein M404DRAFT_27718                    114   7e-27   
gb|EPT05287.1|  hypothetical protein FOMPIDRAFT_1112158                 114   7e-27   
gb|KIM43217.1|  hypothetical protein M413DRAFT_444027                   113   1e-26   
ref|XP_001754158.1|  predicted protein                                  111   1e-26   
gb|KIM86133.1|  hypothetical protein PILCRDRAFT_816673                  113   1e-26   
emb|CCM00650.1|  predicted protein                                      113   1e-26   
gb|EMD39842.1|  hypothetical protein CERSUDRAFT_112109                  113   2e-26   
ref|XP_003683988.1|  hypothetical protein TPHA_0A04790                  112   2e-26   
gb|KIL63207.1|  hypothetical protein M378DRAFT_79929                    112   3e-26   
ref|XP_007768494.1|  Thi4-domain-containing protein                     112   3e-26   
ref|XP_007364009.1|  Thi4-domain-containing protein                     112   4e-26   
gb|KIJ62636.1|  hypothetical protein HYDPIDRAFT_94083                   111   5e-26   
gb|KIJ17836.1|  hypothetical protein PAXINDRAFT_9774                    111   6e-26   
ref|XP_001731131.1|  hypothetical protein MGL_1314                      111   9e-26   
gb|KIK99865.1|  hypothetical protein PAXRUDRAFT_822318                  110   1e-25   
ref|XP_007380545.1|  thiazole biosynthetic enzyme                       110   2e-25   
gb|KIM63333.1|  hypothetical protein SCLCIDRAFT_752494                  110   2e-25   
gb|KIY62047.1|  thiazole biosynthetic enzyme                            110   2e-25   
gb|KIY43384.1|  Thi4-domain-containing protein                          110   2e-25   
gb|ACZ34282.1|  thiazole synthase                                       108   9e-25   
ref|XP_007853538.1|  thiazole biosynthetic enzyme                       107   3e-24   
gb|ELU45290.1|  thiazole biosynthetic enzyme                            104   3e-22   
ref|XP_003344754.1|  hypothetical protein SMAC_06409                  98.6    2e-21   
emb|CDK26023.1|  unnamed protein product                              97.1    6e-21   
ref|XP_007277744.1|  thiazole biosynthetic enzyme                     95.5    2e-20   
gb|KDR82811.1|  hypothetical protein GALMADRAFT_238371                94.4    5e-20   
ref|XP_011397717.1|  Thiamine thiazole synthase, chloroplastic        85.1    3e-16   
emb|CCJ09780.1|  putative thiazole biosynthetic enzyme                82.4    7e-16   
ref|WP_018193037.1|  MULTISPECIES: hypothetical protein               76.6    9e-14   
ref|WP_013681434.1|  ribulose-1,5-biphosphate synthetase              75.9    1e-13   



>ref|XP_011086171.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=353

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +2

Query  188  QAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            Q ++A+ H NLSV+ S  PY+LD+FKF PIKESIV+REMTRRYMTDMI YADTDV+VVGA
Sbjct  35   QPIRATPH-NLSVTMSSAPYNLDNFKFHPIKESIVSREMTRRYMTDMITYADTDVVVVGA  93

Query  368  GSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+E
Sbjct  94   GSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEIE  151



>gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
 gb|EYU33911.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
Length=351

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +2

Query  188  QAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            Q +K S+  NL+V+ + TPY+LD FKFQPIKESIVAREMTRRYMTDMI YADTDV+VVGA
Sbjct  36   QPIK-STPKNLAVAMASTPYNLDDFKFQPIKESIVAREMTRRYMTDMITYADTDVVVVGA  94

Query  368  GSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GSAGLSCAYE+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+E
Sbjct  95   GSAGLSCAYELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHKFLDELEIE  152



>gb|KDO52969.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=321

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  37   LQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVV  96

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++
Sbjct  97   GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGID  156



>gb|ABI84250.1| thiamine biosynthetic enzyme [Arachis hypogaea]
Length=201

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
             +S+S +  PY L SFKFQPIKESIVAREMTRRYMTDMI YADTDVIVVGAGSAGLSCAY
Sbjct  42   TISMSMATPPYDLQSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAY  101

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            E+SKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELEV
Sbjct  102  ELSKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEV  149



>emb|CDO99712.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 109/120 (91%), Gaps = 1/120 (1%)
 Frame = +2

Query  185  VQAVKASSHH-NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            VQ VK+S  + ++++SAS   Y+ D+FKFQPI+ESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  32   VQPVKSSPQNFSVTMSASTPQYNFDAFKFQPIQESIVSREMTRRYMTDMITYADTDVVVV  91

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELEVE
Sbjct  92   GAGSAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHKFLDELEVE  151



>ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [Citrus sinensis]
 sp|O23787.1|THI4_CITSI RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Citrus 
sinensis]
 emb|CAB05370.1| thi [Citrus sinensis]
Length=356

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  37   LQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVV  96

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++
Sbjct  97   GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGID  156



>ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
 gb|ESR65433.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
Length=356

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  37   LQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVV  96

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++
Sbjct  97   GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGID  156



>gb|KDO52968.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=356

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  37   LQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVV  96

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++
Sbjct  97   GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGID  156



>ref|XP_011096106.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=354

 Score =   199 bits (505),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 108/121 (89%), Gaps = 2/121 (2%)
 Frame = +2

Query  182  CVQAVKASSHHNLSVSASHT-PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIV  358
             VQ +K S+  +L+++ S   PY+LD+FKFQPIKESIV+REMTRRYMTDMI YADTDV+V
Sbjct  33   AVQPIK-SAPQSLAITMSAAAPYNLDNFKFQPIKESIVSREMTRRYMTDMITYADTDVVV  91

Query  359  VGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELEV
Sbjct  92   VGAGSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHKFLDELEV  151

Query  539  E  541
            E
Sbjct  152  E  152



>ref|XP_008463440.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Cucumis 
melo]
Length=359

 Score =   196 bits (499),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            A++   +S SAS  PY L+ FKF PI+ESIV+REMTRRYMTDMI YADTDVI+VGAGSAG
Sbjct  40   AATSLTISASASQPPYDLNQFKFNPIRESIVSREMTRRYMTDMITYADTDVIIVGAGSAG  99

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            LSCAYE+SKNPN+R+AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VE
Sbjct  100  LSCAYELSKNPNIRIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEVGVE  153



>ref|XP_004152916.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172748.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56149.1| hypothetical protein Csa_3G078800 [Cucumis sativus]
Length=359

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            A++   +S SAS  PY L+ FKF PI+ESIV+REMTRRYMTDMI YADTDV++VGAGSAG
Sbjct  40   AATSLTISASASQPPYDLNQFKFNPIRESIVSREMTRRYMTDMITYADTDVVIVGAGSAG  99

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            LSCAYE+SKNPN+R+AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VE
Sbjct  100  LSCAYELSKNPNIRIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEVGVE  153



>ref|XP_004496776.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=350

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 2/118 (2%)
 Frame = +2

Query  194  VKASSHHNLSVSASHT--PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            +K++SH+  SVS S    PY L SFKFQPIKESIV+REMTRRYMTDMI YADTDV++VGA
Sbjct  32   IKSTSHNYSSVSMSLNTPPYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTDVVIVGA  91

Query  368  GSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V+
Sbjct  92   GSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVD  149



>ref|XP_010267751.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Nelumbo 
nucifera]
Length=356

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS  +LS+S S TP Y L SFKF+PI+ESIV+REMTRRYM DMI YADTDV++VGAGSAG
Sbjct  41   SSPQSLSISMSSTPPYDLQSFKFEPIRESIVSREMTRRYMMDMITYADTDVVIVGAGSAG  100

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            LSCAYE+SKNP+VRVAIIEQSVSPGGG+WLGGQLFSAMVVRKPAQ+FLDEL +E
Sbjct  101  LSCAYELSKNPSVRVAIIEQSVSPGGGSWLGGQLFSAMVVRKPAQLFLDELGIE  154



>gb|KJB67127.1| hypothetical protein B456_010G176000 [Gossypium raimondii]
Length=356

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS HN ++S S TP Y L SF+FQPIKES V+REMTRRYM DMI YADTDVI+VGAGSAG
Sbjct  41   SSSHNSAISMSLTPPYDLQSFEFQPIKESYVSREMTRRYMMDMITYADTDVIIVGAGSAG  100

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            LSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++
Sbjct  101  LSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQ  154



>gb|KHG29710.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=356

 Score =   194 bits (492),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS HN ++S S TP Y L SFKFQPIKES V+REMTRRYM D+I YADTDVI+VGAGSAG
Sbjct  41   SSSHNSAISMSLTPPYDLQSFKFQPIKESYVSREMTRRYMMDIITYADTDVIIVGAGSAG  100

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            LSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++
Sbjct  101  LSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQ  154



>gb|KJB57702.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=304

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS    ++S S TP Y L SFKFQPIKES VAREMTRRYM DMI YADTDVI+VGAGSAG
Sbjct  40   SSSQTATISMSLTPPYDLQSFKFQPIKESYVAREMTRRYMMDMITYADTDVIIVGAGSAG  99

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            LSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++
Sbjct  100  LSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQ  153



>gb|ACV52582.1| thiazole biosynthetic enzyme [Nicotiana benthamiana]
Length=160

 Score =   187 bits (476),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S  +S  PY L++F F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAY
Sbjct  45   SMSADSSPPPYDLNAFSFNPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAY  104

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            EISKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++
Sbjct  105  EISKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGID  153



>ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
 gb|EEE97818.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
Length=350

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +S+S +   Y L SFKFQPIKESIV+REMTRRYMTDM+ YADTDV++VGAGSAGL
Sbjct  40   STSPAISMSLTQPSYDLQSFKFQPIKESIVSREMTRRYMTDMVTYADTDVVIVGAGSAGL  99

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSAM+VRKPA  FLDELE+E
Sbjct  100  SCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDELEIE  152



>ref|XP_003536550.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            +S    +S+S +  PY L SFKFQPIKESIV+REMTRRYMTDMI YADTDV++VGAGSAG
Sbjct  37   SSKQGTISMSLTQPPYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAG  96

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            LSCAYEISKNP V VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  97   LSCAYEISKNPAVSVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  149



>ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
 gb|ABK94925.1| unknown [Populus trichocarpa]
 gb|EEE86114.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
Length=350

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +++S +   Y L SFKFQPIKESIV+REMTRRYMTDM+ YADTDV+VVGAGSAGL
Sbjct  40   STSPAITMSLTQPSYDLQSFKFQPIKESIVSREMTRRYMTDMVTYADTDVVVVGAGSAGL  99

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSAM+VRKPA  FLDELE+E
Sbjct  100  SCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDELEIE  152



>gb|AFK49080.1| unknown [Medicago truncatula]
Length=195

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++FKF PIKESIVAREMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE+SKNPNV++
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPNVKI  113

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+E
Sbjct  114  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELEIE  152



>gb|KJB57700.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
 gb|KJB57701.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=355

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS    ++S S TP Y L SFKFQPIKES VAREMTRRYM DMI YADTDVI+VGAGSAG
Sbjct  40   SSSQTATISMSLTPPYDLQSFKFQPIKESYVAREMTRRYMMDMITYADTDVIIVGAGSAG  99

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            LSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++
Sbjct  100  LSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQ  153



>ref|XP_011037712.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +++S +   Y L SFKFQPIKESIV+REMTRRYMTDM+ YADTDV++VGAGSAGL
Sbjct  40   STSSAITMSLAQPSYDLQSFKFQPIKESIVSREMTRRYMTDMVTYADTDVVIVGAGSAGL  99

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSAM+VRKPA  FLDELE+E
Sbjct  100  SCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDELEIE  152



>ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
 gb|ESR62329.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
Length=359

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 2/121 (2%)
 Frame = +2

Query  185  VQAVKASSHHNL-SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIV  358
            V  +++SS     ++S S TP Y  +SF F PIKESIV+REMTRRYMTDM+ YADTDVIV
Sbjct  37   VTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREMTRRYMTDMVTYADTDVIV  96

Query  359  VGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VGAGSAGLSCAYEISKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQ+FLDEL V
Sbjct  97   VGAGSAGLSCAYEISKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQIFLDELGV  156

Query  539  E  541
            E
Sbjct  157  E  157



>ref|XP_007213805.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
 gb|EMJ15004.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
Length=360

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 4/121 (3%)
 Frame = +2

Query  188  QAVKASSHHNLSVSAS---HTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVI  355
            +A   S++H LSVS S    TP Y L +FKF PIKESIV+REMTRRYMTDMI YADTDV+
Sbjct  39   KAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADTDVV  98

Query  356  VVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELE  535
            VVGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL 
Sbjct  99   VVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELG  158

Query  536  V  538
            +
Sbjct  159  I  159



>ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
 gb|ESW15201.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
Length=355

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            +S    +S+S +  PY L SFKFQPIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAG
Sbjct  41   SSKQPTISMSLTPPPYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAG  100

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            LSCAYE+SKNP V VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V+
Sbjct  101  LSCAYELSKNPAVSVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVD  154



>ref|XP_010545204.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Tarenaya 
hassleriana]
Length=359

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S  +S  PY L++F+F PIKESIV+REMTRRYMTDMI YA+TDV++VGAGSAGLSCAYEI
Sbjct  52   SAESSSPPYDLNNFRFSPIKESIVSREMTRRYMTDMITYAETDVVIVGAGSAGLSCAYEI  111

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SKNPNV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL++E
Sbjct  112  SKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHMFLDELDIE  158



>gb|EPS63253.1| hypothetical protein M569_11533 [Genlisea aurea]
Length=344

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A+  PY+LD+FKF PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK
Sbjct  40   AAAALPYNLDAFKFNPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSK  99

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            NP+V VA++EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELEV+
Sbjct  100  NPDVNVALVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEVD  144



>gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticulata]
Length=355

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = +2

Query  206  SHHNLSVS-ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            SH + ++S +S +PY L SFKF+PIKESIVAREMTRRYM DMI YADTDV++VGAGSAGL
Sbjct  41   SHQSPTISMSSASPYDLQSFKFEPIKESIVAREMTRRYMMDMITYADTDVVIVGAGSAGL  100

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SCAYE+SKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +E
Sbjct  101  SCAYELSKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELGIE  153



>ref|XP_008244366.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Prunus 
mume]
Length=360

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 105/121 (87%), Gaps = 4/121 (3%)
 Frame = +2

Query  188  QAVKASSHHNLSVSAS---HTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVI  355
            +A   S++H LSVS S    TP Y L +FKF PIKESIV+REMTRRYMTDMI YADTDV+
Sbjct  39   KAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADTDVV  98

Query  356  VVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELE  535
            VVGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL 
Sbjct  99   VVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELG  158

Query  536  V  538
            +
Sbjct  159  I  159



>ref|XP_003563001.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Brachypodium 
distachyon]
Length=352

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+SAS  PY L++FKF PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+
Sbjct  43   SISASTPPYDLNAFKFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEL  102

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SK+P++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +E
Sbjct  103  SKDPSISIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELNIE  149



>gb|KEH43920.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=349

 Score =   191 bits (484),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +++S +  PY +++FKF PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGL
Sbjct  37   STPQKITMSLTTPPYDINTFKFAPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGL  96

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VE
Sbjct  97   SCAYELSKNPNISIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVE  149



>ref|XP_002267414.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Vitis 
vinifera]
 sp|F6H7K5.1|THI42_VITVI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Vitis vinifera]
Length=355

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +2

Query  206  SHHNLSVSASH-TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            SH + ++S S  +PY L SFKF+PIKESIVAREMTRRYM DMI YADTDV++VGAGSAGL
Sbjct  41   SHQSPTISMSSVSPYDLQSFKFEPIKESIVAREMTRRYMMDMITYADTDVVIVGAGSAGL  100

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SCAYE+SKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +E
Sbjct  101  SCAYELSKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELGIE  153



>ref|XP_003556028.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            + +S    +S+S +  PY L SFKFQPIKESIV+REMTRRYMTDMI YADTDV++VGAGS
Sbjct  35   LSSSKQGTISMSLTPPPYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTDVVIVGAGS  94

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AGLSCAYE+SKNP V VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  95   AGLSCAYELSKNPAVSVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  149



>gb|AFK44470.1| unknown [Medicago truncatula]
Length=349

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +++S +  PY +++FKF PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGL
Sbjct  37   STPQKITMSLTTPPYDINTFKFAPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGL  96

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VE
Sbjct  97   SCAYELSKNPNISIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVE  149



>ref|XP_004294669.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 107/125 (86%), Gaps = 6/125 (5%)
 Frame = +2

Query  185  VQAVKA--SSHHNLSVS----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            VQ +KA  S+ H LSVS     S + Y L +FKF+PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   VQPLKAATSNGHGLSVSMSAGGSTSAYDLTNFKFEPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLN  154

Query  527  ELEVE  541
            EL ++
Sbjct  155  ELGID  159



>ref|XP_002281769.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Vitis 
vinifera]
 sp|F6H9A9.1|THI41_VITVI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Vitis vinifera]
Length=353

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            NL+V+A+  PY L SFKF+PIKESIV+REMTRRYM DMI YADTDV+VVGAGSAGLSCAY
Sbjct  44   NLAVTAAAMPYDLRSFKFEPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSAGLSCAY  103

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            E+SKNP+V+VAIIEQSVSPGGGAWLGGQLFS+MVVRKPA  FLDEL +E
Sbjct  104  ELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSSMVVRKPAHRFLDELGLE  152



>ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Citrus 
sinensis]
 gb|KDO75540.1| hypothetical protein CISIN_1g018188mg [Citrus sinensis]
Length=359

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 104/121 (86%), Gaps = 2/121 (2%)
 Frame = +2

Query  185  VQAVKASSHHNL-SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIV  358
            V  +++SS     ++S S TP Y  +SF F PIKESIV+REMTRRYMTDM+ YADTDVIV
Sbjct  37   VTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREMTRRYMTDMVTYADTDVIV  96

Query  359  VGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VGAGSAGLSCAYEISKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQ FLDEL V
Sbjct  97   VGAGSAGLSCAYEISKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQRFLDELGV  156

Query  539  E  541
            E
Sbjct  157  E  157



>ref|XP_010105570.1| Thiamine thiazole synthase 2 [Morus notabilis]
 gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis]
Length=353

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = +2

Query  182  CVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            C++   A +  ++S+SA+  PY L +F+F+PIKESIV+REMTRRYM DMI YADTDV+VV
Sbjct  34   CLRLQPAKAGFSVSMSAA-APYDLKNFRFEPIKESIVSREMTRRYMMDMITYADTDVVVV  92

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +E
Sbjct  93   GAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIE  152



>ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Solanum 
lycopersicum]
Length=354

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 101/116 (87%), Gaps = 3/116 (3%)
 Frame = +2

Query  203  SSHHNLSVSAS---HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            S+  N+SVS S     PY L SF F PIKESIVAREMTRRYMTDMI YADTDV++VGAGS
Sbjct  39   STPQNMSVSMSADASPPYDLGSFSFNPIKESIVAREMTRRYMTDMITYADTDVVIVGAGS  98

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AGLSCAYE+SKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++
Sbjct  99   AGLSCAYELSKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGID  154



>gb|EPS63028.1| thiazole biosynthetic enzyme, chloroplastic, partial [Genlisea 
aurea]
Length=291

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L+SFKF PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SKNP+VR
Sbjct  2    PYDLNSFKFAPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPSVR  61

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V+
Sbjct  62   VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVD  101



>ref|XP_004294348.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 2/121 (2%)
 Frame = +2

Query  185  VQAVKASSHHNLSVS--ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIV  358
            ++A  +S+ H LSVS  AS   Y L +FKF+PIKESIV+REMTRRYMTDMI YADTDV+V
Sbjct  40   LKAASSSNGHGLSVSMSASTNAYDLSNFKFEPIKESIVSREMTRRYMTDMITYADTDVVV  99

Query  359  VGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FL EL +
Sbjct  100  VGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLSELGI  159

Query  539  E  541
            +
Sbjct  160  D  160



>gb|KHG06769.1| Thiamine thiazole synthase 1, chloroplastic [Gossypium arboreum]
Length=357

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 102/116 (88%), Gaps = 3/116 (3%)
 Frame = +2

Query  203  SSHHNLSVS---ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            SSH N S+S   AS  PY  ++F+F PIKESIV+REMTRRYM DMIIYADTDV+VVGAGS
Sbjct  42   SSHCNASISMSAASPPPYDFNNFRFDPIKESIVSREMTRRYMMDMIIYADTDVVVVGAGS  101

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +E
Sbjct  102  AGLSCAYELSKNPSVQIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELAIE  157



>ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma cacao]
 gb|EOY28614.1| Thiazole biosynthetic enzyme [Theobroma cacao]
Length=387

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +2

Query  194  VKASSHHN-LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            +++SS  + +S+S +  PY L SF FQPIKES VAREMTRRYM DMI YADTDVI+VGAG
Sbjct  69   IRSSSQDSAISMSLNTPPYDLQSFNFQPIKESYVAREMTRRYMMDMITYADTDVIIVGAG  128

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SAGLSCAYEISKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++
Sbjct  129  SAGLSCAYEISKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIQ  185



>gb|KHG02821.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=355

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 103/117 (88%), Gaps = 2/117 (2%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            +K+SS  + ++S S TP Y L SFKFQPI+ES VAREMTRRYM DMI YADTDVI+VGAG
Sbjct  38   IKSSSQIS-TISMSLTPPYDLQSFKFQPIQESYVAREMTRRYMMDMITYADTDVIIVGAG  96

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++
Sbjct  97   SAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQ  153



>gb|AAP03875.1| putative chloroplast thiazole biosynthetic protein [Nicotiana 
tabacum]
Length=358

 Score =   189 bits (479),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 4/117 (3%)
 Frame = +2

Query  203  SSHHNLSVS----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            S+  N+++S    +S  PY L++F F PIKESIV+REMTRRYMTDMI YADTDV++VGAG
Sbjct  42   SAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVSREMTRRYMTDMITYADTDVVIVGAG  101

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++
Sbjct  102  SAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGID  158



>ref|XP_009774029.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Nicotiana 
sylvestris]
Length=358

 Score =   189 bits (479),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 4/117 (3%)
 Frame = +2

Query  203  SSHHNLSVS----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            S+  N+++S    +S  PY L++F F PIKESIV+REMTRRYMTDMI YADTDV++VGAG
Sbjct  42   SAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVSREMTRRYMTDMITYADTDVVIVGAG  101

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++
Sbjct  102  SAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGID  158



>ref|XP_009590342.1| PREDICTED: thiamine thiazole synthase, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158} 
[Nicotiana tomentosiformis]
Length=359

 Score =   189 bits (479),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 4/117 (3%)
 Frame = +2

Query  203  SSHHNLSVS----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            S+  N+++S    +S  PY L++F F PIKESIV+REMTRRYMTDMI YADTDV++VGAG
Sbjct  43   SAQQNMTISMSADSSPPPYDLNAFTFNPIKESIVSREMTRRYMTDMITYADTDVVIVGAG  102

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++
Sbjct  103  SAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGID  159



>gb|EMS66450.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Triticum urartu]
Length=348

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +2

Query  167  ARCFFCVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            AR   CV   +A +  N S+S+S  PY L++FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  22   ARTPSCVATPRAGAICN-SISSSTPPYDLNAFKFSPIKESIVSREMTRRYMTDMITYADT  80

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV++VGAGSAGLSCAYE+SK+P++ +AIIEQSVSPGGG WLG QLFSAMVVRKPA +FLD
Sbjct  81   DVVIVGAGSAGLSCAYELSKDPSISIAIIEQSVSPGGGRWLGAQLFSAMVVRKPAHLFLD  140

Query  527  ELEVE  541
            EL +E
Sbjct  141  ELNIE  145



>emb|CDY42479.1| BnaA10g08550D [Brassica napus]
Length=258

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  95

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  96   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  151



>gb|AAW66657.1| thiamine biosynthetic enzyme [Picrorhiza kurrooa]
Length=354

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 108/142 (76%), Gaps = 3/142 (2%)
 Frame = +2

Query  119  TQTIFLRCRQIIVQWNARCFFCVQAVKASSHHNLSV--SASHTPYSLDSFKFQPIKESIV  292
            T++ FL  +  I          +Q VK SS  NLSV  SA+   Y LD+  F PIKESIV
Sbjct  13   TKSSFLDTKSSIYGSPLSSRATIQRVK-SSPQNLSVTMSAATPAYDLDNLTFAPIKESIV  71

Query  293  AREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLG  472
            +REMTRRYM DMI YADTDV+VVGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLG
Sbjct  72   SREMTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLG  131

Query  473  GQLFSAMVVRKPAQVFLDELEV  538
             QLFSAMVVRKPA  FLDELE+
Sbjct  132  SQLFSAMVVRKPAPKFLDELEI  153



>ref|XP_010062976.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Eucalyptus 
grandis]
Length=357

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 5/118 (4%)
 Frame = +2

Query  203  SSHHNLSVS-----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            SS H+  +S     A+  PY L++F+F PIKESIV+REMTRRYM DMI YADTDV+VVGA
Sbjct  40   SSAHSSGISMSAAAANPPPYDLNAFRFDPIKESIVSREMTRRYMMDMITYADTDVVVVGA  99

Query  368  GSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+E
Sbjct  100  GSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEIE  157



>ref|XP_011000691.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +S+S +       SFKFQPIKESIV+REMTRRYMTDM+ YADTDV++VGAGSAGL
Sbjct  40   STSPAISMSLTQPSCDFQSFKFQPIKESIVSREMTRRYMTDMVTYADTDVVIVGAGSAGL  99

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSAM+VRKPA  FLDELE+E
Sbjct  100  SCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDELEIE  152



>ref|XP_003607681.1| Thiazole biosynthetic enzyme [Medicago truncatula]
 gb|AES89878.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=350

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++FKF PIKESIVAREMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE+SKNPNV++
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPNVKI  113

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+E
Sbjct  114  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELEIE  152



>ref|XP_009408664.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +2

Query  182  CVQAVKASSHHNLSVSA-SHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVI  355
             ++++      +LSV+A S  P Y LDSF+F+PIKES+V+REMTRRYMTDMI YADTDV+
Sbjct  36   ALRSLPGRGRPSLSVTAASAAPRYDLDSFRFEPIKESVVSREMTRRYMTDMITYADTDVV  95

Query  356  VVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELE  535
            V+GAGSAGLSCAYEISK+P+VRVAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL 
Sbjct  96   VIGAGSAGLSCAYEISKDPSVRVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELG  155

Query  536  V  538
            V
Sbjct  156  V  156



>gb|ACF85034.1| unknown [Zea mays]
Length=307

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  218  LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            +S+S+S+ PY L SF+F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE
Sbjct  1    MSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYE  60

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  61   LSKDPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  107



>ref|XP_009358110.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 6/125 (5%)
 Frame = +2

Query  185  VQAVKASSHHN--LSVSASH---TP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            +Q  KA+  +N  LSVS S    TP Y L +FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   LQPAKAAPANNGGLSVSMSANGLTPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLN  154

Query  527  ELEVE  541
            EL ++
Sbjct  155  ELGID  159



>ref|XP_001767548.1| predicted protein [Physcomitrella patens]
 sp|A9SME1.1|THI42_PHYPA RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67683.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF+PIKESIVAREMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  55   SDAKYDLNNYKFEPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  114

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            NV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+EV
Sbjct  115  NVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEV  156



>ref|XP_010448624.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010448632.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X2 [Camelina sativa]
Length=351

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  43   SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  102

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  103  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  150



>ref|XP_010443053.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=351

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  43   SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  102

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  103  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  150



>ref|XP_004504342.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=349

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +2

Query  155  VQWNARCFFCVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMII  334
            + +N      VQ  K S   +++ + S  PY L+SFKF PIKESIV+REMTRRYMTDM+ 
Sbjct  24   LSFNTTLNLGVQR-KFSVSASVAAANSPPPYDLNSFKFDPIKESIVSREMTRRYMTDMVT  82

Query  335  YADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQ  514
            +ADTDV++VGAGSAGL+CAYE+SKNPNV +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA 
Sbjct  83   HADTDVVIVGAGSAGLTCAYELSKNPNVNIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAH  142

Query  515  VFLDELEVE  541
            +FL+EL ++
Sbjct  143  LFLNELGID  151



>gb|AFK46185.1| unknown [Medicago truncatula]
Length=350

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++FKF PIKESIVAREMTRRYMTDM  +ADTDV++VGAGSAGLSCAYE+SKNPNV++
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMATHADTDVVIVGAGSAGLSCAYELSKNPNVKI  113

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+E
Sbjct  114  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELEIE  152



>ref|XP_001755171.1| predicted protein [Physcomitrella patens]
 gb|EDQ80115.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF PIKESIVAREMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  57   SDAKYDLNNYKFDPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  116

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            NV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+EV
Sbjct  117  NVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEV  158



>ref|XP_002864354.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40613.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   186 bits (471),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSGSVVSVRATTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  95

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  96   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  151



>ref|XP_008366026.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic 
[Malus domestica]
Length=378

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 6/125 (5%)
 Frame = +2

Query  185  VQAVKASSHHN--LSVSASH---TP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            +Q  KA+  +N  LSVS S    TP Y L +FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   LQLAKAAPANNGGLSVSMSANGLTPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLN  154

Query  527  ELEVE  541
            EL ++
Sbjct  155  ELGID  159



>ref|XP_011030844.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic-like 
[Populus euphratica]
Length=357

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            +Q  K+SS  N+S+S S  PY L++FKF+PIKESIV+REMTRRYM DMI +ADTDV++VG
Sbjct  39   MQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVSREMTRRYMMDMITHADTDVVIVG  98

Query  365  AGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AGSAGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL VE
Sbjct  99   AGSAGLSCAYELSKNPSVKIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVE  157



>ref|XP_009120006.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Brassica 
rapa]
Length=352

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  95

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  96   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  151



>ref|XP_008386070.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=312

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 6/125 (5%)
 Frame = +2

Query  185  VQAVKAS--SHHNLSVSAS----HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            +Q  KA+  S+  LSVS S    +  Y+L +FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   LQPAKAAPASNGGLSVSMSANGLNPSYNLSAFKFDPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLN  154

Query  527  ELEVE  541
            EL ++
Sbjct  155  ELGID  159



>gb|KJB13600.1| hypothetical protein B456_002G083700 [Gossypium raimondii]
Length=357

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 3/116 (3%)
 Frame = +2

Query  203  SSHHNLSVS---ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            SS  N S+S   AS  PY L++F+F PIKESIV+REMTRRYM DMI YADTDV+VVGAGS
Sbjct  42   SSPCNASISMSAASPPPYDLNNFRFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGS  101

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +E
Sbjct  102  AGLSCAYELSKNPSVQIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELAIE  157



>ref|XP_006845176.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
 gb|ERN06851.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
Length=355

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L  FKF+PIKESIV+REMTRRYM DMI YADTDV+VVGAGSAGLSCAYE+SKNPNVRV
Sbjct  56   YDLKDFKFEPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPNVRV  115

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V+
Sbjct  116  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVD  154



>gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum]
Length=357

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 3/116 (3%)
 Frame = +2

Query  203  SSHHNLSVS---ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            SS  N S+S   AS  PY L++F+F PIKESIV+REMTRRYM DMI YADTDV+VVGAGS
Sbjct  42   SSPCNASISMSAASPPPYDLNNFRFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGS  101

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +E
Sbjct  102  AGLSCAYELSKNPSVQIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELAIE  157



>ref|XP_010670818.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S ++S  PY L + KF PI+ESIVAREMTRRYMTDMI YADTDV+++GAGSAGLSCAY
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            E+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VE
Sbjct  106  ELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVE  154



>ref|XP_010670817.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S ++S  PY L + KF PI+ESIVAREMTRRYMTDMI YADTDV+++GAGSAGLSCAY
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            E+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VE
Sbjct  106  ELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVE  154



>ref|XP_001767495.1| predicted protein [Physcomitrella patens]
 sp|A9SMC8.1|THI44_PHYPA RecName: Full=Thiamine thiazole synthase 4, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 4; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67630.1| predicted protein [Physcomitrella patens]
Length=343

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF+PIKESIVAREMTRRYMT+MI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  42   SDAKYDLNNYKFEPIKESIVAREMTRRYMTEMITHADTDVVVVGAGSAGLSCAYELSKNP  101

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            NV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+EV
Sbjct  102  NVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEV  143



>gb|KDP39066.1| hypothetical protein JCGZ_00823 [Jatropha curcas]
Length=354

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            S+S   Y+L+SF+F PIKESIV+REMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE+SK
Sbjct  52   SSSVPQYNLNSFRFDPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSK  111

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            NP+V+VAI+EQSVSPGGGAWLGGQLFSAM+VRKPA +FLDEL++E
Sbjct  112  NPSVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDELDIE  156



>ref|XP_010670808.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S ++S  PY L + KF PI+ESIVAREMTRRYMTDMI YADTDV+++GAGSAGLSCAY
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            E+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VE
Sbjct  106  ELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVE  154



>gb|AGT17015.1| thiazole biosynthetic enzyme [Saccharum hybrid cultivar R570]
Length=355

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  152



>gb|EYU19221.1| hypothetical protein MIMGU_mgv1a009132mg [Erythranthe guttata]
Length=352

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+ F+F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SKNP+VRV
Sbjct  59   YDLNQFRFAPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPSVRV  118

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +E
Sbjct  119  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGLE  157



>gb|AGT16507.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  152



>gb|AGT16062.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  152



>gb|AGT16846.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16900.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  152



>ref|XP_009378870.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 106/125 (85%), Gaps = 6/125 (5%)
 Frame = +2

Query  185  VQAVKAS--SHHNLSVSAS----HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            +Q  KA+  S+  LSVS S    +  Y L +FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   LQPAKAAPASNGGLSVSMSSNGLNPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLN  154

Query  527  ELEVE  541
            EL ++
Sbjct  155  ELGID  159



>gb|KCW70139.1| hypothetical protein EUGRSUZ_F03433 [Eucalyptus grandis]
Length=487

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            + +A+  PY L++F+F PIKESIV+REMTRRYM DMI YADTDV+VVGAGSAGLSCAYE+
Sbjct  181  AAAANPPPYDLNAFRFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSAGLSCAYEL  240

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+E
Sbjct  241  SKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEIE  287



>gb|AGT15954.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16278.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16833.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT17116.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  152



>ref|XP_004505443.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=352

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L+SFKF PIKESIV+REMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE+SKNP+++
Sbjct  53   PYDLNSFKFNPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPSIK  112

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+E+ VE
Sbjct  113  IAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNEIGVE  152



>ref|XP_002458014.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
 sp|C5XNN6.1|THI41_SORBI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Sorghum bicolor]
 gb|EES03134.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
Length=354

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            + PY L SFKF PIKESIV+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE+SK+P 
Sbjct  50   NPPYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPT  109

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VRVAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  110  VRVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  150



>ref|XP_001753819.1| predicted protein [Physcomitrella patens]
 sp|A9RHX1.1|THI41_PHYPA RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81571.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF PIKESIVAREMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  56   SDANYDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  115

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            NV+VAI+EQSVSPGGGAWLGGQLFSAM+VRKPA  FLDE+EV
Sbjct  116  NVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDEIEV  157



>ref|XP_004957903.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=350

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  218  LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            +  S S+ PY L SFKF PIKESIV+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE
Sbjct  41   IRASISNPPYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYE  100

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +SK+P+V VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  101  LSKDPSVSVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  147



>ref|XP_001753698.1| predicted protein [Physcomitrella patens]
 ref|XP_001753700.1| predicted protein [Physcomitrella patens]
 sp|A9RHW6.1|THI43_PHYPA RecName: Full=Thiamine thiazole synthase 3, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 3; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81450.1| predicted protein [Physcomitrella patens]
 gb|EDQ81452.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF PIKESIVAREMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  56   SDANYDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  115

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            NV+VAI+EQSVSPGGGAWLGGQLFSAM+VRKPA  FLDE+EV
Sbjct  116  NVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDEIEV  157



>ref|NP_001236812.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88227.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+SAS  PY   SF+F PI+ESIV+REMTRRYM DM+ +ADTDV++VGAGSAGLSCAYE+
Sbjct  41   SMSASAPPYDFGSFRFDPIRESIVSREMTRRYMIDMVTHADTDVVIVGAGSAGLSCAYEL  100

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SKNP++ +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL VE
Sbjct  101  SKNPSINIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELNVE  147



>ref|XP_002522858.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
 gb|EEF39556.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
Length=359

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = +2

Query  239  TP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            TP Y+L+SFKF PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SKNP+
Sbjct  60   TPSYNLNSFKFDPIKESIVSREMTRRYMTDMISYADTDVVIVGAGSAGLSCAYELSKNPD  119

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+ +E
Sbjct  120  VQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEVGIE  161



>ref|XP_006401539.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
 gb|ESQ42992.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
Length=350

 Score =   183 bits (464),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 99/108 (92%), Gaps = 1/108 (1%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            +LSV A+ + Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  43   SLSVRAT-SGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  101

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  102  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  149



>ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
 gb|ABK94930.1| unknown [Populus trichocarpa]
 gb|EEE97593.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
Length=357

 Score =   183 bits (464),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            +Q  K+SS  N+S+S S  PY L++FKF+PIKESIV+REMTRRYM DMI +ADTDV++VG
Sbjct  39   MQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVSREMTRRYMMDMITHADTDVVIVG  98

Query  365  AGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AGSAGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL +E
Sbjct  99   AGSAGLSCAYELSKNPSVKIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIE  157



>ref|XP_004965741.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=351

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S + S+ PY L SF+F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAY
Sbjct  41   SISSTPSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAY  100

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            E+SK+P++ +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +
Sbjct  101  ELSKDPSISIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGI  148



>gb|AHA84206.1| thiamin biosynthetic enzyme [Phaseolus vulgaris]
Length=348

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 99/108 (92%), Gaps = 1/108 (1%)
 Frame = +2

Query  221  SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            S+SA+ +P Y L SF+FQPIKESIV+REMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE
Sbjct  42   SMSAAPSPAYDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYE  101

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            +SKNP + +AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDEL +E
Sbjct  102  LSKNPAINIAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHMFLDELGLE  149



>ref|XP_007132954.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
 gb|ESW04948.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
Length=348

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 99/108 (92%), Gaps = 1/108 (1%)
 Frame = +2

Query  221  SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            S+SA+ +P Y L SF+FQPIKESIV+REMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE
Sbjct  42   SMSAAPSPAYDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYE  101

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            +SKNP + +AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDEL +E
Sbjct  102  LSKNPAINIAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHMFLDELGLE  149



>emb|CDY47441.1| BnaC09g31160D [Brassica napus]
Length=352

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            +K  S   +SV AS   Y L++F F PIKESIV+REMTRRYMTDMI  A+TDV+VVGAGS
Sbjct  37   LKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMTRRYMTDMITSAETDVVVVGAGS  96

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  97   AGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  151



>ref|NP_001105697.1| thiamine thiazole synthase 2, chloroplastic precursor [Zea mays]
 sp|Q41739.1|THI42_MAIZE RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Zea mays]
 gb|AAA96739.1| thiamine biosynthetic enzyme [Zea mays]
Length=354

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+ + PY L SF+F PIKESIV+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE+
Sbjct  46   SISSPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  105

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SK+P V VAI+EQSVSPGGGAWLGGQLFSAMVVR+PA +FLDEL V
Sbjct  106  SKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGV  151



>dbj|BAA88225.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+SAS  PY   SF+F PI+ESIV+REMTRRYM DM+ +ADTDV++VGAGSAGLSCAYE+
Sbjct  41   SMSASAPPYDFGSFRFDPIRESIVSREMTRRYMIDMVTHADTDVVIVGAGSAGLSCAYEL  100

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SKNP++ +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +E
Sbjct  101  SKNPSINIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELNLE  147



>emb|CDY52570.1| BnaC03g71780D [Brassica napus]
Length=352

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSFSTVSVRAT-AGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  94

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  95   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  150



>emb|CDY28754.1| BnaA02g09460D [Brassica napus]
Length=349

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +2

Query  212  HNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCA  391
             +LSV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCA
Sbjct  41   RSLSVRAT-AGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCA  99

Query  392  YEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            YEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  100  YEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  148



>ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=357

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 101/119 (85%), Gaps = 6/119 (5%)
 Frame = +2

Query  203  SSHHNLSVSAS------HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            S+  N++VS S        PY L SF F PIKESIVAREMTRRYMTDMI YADTDV++VG
Sbjct  39   STPQNMAVSMSADASPPPPPYDLGSFSFNPIKESIVAREMTRRYMTDMITYADTDVVIVG  98

Query  365  AGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AGSAGLSCAYE+SKNP+V+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++
Sbjct  99   AGSAGLSCAYELSKNPDVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGID  157



>emb|CDY43024.1| BnaA03g11710D [Brassica napus]
Length=351

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSASTVSVRAT-AGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  94

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  95   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  150



>dbj|BAA88226.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A+  PY   SF+F+PI+ESIV+REMTRRYMTDM+ +ADTDV+VVGAGSAGLSCAYE+SK
Sbjct  47   AAAPPPYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTDVVVVGAGSAGLSCAYELSK  106

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            NP+V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +E
Sbjct  107  NPSVNIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGLE  151



>ref|XP_009132425.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=351

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSASTVSVRAT-AGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  94

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  95   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  150



>ref|NP_200288.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
 sp|Q38814.1|THI4_ARATH RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16153.1|AF428385_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL16285.1|AF428355_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL31936.1|AF419604_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAC97124.1| Thi1 protein [Arabidopsis thaliana]
 dbj|BAB08756.1| thiazole biosynthetic enzyme precursor (ARA6) [Arabidopsis thaliana]
 gb|AAL06876.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL24202.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAN12914.1| At5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AED96539.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
Length=349

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  212  HNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCA  391
             + SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLS A
Sbjct  40   RSFSVRATTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAA  99

Query  392  YEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            YEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  100  YEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  148



>ref|XP_010485129.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=548

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  42   SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  101

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  102  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  149


 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  240  SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  299

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  300  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  347



>gb|ABK22862.1| unknown [Picea sitchensis]
Length=335

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+SFKF+PI+ESIVAREMTRRYM DMI +ADTDV++VGAGSAGLSCAYE+SKNP+++V
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPDIKV  130

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  131  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  168



>ref|NP_001236824.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88228.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A+  PY   SF+F+PI+ESIV+REMTRRYMTDM+ +ADTDV+VVGAGSAGLSCAYE+SK
Sbjct  47   AAAPPPYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTDVVVVGAGSAGLSCAYELSK  106

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            NP+V +AI+EQS+SPGGGAWLGGQLFSAMVVRKPA +FLDEL +E
Sbjct  107  NPSVNIAIVEQSISPGGGAWLGGQLFSAMVVRKPAHLFLDELGLE  151



>ref|XP_006280726.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
 gb|EOA13624.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
Length=350

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = +2

Query  212  HNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSC  388
             ++SVS   T  Y L++F F PIKESIV+REMTRRYMTDMI +A+TDV+VVGAGSAGLSC
Sbjct  40   RSVSVSVRATAGYDLNAFTFDPIKESIVSREMTRRYMTDMITFAETDVVVVGAGSAGLSC  99

Query  389  AYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  100  AYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  149



>gb|ACF87708.1| unknown [Zea mays]
 gb|ACN36053.1| unknown [Zea mays]
 tpg|DAA58589.1| TPA: thiazole biosynthetic enzyme 1-2, Precursor [Zea mays]
Length=355

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 97/107 (91%), Gaps = 1/107 (1%)
 Frame = +2

Query  221  SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            S+S+S TP Y L SF+F PIKESIV+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE
Sbjct  46   SISSSPTPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYE  105

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +SK+P V VAI+EQSVSPGGGAWLGGQLFSAMVVR+PA +FLDEL V
Sbjct  106  LSKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGV  152



>ref|XP_002463222.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
 sp|C5X2M4.1|THI42_SORBI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Sorghum bicolor]
 gb|EER99743.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
Length=352

 Score =   181 bits (458),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            + PY L SF+F PIKES+V+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SK+P+
Sbjct  49   NPPYDLTSFRFSPIKESVVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPS  108

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  109  VSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  149



>ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
 gb|EOY12547.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
Length=358

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++F+F PIKESIV+REMTRRYM DMI +ADTDV+VVGAGSAGLSCAYE+SKNP+V+
Sbjct  59   PYDLNNFRFDPIKESIVSREMTRRYMMDMITHADTDVVVVGAGSAGLSCAYELSKNPSVQ  118

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +E
Sbjct  119  VAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIE  158



>dbj|BAC79982.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
Length=306

 Score =   179 bits (454),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  147



>ref|NP_001105696.1| thiamine thiazole synthase 1, chloroplastic precursor [Zea mays]
 sp|Q41738.1|THI41_MAIZE RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Zea mays]
 gb|AAA96738.1| thiamine biosynthetic enzyme [Zea mays]
 gb|ACF86401.1| unknown [Zea mays]
 gb|AFW83048.1| thiazole biosynthetic enzyme 1-1, Precursor [Zea mays]
Length=354

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            + PY L SF+F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SK+P 
Sbjct  54   NPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPA  113

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  114  VSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  154



>gb|AFO59577.1| thiamine biosynthetic enzyme [Saccharum hybrid cultivar GT28]
Length=355

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE+
Sbjct  47   SFSSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SK+P V +AI+EQSVSPGGGAWLGGQLFSA+VVRKPA +FLDEL V
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAVVVRKPAHLFLDELGV  152



>ref|XP_010930933.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase 1, 
chloroplastic-like [Elaeis guineensis]
Length=358

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+S +F+PIKESIV+REMTRRYMTDMI YADTDV+V+GAGSAGLSCAYE+SK+P+VRV
Sbjct  58   YDLNSIRFEPIKESIVSREMTRRYMTDMITYADTDVVVIGAGSAGLSCAYELSKDPSVRV  117

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +
Sbjct  118  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGI  155



>ref|XP_002973063.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
 gb|EFJ26284.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
Length=356

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +2

Query  218  LSVSASHTP---YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSC  388
            +S S S +P   Y L+ F F PIKES+VAREMTRRYMTDMI YADTDV++VGAGSAGLSC
Sbjct  45   ISCSNSISPSARYDLNKFSFDPIKESLVAREMTRRYMTDMITYADTDVVIVGAGSAGLSC  104

Query  389  AYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AYE+SKNPNV VA++EQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  105  AYELSKNPNVSVAVVEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEVGV  154



>gb|ABK23376.1| unknown [Picea sitchensis]
Length=368

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+SFKF+PI+ESIVAREMTRRYM DMI +ADTDV++VGAGSAGLSCAYE+SKNP+++V
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPDIKV  130

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  131  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  168



>ref|XP_009388868.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SF F+PI+ESIV+REMTRRYMTDMI YADTDV+V+GAGSAGLSCAYEISK+P+VRV
Sbjct  60   YDLGSFSFKPIQESIVSREMTRRYMTDMISYADTDVVVIGAGSAGLSCAYEISKDPSVRV  119

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  120  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  157



>gb|AFW83047.1| hypothetical protein ZEAMMB73_797739 [Zea mays]
Length=384

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            + PY L SF+F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SK+P 
Sbjct  54   NPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPA  113

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  114  VSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  154



>ref|XP_006657781.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Oryza 
brachyantha]
Length=351

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P++ 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSIS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  109  IAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  147



>ref|XP_002994429.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
 gb|EFJ04508.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
Length=356

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+ F F PIKES+VAREMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SKNPNV V
Sbjct  57   YDLNKFSFDPIKESLVAREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPNVSV  116

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            A++EQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  117  AVVEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEVGV  154



>ref|XP_009127069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=349

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +2

Query  212  HNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCA  391
             +LSV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCA
Sbjct  41   RSLSVRAT-AGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCA  99

Query  392  YEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            YEISKNPNV+VAII QSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  100  YEISKNPNVQVAIIAQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  148



>ref|NP_001059841.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAC78562.1| thiamine biosynthetic enzyme [Oryza sativa Japonica Group]
 dbj|BAF21755.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  52   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  111

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  112  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  150



>gb|AAZ93636.1| pathogen-induced defense-responsive protein 8 [Oryza sativa Indica 
Group]
Length=352

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  147



>dbj|BAC45141.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
 gb|EAZ40087.1| hypothetical protein OsJ_24530 [Oryza sativa Japonica Group]
Length=352

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  147



>pdb|1RP0|A Chain A, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
 pdb|1RP0|B Chain B, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
Length=284

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLS AYEISKNPNV+V
Sbjct  7    YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQV  66

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  67   AIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  104



>gb|AAV92535.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  143



>gb|EAZ04139.1| hypothetical protein OsI_26282 [Oryza sativa Indica Group]
Length=353

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  147



>gb|AFK48432.1| unknown [Lotus japonicus]
Length=363

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF PIKESIV+REM RRYMTDM+ +ADTDV++VGAGSAGL+CAYE+SKNPNV+V
Sbjct  63   YDLGSFKFAPIKESIVSREMARRYMTDMVTFADTDVVIVGAGSAGLTCAYELSKNPNVQV  122

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL V+
Sbjct  123  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGVD  161



>gb|KFK27084.1| hypothetical protein AALP_AA8G331900 [Arabis alpina]
Length=345

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLS AYEISKNPNV+V
Sbjct  47   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQV  106

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V
Sbjct  107  AIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGV  144



>gb|AAV92529.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92530.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92532.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92540.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92541.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92546.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  143



>gb|AAV92539.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  143



>gb|AAV92537.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  143



>gb|AAV92531.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92533.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92534.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92536.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92542.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92543.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92544.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92545.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92547.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92548.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92549.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92550.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92551.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92555.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92556.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  143



>gb|AAV92538.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  143



>gb|AFK49632.1| unknown [Lotus japonicus]
Length=355

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 104/120 (87%), Gaps = 3/120 (3%)
 Frame = +2

Query  191  AVKASSHHN---LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            ++K+++  N   +S+S +   Y L++FKF P KESIV+REMTRRYMTDMI YADTDV++V
Sbjct  35   SIKSTTQQNTTTISMSLNSPAYDLEAFKFAPTKESIVSREMTRRYMTDMITYADTDVVIV  94

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SK+P++ +AIIEQSVSPGGGAWLGGQLFSAMVVR+PA +FL+E+ V+
Sbjct  95   GAGSAGLSCAYELSKDPSISIAIIEQSVSPGGGAWLGGQLFSAMVVREPAHLFLNEIGVD  154



>gb|AAV92552.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92553.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLHSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  143



>emb|CBI23176.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +2

Query  260  FKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQ  439
            FKF+PIKESIVAREMTRRYM DMI YADTDV++VGAGSAGLSCAYE+SKNP++RVAIIEQ
Sbjct  42   FKFEPIKESIVAREMTRRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPSIRVAIIEQ  101

Query  440  SVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +E
Sbjct  102  SVSPGGGAWLGGQLFSAMVVRKPAHHFLDELGIE  135



>gb|AAV92554.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=351

 Score =   178 bits (452),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGV  143



>sp|Q38709.1|THI4_ALNGL RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Alnus 
glutinosa]
 emb|CAA66064.1| thaizole biosynthetic enzmye [Alnus glutinosa]
Length=352

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 2/120 (2%)
 Frame = +2

Query  185  VQAVKASSHHNLSVS-ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            VQ  KA +  ++S+S A   PY L +F F PIKESIV+REMTRRYM DMI YADTDV+VV
Sbjct  34   VQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVV  93

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGS+GL C YE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFS MVVRKPA +FLDEL +E
Sbjct  94   GAGSSGLVC-YELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIE  152



>ref|XP_010923945.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Elaeis 
guineensis]
Length=360

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  218  LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            +S SA+   Y L+S +F PIKESIV+REMTRRYMTDMI +ADTDV+V+GAGSAGLSCAYE
Sbjct  52   ISASAATPKYDLNSIRFDPIKESIVSREMTRRYMTDMITHADTDVVVIGAGSAGLSCAYE  111

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +SK+ +V+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V
Sbjct  112  LSKDASVQVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGV  158



>ref|XP_008809851.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Phoenix 
dactylifera]
Length=359

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 1/101 (1%)
 Frame = +2

Query  239  TP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            TP Y L+S +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+
Sbjct  57   TPKYDLNSIRFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPS  116

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            V VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL +
Sbjct  117  VNVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGI  157



>ref|XP_008803216.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=355

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+S +F PIKESIV+REMTRRYMTDMI +ADTDV+V+GAGSAGLSCAYE+SK+P+V V
Sbjct  56   YDLNSIRFNPIKESIVSREMTRRYMTDMITHADTDVVVIGAGSAGLSCAYELSKDPSVCV  115

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +
Sbjct  116  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGI  153



>gb|EMT30436.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Aegilops tauschii]
Length=348

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = +2

Query  167  ARCFFCVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            AR   CV   +A +  N S+S+S  PY L++FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  22   ARTPSCVATPRAGAICN-SISSSTPPYDLNAFKFSPIKESIVSREMTRRYMTDMITYADT  80

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV++VGAGSAGLSCAYE+SK+P++ +AIIEQSVSPGGGA LGGQLFSAMVVRKPA +FLD
Sbjct  81   DVVIVGAGSAGLSCAYELSKDPSISIAIIEQSVSPGGGAGLGGQLFSAMVVRKPAHLFLD  140

Query  527  ELEVE  541
            EL +E
Sbjct  141  ELNIE  145



>gb|KFH67165.1| thiazole biosynthetic enzyme, chloroplastic [Mortierella verticillata 
NRRL 6337]
Length=307

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++ KF PIKE+ V+REMTRRYMTDM+ +A+TDV+V+GAGSAGLSCA+E+SKNPN++V
Sbjct  31   YDLNNLKFNPIKEADVSREMTRRYMTDMLDHAETDVVVIGAGSAGLSCAWELSKNPNIQV  90

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
             +IEQSVSPGGGAWLGGQLFSAM+VRKP Q FL E+ V
Sbjct  91   TVIEQSVSPGGGAWLGGQLFSAMIVRKPGQHFLAEVGV  128



>emb|CDM85402.1| unnamed protein product [Triticum aestivum]
Length=338

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+   PY L SFKF P+KES+ +REM RRYMTDMI   +TDVI++G GSAGLSCAYE+
Sbjct  42   SISSCTPPYDLSSFKFSPMKESVASREMIRRYMTDMIADVNTDVIIIGTGSAGLSCAYEL  101

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            SK+P+V +AII++SVSPGG  WLG QLFSAMVVRKPA +FLDEL +E
Sbjct  102  SKDPSVNIAIIQRSVSPGGSGWLGSQLFSAMVVRKPAHLFLDELNIE  148



>ref|XP_005648929.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE24385.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = +2

Query  197  KASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSA  376
            +A+  H L+ + S TP+  D+FKF+PI E  V+R MT RY  D+  YA+TDVI+VGAGSA
Sbjct  7    RAADAHRLNQAFSETPF--DNFKFEPITEHQVSRAMTSRYFKDLDEYAETDVIIVGAGSA  64

Query  377  GLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            GLSCAYE+SK PNV+VAIIEQ V+PGGGAWLGGQLFSAMVVRKPA   LDELEV
Sbjct  65   GLSCAYELSKYPNVKVAIIEQGVAPGGGAWLGGQLFSAMVVRKPAHTILDELEV  118



>ref|XP_004496859.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=360

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            +K++SH+N S+S S   ++L SFKF+PI+ESIV+RE++R Y+T+M+ Y  TDV+++G  S
Sbjct  71   IKSTSHNNSSISMSLNTHNLHSFKFKPIEESIVSREISRCYITNMVTY--TDVVILGDSS  128

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            +GLSCAY +SKNPN+ +AIIEQSVSPGGGAWL GQL SAMVVRKP  +FLDE+EV+
Sbjct  129  SGLSCAYGLSKNPNIGIAIIEQSVSPGGGAWLDGQLLSAMVVRKPVDLFLDEIEVD  184



>gb|EPB86412.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 92/115 (80%), Gaps = 4/115 (3%)
 Frame = +2

Query  206  SHHNLSVSASHTPY----SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            S H L  ++ + P       D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GS
Sbjct  13   SGHRLGGASEYKPEMNYEDFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGS  72

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AGLSCA+E+SK+P++++AIIEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+
Sbjct  73   AGLSCAWELSKDPSLKIAIIEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEI  127



>dbj|GAN03507.1| thiamin biosynthetic enzyme [Mucor ambiguus]
Length=313

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 91/115 (79%), Gaps = 4/115 (3%)
 Frame = +2

Query  206  SHHNLSVSASHTPY----SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            S H L  +  + P       D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GS
Sbjct  15   SGHRLGGANEYKPEMNYEDFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGS  74

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AGLSCA+E+SK+P++++AIIEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+
Sbjct  75   AGLSCAWELSKDPSLKIAIIEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEI  129



>gb|ABK95834.1| unknown [Populus trichocarpa]
Length=278

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +2

Query  302  MTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  481
            MTRRYMTDM+ YADTDV++VGAGSAGLSCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQL  60

Query  482  FSAMVVRKPAQVFLDELEVE  541
            FSAM+VRKPA  FLDELE+E
Sbjct  61   FSAMIVRKPAHRFLDELEIE  80



>gb|EIE83081.1| thiazole biosynthetic enzyme, chloroplastic [Rhizopus delemar 
RA 99-880]
Length=305

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
             D +KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++AI
Sbjct  27   FDGYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIAI  86

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+
Sbjct  87   IEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEI  122



>gb|KDO30626.1| hypothetical protein SPRG_04526 [Saprolegnia parasitica CBS 223.65]
Length=334

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 2/104 (2%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A  TP+  D + F P+KE+ V+REMT RYM DM  YAD+DVI+ GAGSAGL  AYE+SK
Sbjct  42   NARSTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDYADSDVIIAGAGSAGLCAAYELSK  99

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
             PNVRVAIIEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+
Sbjct  100  YPNVRVAIIEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEI  143



>ref|XP_009844132.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 ref|XP_009844133.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
 gb|ETV66357.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 gb|ETV66358.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
Length=333

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 2/104 (2%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A  TP+  D + F P+KE+ V+REMT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK
Sbjct  41   AARTTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSK  98

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +PN+RVAIIEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+
Sbjct  99   HPNIRVAIIEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEI  142



>emb|CEI86767.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=189

 Score =   150 bits (378),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  248  SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVA  427
              D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++A
Sbjct  28   DFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIA  87

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IIEQ+V+PGGG WLGGQLFSAMVVRKPA  FLDEL +
Sbjct  88   IIEQNVAPGGGCWLGGQLFSAMVVRKPADKFLDELGI  124



>emb|CEI86769.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=273

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  248  SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVA  427
              D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++A
Sbjct  28   DFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIA  87

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IIEQSV+PGGG WLGGQLFSAM+VRKPA  FLDEL++
Sbjct  88   IIEQSVAPGGGCWLGGQLFSAMIVRKPADKFLDELDI  124



>emb|CEG62855.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=307

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
             D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++AI
Sbjct  29   FDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIAI  88

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IEQSV+PGGG WLGGQLFSAM+VRKPA  FLDEL++
Sbjct  89   IEQSVAPGGGCWLGGQLFSAMIVRKPADKFLDELDI  124



>emb|CEG76808.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=261

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  248  SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVA  427
              D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++A
Sbjct  28   DFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIA  87

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IIEQ+V+PGGG WLGGQLFSAM+VRKPA  FLDEL++
Sbjct  88   IIEQNVAPGGGCWLGGQLFSAMIVRKPADKFLDELDI  124



>emb|CDY41008.1| BnaA02g27980D [Brassica napus]
Length=280

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = +2

Query  302  MTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  481
            MTRRYMTDMI YA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQL  60

Query  482  FSAMVVRKPAQVFLDELEV  538
            FSAM+VRKPA +FLDE+ V
Sbjct  61   FSAMIVRKPAHLFLDEIGV  79



>ref|XP_008616182.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
 gb|EQC30329.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
Length=334

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 2/104 (2%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A  TP+  D + F P+KE+ V+REMT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK
Sbjct  42   NARSTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSK  99

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
             PN+RVAIIEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+
Sbjct  100  YPNIRVAIIEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEI  143



>ref|XP_008877253.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
 ref|XP_008877254.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94050.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94051.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
Length=333

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
             D + F P+KE+ V+REMT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK+PN+RVAI
Sbjct  47   FDGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSKHPNIRVAI  106

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+
Sbjct  107  IEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEI  142



>emb|CEP18429.1| hypothetical protein [Parasitella parasitica]
Length=309

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
             D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+ ++++AI
Sbjct  31   FDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDASLKIAI  90

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+
Sbjct  91   IEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEI  126



>emb|CDP05793.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   150 bits (379),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +2

Query  302  MTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  481
            MTRRYM DMI YADTDV++VGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPSVQVAIIEQSVSPGGGAWLGGQL  60

Query  482  FSAMVVRKPAQVFLDELEVE  541
            FSAMVVRKPA +FLDEL V+
Sbjct  61   FSAMVVRKPAHLFLDELGVD  80



>gb|EPB91714.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 4/119 (3%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTP----YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +  +S H L     + P       + +KF PI+ES V+REM  RYM DM+ YA++DV++V
Sbjct  9    LSTASGHRLGGPNEYKPDMKYEDFNGYKFAPIRESQVSREMVTRYMNDMLYYAESDVVIV  68

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            G GSA LSCA+E+SK+ ++++AIIEQSVSPGGG WLGGQLFSAMVVRKPAQ FLDEL+V
Sbjct  69   GCGSANLSCAWELSKDSSLKIAIIEQSVSPGGGCWLGGQLFSAMVVRKPAQKFLDELDV  127



>ref|XP_002784437.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER16233.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=325

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            YS +  +F PI+ES V+REMT RYM D+  +ADTDV++ GAGSAGLS AYE+SKNPNV+V
Sbjct  27   YSPEFSRFAPIRESEVSREMTTRYMKDLYDFADTDVVITGAGSAGLSAAYELSKNPNVKV  86

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            A+I+Q V+PGGGAWLGGQLFS+MVVRKPA +FL+E+ VE
Sbjct  87   ALIDQGVAPGGGAWLGGQLFSSMVVRKPAHLFLNEVGVE  125



>emb|CBI23938.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +2

Query  302  MTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  481
            MTRRYM DMI YADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPSVQVAIIEQSVSPGGGAWLGGQL  60

Query  482  FSAMVVRKPAQVFLDELEVE  541
            FS+MVVRKPA  FLDEL +E
Sbjct  61   FSSMVVRKPAHRFLDELGLE  80



>gb|EYU27823.1| hypothetical protein MIMGU_mgv1a009995mg [Erythranthe guttata]
Length=325

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (82%), Gaps = 3/98 (3%)
 Frame = +2

Query  257  SFKFQPIKESIVAREMT---RRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVA  427
            SF   P+     A  +    +RYMTDMI YADTDV+VVGAGSAGLSCAYE+SKNP++ +A
Sbjct  25   SFHGSPVSTRAAAHPIKSGPQRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDINIA  84

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            IIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+E
Sbjct  85   IIEQSVSPGGGAWLGGQLFSAMVVRKPAHKFLDELEIE  122



>ref|XP_008336996.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=160

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 93/139 (67%), Gaps = 12/139 (9%)
 Frame = +2

Query  134  LRCRQIIVQWNARCFFCVQAVKASSHHNLSVSAS----HTPYSLDSFKFQPIKESIVARE  301
            +  +    + ++   +       +S+  LSVS S    ++ Y L +FKF PIKESIV+RE
Sbjct  1    METKYQTTEADSASLYAPTKAAPASNGGLSVSTSANGLNSSYDLSAFKFDPIKESIVSRE  60

Query  302  MTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  481
            MTR YMTDMI YADT +++VGAGSAGLSCAYE+SKNP+V+VAI EQSVS GGGAWL G L
Sbjct  61   MTRHYMTDMITYADTGIVLVGAGSAGLSCAYELSKNPDVQVAITEQSVSLGGGAWLSGHL  120

Query  482  FSAM--------VVRKPAQ  514
             SAM          R+PA+
Sbjct  121  LSAMDSDPKPHTTSRRPAR  139



>ref|XP_005834399.1| putative THI4, thiamine [Guillardia theta CCMP2712]
 gb|EKX47419.1| putative THI4, thiamine [Guillardia theta CCMP2712]
Length=325

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 91/116 (78%), Gaps = 8/116 (7%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            V A +H   S     TP+  D +KF+PI+E+ V R MT RY  D+  YA++D+++VGAGS
Sbjct  27   VPAQAHQQPS-----TPF--DGYKFEPIREATVNRAMTSRYFRDLEAYAESDIVIVGAGS  79

Query  374  AGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AGLSCAYE+SK  P+V+VAIIEQ+V+PGGGAWLGGQLFSAMV+RKPA + LDELEV
Sbjct  80   AGLSCAYELSKIAPDVKVAIIEQNVAPGGGAWLGGQLFSAMVIRKPAHLLLDELEV  135



>emb|CAH25337.1| thiazole biosynthetic enzyme [Guillardia theta]
Length=328

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 91/116 (78%), Gaps = 8/116 (7%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            V A +H   S     TP+  D +KF+PI+E+ V R MT RY  D+  YA++D+++VGAGS
Sbjct  30   VPAQAHQQPS-----TPF--DGYKFEPIREATVNRAMTSRYFRDLEAYAESDIVIVGAGS  82

Query  374  AGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AGLSCAYE+SK  P+V+VAIIEQ+V+PGGGAWLGGQLFSAMV+RKPA + LDELEV
Sbjct  83   AGLSCAYELSKIAPDVKVAIIEQNVAPGGGAWLGGQLFSAMVIRKPAHLLLDELEV  138



>gb|AEO13833.1| thiazole biosynthetic protein [Camellia sinensis]
Length=132

 Score =   141 bits (355),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 81/91 (89%), Gaps = 1/91 (1%)
 Frame = +2

Query  185  VQAVKASSHH-NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +Q +K++ H+ ++S+SAS  PY L SF F+PIKESIV+REMTRRYM DMI YADTDV+VV
Sbjct  39   LQPIKSTPHNLSISMSASSPPYDLRSFTFEPIKESIVSREMTRRYMMDMITYADTDVVVV  98

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPG  454
            GAGSAGLSCAYE+SKNP+++VAIIEQSVSPG
Sbjct  99   GAGSAGLSCAYELSKNPSIQVAIIEQSVSPG  129



>gb|ABR01228.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01230.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01236.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
Length=340

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +2

Query  239  TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNV  418
            TP+  D FKF+ I+ES ++R MT RY  D+  +A+ DV++VGAGSAGLSCAYE+SK P++
Sbjct  46   TPF--DGFKFESIRESQISRAMTSRYFQDLHDHAEVDVVIVGAGSAGLSCAYELSKYPDI  103

Query  419  RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            RVAIIEQ V+PGGGAWLGGQLFSAM +RKPA   LDELEV
Sbjct  104  RVAIIEQGVAPGGGAWLGGQLFSAMCIRKPAHKLLDELEV  143



>ref|XP_005847930.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
 gb|EFN55828.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
Length=300

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +2

Query  239  TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNV  418
            TP+  D FKF+ I+ES ++R MT+RY  D+  +A+ DV++VGAGSAGLSCAYE+SK P++
Sbjct  3    TPF--DGFKFESIRESQISRAMTQRYFQDLHDHAEVDVVIVGAGSAGLSCAYELSKYPDL  60

Query  419  RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            RVAIIEQ V+PGGGAWLGGQLFSAM +RKPA   +DELEV
Sbjct  61   RVAIIEQGVAPGGGAWLGGQLFSAMCIRKPAHKLMDELEV  100



>ref|XP_006441062.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
 gb|ESR54302.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
Length=353

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 8/97 (8%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
            LD+FKF  IKESIV+RE TRRYMTDMI +ADTDV+VVGAGSAGLSCAYEISKNPNV+VAI
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTDVVVVGAGSAGLSCAYEISKNPNVQVAI  135

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            IEQSVSPGG         S  VVRKPA +FLDEL ++
Sbjct  136  IEQSVSPGGA--------SGSVVRKPAHLFLDELGID  164



>gb|KDO47270.1| hypothetical protein CISIN_1g039605mg [Citrus sinensis]
Length=352

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 80/97 (82%), Gaps = 8/97 (8%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
            LD+FKF  IKESIV+RE TRRYMTDMI +ADTDV+VVGAGSAGLSCAYEISKNPNV+VAI
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTDVVVVGAGSAGLSCAYEISKNPNVQVAI  135

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            IEQSVSPGG         S  VVRKPA +FLDEL ++
Sbjct  136  IEQSVSPGGA--------SGSVVRKPAHLFLDELGID  164



>ref|XP_007376158.1| hypothetical protein SPAPADRAFT_51398 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW31380.1| hypothetical protein SPAPADRAFT_51398 [Spathaspora passalidarum 
NRRL Y-27907]
Length=353

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  Y ++DV++VGAGSAGLS AY ++KN P++++AI
Sbjct  44   DKFKFAPIRESTVSRAMTRRYFADLDKYTESDVVIVGAGSAGLSAAYVLAKNRPDLKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDEL++
Sbjct  104  IEASVSPGGGCWLGGQLFSAMVLRKPANIFLDELDI  139



>ref|XP_001386426.1| hypothetical protein PICST_50942 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN68397.1| predicted protein [Scheffersomyces stipitis CBS 6054]
Length=351

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            ++FKF PI+ES V+R MT+RY  D+  Y ++DV++VGAGSAGLS AY ++KN PN+++AI
Sbjct  43   ENFKFAPIRESTVSRAMTKRYFADLDKYTESDVVIVGAGSAGLSAAYVLAKNRPNLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDELE++
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDELEIQ  139



>gb|KIY92671.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=351

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 3/101 (3%)
 Frame = +2

Query  239  TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPN  415
            TP+  D ++F PI+E+ V+R MT RY  D+  YA+ DVI+ GAGSAGL+CAYE+SK  P+
Sbjct  54   TPF--DDYRFAPIREATVSRAMTSRYFKDLDSYAEADVIIAGAGSAGLACAYELSKLAPD  111

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
             R+AIIEQ+VSPGGGAWLGGQLFSAMV+RKP Q  LDEL V
Sbjct  112  ARIAIIEQNVSPGGGAWLGGQLFSAMVIRKPGQAILDELAV  152



>emb|CAA57779.1| nmt2 [Schizosaccharomyces pombe]
Length=301

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = +2

Query  221  SVSASHTPYSLD-SFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            ++S ++  YSLD SF F PI+ES V+R MTRRY +D+  YA++D+++VGAGSAGL+ AY 
Sbjct  35   ALSKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYY  94

Query  398  I-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            I ++ P++++AIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+ V
Sbjct  95   IGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGV  142



>ref|NP_596642.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 sp|P40998.2|THI4_SCHPO RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 emb|CAA21093.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe]
Length=328

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = +2

Query  221  SVSASHTPYSLD-SFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            ++S ++  YSLD SF F PI+ES V+R MTRRY +D+  YA++D+++VGAGSAGL+ AY 
Sbjct  35   ALSKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYY  94

Query  398  I-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            I ++ P++++AIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+ V
Sbjct  95   IGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGV  142



>ref|XP_004198891.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
 emb|CCE82554.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
Length=322

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +2

Query  179  FCVQAVKASSHHNLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTD  349
            F ++  K +   NL+ + S+   S    D FKF PI+ES V+R MT+RY  D+  YA++D
Sbjct  15   FSLKGSKEAKVVNLTSNKSNAEVSFADWDKFKFAPIRESTVSRAMTKRYFADLDKYAESD  74

Query  350  VIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            V+++GAGSAGLS AY ++KN P +++AIIE SVSPGGG WLGGQLFSAMV+RKPA +F+ 
Sbjct  75   VVIIGAGSAGLSAAYVLAKNRPELKIAIIEASVSPGGGCWLGGQLFSAMVLRKPADLFIQ  134

Query  527  ELEVE  541
            EL ++
Sbjct  135  ELGID  139



>ref|XP_007591792.1| thiazole biosynthetic enzyme [Colletotrichum fioriniae PJ7]
 gb|EXF84591.1| thiazole biosynthetic enzyme [Colletotrichum fioriniae PJ7]
Length=326

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            DSFKF PI+ES V+R MTRRY +D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  47   DSFKFAPIRESQVSRAMTRRYFSDLDTYAESDVVIVGAGSCGLSTAYVLAKTRPDLKIAI  106

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E  V+PGGGAWLGGQLFSAMV+RKPAQVFLDE+ V
Sbjct  107  VEAGVAPGGGAWLGGQLFSAMVMRKPAQVFLDEVGV  142



>gb|KIY99977.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=359

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVA  427
             D ++F PI+E+ V+R MT RY  D+  YA+ DV++ GAGSAGL+CAYE+SK  P+ ++A
Sbjct  65   FDDYRFAPIREATVSRAMTSRYFKDLDTYAEADVVIAGAGSAGLACAYELSKLAPDAKIA  124

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IIEQ+VSPGGGAWLGGQLFSAMV+RKP Q  LDEL V
Sbjct  125  IIEQNVSPGGGAWLGGQLFSAMVIRKPGQAILDELAV  161



>ref|XP_002951140.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
 gb|EFJ47669.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
Length=359

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 89/117 (76%), Gaps = 3/117 (3%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A  AS      +  + TPY  D++ F  I+E+ V R MTRRY  DM  +A++DV++VGAG
Sbjct  43   AADASMLARAGLPPTTTPY--DNYVFASIREAEVNRAMTRRYFKDMDEFAESDVVIVGAG  100

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SAGL+CAYE+ K  P+++VA++EQSV+PGGGAWLGGQLFSAMVVRKPA + LDELEV
Sbjct  101  SAGLACAYELGKVAPHLKVALLEQSVAPGGGAWLGGQLFSAMVVRKPAHLMLDELEV  157



>ref|XP_002951138.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
 gb|EFJ47667.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
Length=355

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 89/117 (76%), Gaps = 3/117 (3%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A  AS      +  + TPY  D++ F  I+E+ V R MTRRY  DM  +A++DV++VGAG
Sbjct  42   AADASMLARAGLPPTTTPY--DNYVFASIREAEVNRAMTRRYFKDMDEFAESDVVIVGAG  99

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            SAGL+CAYE+ K  P+++VA++EQSV+PGGGAWLGGQLFSAMVVRKPA + LDELEV
Sbjct  100  SAGLACAYELGKVAPHLKVALLEQSVAPGGGAWLGGQLFSAMVVRKPAHLMLDELEV  156



>ref|XP_004199741.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
 emb|CCE81622.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
Length=322

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +2

Query  179  FCVQAVKASSHHNLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTD  349
            F ++    +   NL+ + S+   S    D FKF PI+ES V+R MT+RY  D+  YA++D
Sbjct  15   FSLKGSNGAKAVNLTSNKSNAEVSFADWDKFKFAPIRESTVSRAMTKRYFADLDKYAESD  74

Query  350  VIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            V+++GAGSAGLS AY ++KN P +++AIIE SVSPGGG WLGGQLFSAMV+RKPA +F+ 
Sbjct  75   VVIIGAGSAGLSAAYVLAKNRPELKIAIIEASVSPGGGCWLGGQLFSAMVLRKPADLFIQ  134

Query  527  ELEVE  541
            EL ++
Sbjct  135  ELGID  139



>gb|EMG50374.1| hypothetical protein G210_4595 [Candida maltosa Xu316]
Length=329

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            ++FKF PI+ES VAREM RRY  D+  YA++DV+V+G GSAG S AY ++KN P++++AI
Sbjct  42   ENFKFAPIRESQVAREMGRRYFQDLDKYAESDVVVIGGGSAGFSAAYTLAKNRPDLKIAI  101

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD+L +E
Sbjct  102  IEASVSPGGGCWLGGQLFSAMVLRKPADLFLDDLGLE  138



>ref|XP_001483482.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=332

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D F F PI+ES V+R MT+RY  D+  YA++DV++VGAGSAGLS AY ++KN P +++AI
Sbjct  44   DKFHFAPIRESAVSRAMTKRYFADLDKYAESDVVIVGAGSAGLSAAYVLAKNRPELKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDEL +
Sbjct  104  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDELNI  139



>gb|EDK40113.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=332

 Score =   138 bits (348),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D F F PI+ES V+R MT+RY  D+  YA++DV++VGAGSAGLS AY ++KN P +++AI
Sbjct  44   DKFHFAPIRESAVSRAMTKRYFADLDKYAESDVVIVGAGSAGLSAAYVLAKNRPELKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDEL +
Sbjct  104  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDELNI  139



>gb|KHC63824.1| thiazole biosynthesis enzyme [Candida albicans P75010]
Length=354

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            + FKF PI+ESIV+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESIVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLD  139



>ref|XP_001698672.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
 sp|A8J9T5.1|THI4_CHLRE RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|EDO99354.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
Length=357

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +2

Query  239  TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPN  415
            TPY  D +KF PI+E+ V R MTRRY  DM  +A++DV++VGAGSAGL+CA+E+ +  P+
Sbjct  59   TPY--DDYKFAPIREAEVNRAMTRRYFKDMDEFAESDVVIVGAGSAGLACAFELGRIAPH  116

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            ++VA++EQSV+PGGGAWLGGQLFSAMVVRKPA   LD L+V
Sbjct  117  LKVALMEQSVAPGGGAWLGGQLFSAMVVRKPAHEMLDALQV  157



>ref|XP_007913237.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
 gb|EOO01967.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
Length=326

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+F F PI+ES V+R MTRRY +D+  YA++D++++GAGS GLS AY + K  P++++AI
Sbjct  45   DTFTFNPIRESQVSRAMTRRYFSDLDTYAESDIVIIGAGSCGLSAAYTLGKARPDLKIAI  104

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE  VSPGGGAWLGGQLFSAMV+RKPA+VFLD++ V
Sbjct  105  IEAGVSPGGGAWLGGQLFSAMVMRKPAEVFLDDIGV  140



>gb|KDN61355.1| putative Thi4 family protein [Colletotrichum sublineola]
Length=342

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 91/124 (73%), Gaps = 8/124 (6%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSL-------DSFKFQPIKESIVAREMTRRYMTDMIIYADTD  349
            A K +   +  V+A+ TP  +       DSF F PI+ES V+R MTRRY  D+  YA++D
Sbjct  19   AGKTTKPADGHVAAAGTPAKVEDFFGKWDSFTFSPIRESQVSRAMTRRYFADLDAYAESD  78

Query  350  VIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            +++VGAGS GLS AY ++K  P++R+AI+E  V+PGGGAWLGGQLFSAMV+RKPA+VFLD
Sbjct  79   IVIVGAGSCGLSAAYVLAKARPDLRIAIVEAGVAPGGGAWLGGQLFSAMVMRKPAEVFLD  138

Query  527  ELEV  538
            E+ V
Sbjct  139  EVGV  142



>gb|KIW79545.1| thiamine thiazole synthase [Fonsecaea pedrosoi CBS 271.37]
Length=329

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 89/117 (76%), Gaps = 3/117 (3%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A+KA+  HN  +      +  D+FKF PI+ES V+R MTRRY  D+  YA++DV++VGAG
Sbjct  31   ALKAAGEHNNLLEQFGDKW--DAFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAG  88

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            S GLS AY ++K  P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V
Sbjct  89   SCGLSTAYTLAKARPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIGV  145



>gb|EFW21941.1| thiazole biosynthetic enzyme [Coccidioides posadasii str. Silveira]
Length=328

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE +VSPGGGAWLGGQLFSAMV+RKPA  FLDE+ V
Sbjct  106  IEAAVSPGGGAWLGGQLFSAMVLRKPADKFLDEIGV  141



>ref|XP_003066032.1| thiazole biosynthetic enzyme, mitochondrial precursor, putative 
[Coccidioides posadasii C735 delta SOWgp]
 gb|EER23887.1| thiazole biosynthetic enzyme, mitochondrial precursor, putative 
[Coccidioides posadasii C735 delta SOWgp]
Length=328

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE +VSPGGGAWLGGQLFSAMV+RKPA  FLDE+ V
Sbjct  106  IEAAVSPGGGAWLGGQLFSAMVLRKPADKFLDEIGV  141



>ref|XP_001247344.1| thiazole biosynthetic enzyme, mitochondrial precursor [Coccidioides 
immitis RS]
 gb|KJF60209.1| thiamine thiazole synthase [Coccidioides immitis RS]
 gb|KJF60210.1| thiamine thiazole synthase, variant [Coccidioides immitis RS]
Length=328

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE +VSPGGGAWLGGQLFSAMV+RKPA  FLDE+ V
Sbjct  106  IEAAVSPGGGAWLGGQLFSAMVLRKPADKFLDEIGV  141



>gb|EQB43457.1| hypothetical protein CGLO_17887 [Colletotrichum gloeosporioides 
Cg-14]
Length=325

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+F F PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DTFTFAPIRESQVSRAMTRRYFADLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E  VSPGGGAWLGGQLFSAMV+RKPA VFLDEL V
Sbjct  106  VEAGVSPGGGAWLGGQLFSAMVMRKPADVFLDELGV  141



>gb|AAF25444.1|AF217503_1 putative thiazole synthase [Aspergillus oryzae]
 gb|ADM43597.1| ThiA protein [Cloning vector pSK485]
 gb|EIT72848.1| protein involved in thiamine biosynthesis and DNA damage tolerance 
[Aspergillus oryzae 3.042]
 gb|KDE83469.1| hypothetical protein AO1008_10087 [Aspergillus oryzae 100-8]
Length=327

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DEFKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E SVSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V
Sbjct  106  VEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGV  141



>ref|XP_001819323.1| thiazole biosynthetic enzyme [Aspergillus oryzae RIB40]
 sp|Q9UUZ9.2|THI4_ASPOR RecName: Full=Thiamine thiazole synthase; AltName: Full=Pyrithiamine 
resistance protein; AltName: Full=Thiazole biosynthetic 
enzyme [Aspergillus oryzae RIB40]
 dbj|BAE57321.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=327

 Score =   135 bits (341),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DEFKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E SVSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V
Sbjct  106  VEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGV  141



>ref|XP_002375225.1| thiazole biosynthesis enzyme Sti35 [Aspergillus flavus NRRL3357]
 gb|EED56443.1| thiazole biosynthesis enzyme Sti35 [Aspergillus flavus NRRL3357]
Length=327

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DEFKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E SVSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V
Sbjct  106  VEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGV  141



>gb|EYE95075.1| Thi4 family thiamine biosynthetic enzyme [Aspergillus ruber CBS 
135680]
Length=334

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA+TD+++VGAGS GLS AY ++K  P++++AI
Sbjct  49   DEFKFAPIRESQVSRAMTRRYFQDLDKYAETDILIVGAGSCGLSTAYVLAKARPDLKIAI  108

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E SVSPGGGAWLGGQLFSAMV+R+PA +FL+EL V
Sbjct  109  VEASVSPGGGAWLGGQLFSAMVMRRPANIFLEELGV  144



>gb|AAL86771.2| THI4 enzyme [Candida albicans]
Length=354

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 4/113 (4%)
 Frame = +2

Query  215  NLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            NL   A +   S    + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS
Sbjct  27   NLKSDAKNGKVSFADWNEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLS  86

Query  386  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
             AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++
Sbjct  87   AAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLD  139



>ref|XP_009853231.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO55392.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ69381.1| CyPBP37 protein [Neurospora tetrasperma FGSC 2509]
Length=344

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 78/96 (81%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+F F PI+ES V+R MTRRY  D+  +A+TD+++VGAGS GLSCAY +S   P++R+ I
Sbjct  50   DAFTFSPIRESTVSRAMTRRYFADLDAHAETDIVIVGAGSCGLSCAYVLSTLRPDLRITI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E  V+PGGGAWLGGQLFSAMV+RKPA VFLDE+ V
Sbjct  110  VEAGVAPGGGAWLGGQLFSAMVMRKPADVFLDEVGV  145



>emb|CCK70574.1| hypothetical protein KNAG_0E03150 [Kazachstania naganishii CBS 
8797]
Length=324

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 91/120 (76%), Gaps = 3/120 (3%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            +Q    + HH+LS       +S   F+F PI+ES V+R MTRRY  DM  +A +DV+++G
Sbjct  13   LQLNAGTIHHSLSDVVKTEDWS--DFEFTPIRESTVSRAMTRRYFQDMDKFAVSDVVIIG  70

Query  365  AGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AGS+GLS AY I+KN P++++AIIE +V+PGGGAWLGGQLFSAM++RKPA +FL++L ++
Sbjct  71   AGSSGLSAAYVIAKNRPDLKIAIIESNVAPGGGAWLGGQLFSAMIMRKPAHLFLNDLGIQ  130



>ref|XP_723197.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 ref|XP_723050.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 sp|Q5ANB7.1|THI4_CANAL RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Candida albicans SC5314]
 gb|EAL04334.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 gb|EAL04489.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 gb|KGQ92431.1| thiazole biosynthesis enzyme [Candida albicans P37005]
 gb|KGQ98336.1| thiazole biosynthesis enzyme [Candida albicans GC75]
 gb|KGR12895.1| thiazole biosynthesis enzyme [Candida albicans P78048]
 gb|KGR17623.1| thiazole biosynthesis enzyme [Candida albicans P37037]
 gb|KGT69944.1| thiazole biosynthesis enzyme [Candida albicans 12C]
 gb|KGU10362.1| thiazole biosynthesis enzyme [Candida albicans P87]
 gb|KGU10939.1| thiazole biosynthesis enzyme [Candida albicans 19F]
 gb|KGU11477.1| thiazole biosynthesis enzyme [Candida albicans L26]
 gb|KGU27365.1| thiazole biosynthesis enzyme [Candida albicans P34048]
 gb|KGU30750.1| thiazole biosynthesis enzyme [Candida albicans P57055]
 gb|KGU31334.1| thiazole biosynthesis enzyme [Candida albicans P75063]
 gb|KHC42654.1| thiazole biosynthesis enzyme [Candida albicans Ca6]
 gb|KHC52341.1| thiazole biosynthesis enzyme [Candida albicans P60002]
 gb|KHC55715.1| thiazole biosynthesis enzyme [Candida albicans P37039]
 gb|KHC70243.1| thiazole biosynthesis enzyme [Candida albicans P75016]
 gb|KHC78685.1| thiazole biosynthesis enzyme [Candida albicans P78042]
 gb|KHC79055.1| thiazole biosynthesis enzyme [Candida albicans SC5314]
 gb|KHC87279.1| thiazole biosynthesis enzyme [Candida albicans SC5314]
Length=354

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 4/113 (4%)
 Frame = +2

Query  215  NLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            NL   A +   S    + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS
Sbjct  27   NLKSDAKNGKVSFADWNEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLS  86

Query  386  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
             AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++
Sbjct  87   AAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLD  139



>gb|KGQ88127.1| thiazole biosynthesis enzyme [Candida albicans P94015]
Length=354

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 4/113 (4%)
 Frame = +2

Query  215  NLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            NL   A +   S    + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS
Sbjct  27   NLKSDAKNGKVSFADWNEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLS  86

Query  386  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
             AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++
Sbjct  87   AAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLD  139



>ref|XP_002419419.1| thiamine biosynthesis enzyme, putative; thiazole biosynthetic 
enzyme, putative [Candida dubliniensis CD36]
 emb|CAX43013.1| thiamine biosynthesis enzyme, putative [Candida dubliniensis 
CD36]
Length=354

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 4/113 (4%)
 Frame = +2

Query  215  NLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            NL   A +   S    D FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS
Sbjct  27   NLKSDAKNGKVSFANWDEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLS  86

Query  386  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
             AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA +FL+++ ++
Sbjct  87   AAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAHLFLNDMGLD  139



>gb|KHC37210.1| thiazole biosynthesis enzyme [Candida albicans P76067]
Length=354

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 4/113 (4%)
 Frame = +2

Query  215  NLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            NL   A +   S    + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS
Sbjct  27   NLKSDAKNGKVSFADWNEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLS  86

Query  386  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
             AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++
Sbjct  87   AAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLD  139



>gb|KGR10168.1| thiazole biosynthesis enzyme [Candida albicans P57072]
 gb|KHC36840.1| thiazole biosynthesis enzyme [Candida albicans P76055]
Length=354

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLD  139



>gb|KIW92677.1| thiamine thiazole synthase [Cladophialophora bantiana CBS 173.52]
Length=331

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A+ A++ H+ +          D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAG
Sbjct  31   ALTAANEHDNNSLLEQFGGKWDGFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAG  90

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            S GLS AY ++K  P++++A+IE SVSPGGG WLGGQLFSAMV+RKPA+ FL++++V
Sbjct  91   SCGLSTAYTLAKARPDLKIAVIEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIDV  147



>sp|C4YNP4.1|THI4_CANAW RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Candida albicans WO-1]
 gb|EEQ44553.1| hypothetical protein CAWG_02825 [Candida albicans WO-1]
Length=354

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 4/113 (4%)
 Frame = +2

Query  215  NLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            NL   A +   S    + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS
Sbjct  27   NLKSDAKNGKVSFADWNEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLS  86

Query  386  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
             AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++
Sbjct  87   AAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLD  139



>ref|XP_002548228.1| hypothetical protein CTRG_02525 [Candida tropicalis MYA-3404]
 gb|EER33707.1| hypothetical protein CTRG_02525 [Candida tropicalis MYA-3404]
Length=329

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = +2

Query  188  QAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            Q VK +S    +V   H+    + F F PI+ES VAR M +RY  D+  YA++D++VVG 
Sbjct  23   QTVKLTSE---AVDGKHSFADWEKFNFAPIRESQVARAMGKRYFADLDKYAESDIVVVGG  79

Query  368  GSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GSAG S AY ++KN P++++AIIE SVSPGGG WLGGQLFSAMVVRKP  +FLD+L +E
Sbjct  80   GSAGFSAAYVMAKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVVRKPGDLFLDDLGLE  138



>ref|XP_001394167.1| thiazole biosynthetic enzyme [Aspergillus niger CBS 513.88]
 ref|XP_003188811.1| thiazole biosynthetic enzyme [Aspergillus niger CBS 513.88]
 emb|CAK45897.1| unnamed protein product [Aspergillus niger]
 gb|EHA19391.1| hypothetical protein ASPNIDRAFT_199098 [Aspergillus niger ATCC 
1015]
Length=331

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NP  412
            H     D+FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY ++K  P
Sbjct  40   HFAGKWDNFKFAPIRESQVSRAMTRRYFQDLDKYAESDIVIVGAGSCGLSTAYVLAKARP  99

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            ++++AIIE +VSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V
Sbjct  100  DLKIAIIEANVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGV  141



>gb|AGO09853.1| AaceriAAL137Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=321

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            +S+ H LS       +S   F+F PI+E+ V+R MT RY  D+  YA +DV++VGAGS+G
Sbjct  16   SSTRHALSDVVREKDWS--DFEFTPIREATVSRAMTTRYFDDLYKYAVSDVVIVGAGSSG  73

Query  380  LSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            LS AY I+KN P++R+AI+E +V+PGGGAWLGGQLFSAM++RKP  +FLDELE+
Sbjct  74   LSAAYVIAKNRPDLRIAIVEANVAPGGGAWLGGQLFSAMIMRKPTHLFLDELEI  127



>ref|XP_661532.1| THI4_ASPOR Thiazole biosynthetic enzyme, mitochondrial precursor 
[Aspergillus nidulans FGSC A4]
 sp|G5EAZ2.1|THI4_EMENI RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Aspergillus nidulans FGSC A4]
 dbj|BAD04053.1| putative thiazole synthase [Aspergillus nidulans]
 gb|EAA59237.1| THI4_ASPOR Thiazole biosynthetic enzyme, mitochondrial precursor 
[Aspergillus nidulans FGSC A4]
 tpe|CBF75074.1| TPA: Putative thiazole synthaseTHI4_ASPOR Thiazole biosynthetic 
enzyme, mitochondrial ; [Source:UniProtKB/TrEMBL;Acc:Q76B84] 
[Aspergillus nidulans FGSC A4]
Length=331

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DNFKFAPIRESQVSRAMTRRYFQDLDRYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGGAWLGGQLFSAMV+R+PA++FL+EL V
Sbjct  106  IEASVSPGGGAWLGGQLFSAMVMRRPAELFLNELGV  141



>ref|XP_007835960.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1]
 gb|ETS79335.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1]
Length=326

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = +2

Query  209  HHNLSVSASHTPYS-LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            H N+ V+      S  + F FQPI+ES +AREM RRY  D+  YA++D++++GAGS GLS
Sbjct  29   HSNMEVATGAAVGSKWEDFTFQPIRESQIAREMARRYFADLDKYAESDIVIIGAGSCGLS  88

Query  386  CAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
             AY ++K  P++++AIIE SVSPGGGAWLGGQLFSAM++RKPA  FL+E+ V
Sbjct  89   TAYTLAKARPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLEEIGV  140



>ref|XP_461084.2| DEHA2F16654p [Debaryomyces hansenii CBS767]
 emb|CAG89466.2| DEHA2F16654p [Debaryomyces hansenii CBS767]
Length=321

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MT RY  D+  YA++DV+++GAGSAGLS AY ++KN P +++AI
Sbjct  42   DKFKFTPIRESTVSRAMTSRYFADLDKYAESDVVIIGAGSAGLSAAYILAKNRPELKIAI  101

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            IE  VSPGGG WLGGQLFSAM++RKPA +FL+EL +E
Sbjct  102  IEAGVSPGGGCWLGGQLFSAMILRKPAHLFLEELGLE  138



>ref|XP_750725.1| thiazole biosynthesis enzyme [Aspergillus fumigatus Af293]
 sp|Q4WMX7.1|THI4_ASPFU RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Aspergillus fumigatus Af293]
 gb|EAL88687.1| thiazole biosynthesis enzyme [Aspergillus fumigatus Af293]
 gb|EDP49405.1| thiazole biosynthesis enzyme [Aspergillus fumigatus A1163]
Length=332

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  47   DDFKFAPIRESQVSRAMTRRYFQDLDKYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  106

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGGAWLGGQLFSAMV+R+PA+VFL+E+ V
Sbjct  107  IEASVSPGGGAWLGGQLFSAMVLRRPAEVFLNEIGV  142



>ref|XP_002479053.1| thiazole biosynthesis enzyme [Talaromyces stipitatus ATCC 10500]
 gb|EED22090.1| thiazole biosynthesis enzyme [Talaromyces stipitatus ATCC 10500]
Length=333

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  49   DSFKFAPIRESQVSRAMTRRYFNDLDKYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  108

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E +VSPGGGAWLGGQLFSAMV+RKPA VFL++L V
Sbjct  109  VEANVSPGGGAWLGGQLFSAMVMRKPADVFLNDLGV  144



>gb|KEY78369.1| thiazole biosynthesis enzyme [Aspergillus fumigatus var. RP-2014]
Length=332

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  47   DDFKFAPIRESQVSRAMTRRYFQDLDKYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  106

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGGAWLGGQLFSAMV+R+PA+VFL+E+ V
Sbjct  107  IEASVSPGGGAWLGGQLFSAMVLRRPAEVFLNEIGV  142



>gb|KFX46359.1| Thiamine thiazole synthase [Talaromyces marneffei PM1]
 gb|KFX46360.1| Thiamine thiazole synthase [Talaromyces marneffei PM1]
Length=320

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  50   DNFKFAPIRESQVSRAMTRRYFNDLDKYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE +VSPGGGAWLGGQLFSAM++RKPA+VFL++L V
Sbjct  110  IEANVSPGGGAWLGGQLFSAMIMRKPAEVFLNDLGV  145



>ref|XP_007794010.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
 gb|EMR66906.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
Length=326

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 86/119 (72%), Gaps = 5/119 (4%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            +    A+   NL+V  S      + F F+PI+ES VAR M RRY TD+  YA++D+++VG
Sbjct  27   IHQANANGGKNLAVGDSK----WEEFSFEPIRESQVARAMVRRYFTDLDTYAESDIVIVG  82

Query  365  AGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AGS GLS AY ++K  P++++AIIE SVSPGGGAWLGGQLFSAM++RKPA  FL EL V
Sbjct  83   AGSCGLSTAYTLAKARPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADKFLTELGV  141



>ref|XP_007745751.1| thiazole biosynthetic enzyme, mitochondrial [Cladophialophora 
psammophila CBS 110553]
 gb|EXJ69899.1| thiazole biosynthetic enzyme, mitochondrial [Cladophialophora 
psammophila CBS 110553]
Length=331

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            V    A+ H+N S+    +    D FKF PI+ES V+R MTRRY  D+  YA++DV++VG
Sbjct  30   VALTAANEHYNNSLLEQFSG-KWDGFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVG  88

Query  365  AGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AGS GLS AY ++K  P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V
Sbjct  89   AGSCGLSTAYTLAKARPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIGV  147



>ref|XP_002146762.1| thiazole biosynthesis enzyme [Talaromyces marneffei ATCC 18224]
 ref|XP_002146763.1| thiazole biosynthesis enzyme [Talaromyces marneffei ATCC 18224]
 gb|EEA26215.1| thiazole biosynthesis enzyme [Talaromyces marneffei ATCC 18224]
 gb|EEA26216.1| thiazole biosynthesis enzyme [Talaromyces marneffei ATCC 18224]
 gb|KFX44083.1| Thiamine thiazole synthase [Talaromyces marneffei PM1]
 gb|KFX44084.1| Thiamine thiazole synthase [Talaromyces marneffei PM1]
Length=334

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  50   DNFKFAPIRESQVSRAMTRRYFNDLDKYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE +VSPGGGAWLGGQLFSAM++RKPA+VFL++L V
Sbjct  110  IEANVSPGGGAWLGGQLFSAMIMRKPAEVFLNDLGV  145



>ref|XP_006666857.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
 gb|EGX96980.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
Length=330

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 92/131 (70%), Gaps = 10/131 (8%)
 Frame = +2

Query  176  FFCVQAVKASSHHN-LSVSASHTPY--------SLDSFKFQPIKESIVAREMTRRYMTDM  328
            +  V   KA+S HN ++V A+ +            DSFKF PI+ES V+R MTRRY  D+
Sbjct  12   YAAVPVTKAASGHNAVAVPAADSTRLAIDDMLGQWDSFKFAPIRESQVSRAMTRRYFEDL  71

Query  329  IIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRK  505
              YA++D++++GAGS GLS AY + K  P++++AIIE SVSPGGGAWLGGQLFSAM++RK
Sbjct  72   DTYAESDIVIIGAGSCGLSAAYVLGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRK  131

Query  506  PAQVFLDELEV  538
            PA  FL E+ V
Sbjct  132  PADAFLREVGV  142



>ref|XP_001257952.1| thiazole biosynthesis enzyme [Neosartorya fischeri NRRL 181]
 gb|EAW16055.1| thiazole biosynthesis enzyme [Neosartorya fischeri NRRL 181]
Length=332

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 81/96 (84%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  47   DDFKFAPIRESQVSRAMTRRYFQDLDKYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  106

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGGAWLGGQLFSAMV+R+PA+VFL+E+ V
Sbjct  107  IEASVSPGGGAWLGGQLFSAMVLRRPAEVFLNEVGV  142



>dbj|GAA84055.1| thiazole biosynthesis enzyme [Aspergillus kawachii IFO 4308]
Length=331

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NP  412
            H     D+FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY ++K  P
Sbjct  40   HFAGKWDNFKFAPIRESQVSRAMTRRYFQDLDKYAESDIVIVGAGSCGLSTAYVLAKARP  99

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            ++++AI+E +VSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V
Sbjct  100  DLKIAIVEANVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGV  141



>dbj|GAM35876.1| thiazole biosynthetic enzyme [Talaromyces cellulolyticus]
Length=334

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  50   DSFKFAPIRESQVSRAMTRRYFNDLDKYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E +VSPGGGAWLGGQLFSAM++RKPA VFL++L V
Sbjct  110  VEANVSPGGGAWLGGQLFSAMIMRKPADVFLNDLGV  145



>ref|XP_001214996.1| hypothetical protein ATEG_05818 [Aspergillus terreus NIH2624]
 gb|EAU33579.1| hypothetical protein ATEG_05818 [Aspergillus terreus NIH2624]
Length=333

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NP  412
            H     D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++   P
Sbjct  42   HFGNKWDDFKFAPIRESQVSRAMTRRYFQDLDKYAESDVVIVGAGSCGLSTAYVLANARP  101

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            ++++AIIE SVSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V
Sbjct  102  DLKIAIIEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGV  143



>ref|XP_003044703.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 sp|C7Z8P6.1|THI4_NECH7 RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Nectria haematococca mpVI 77-13-4]
 gb|EEU38990.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=322

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +2

Query  206  SHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            S +N + +        D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS
Sbjct  28   SKNNTTATIEEMEGKWDDFKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLS  87

Query  386  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
             AY + K  P++R+AIIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V
Sbjct  88   AAYILGKKRPDLRIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGV  139



>ref|XP_010759569.1| thiazole biosynthetic enzyme, mitochondrial [Paracoccidioides 
brasiliensis Pb18]
 gb|EEH47624.1| thiazole biosynthetic enzyme, mitochondrial [Paracoccidioides 
brasiliensis Pb18]
Length=332

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 78/96 (81%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  46   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FLD+L +
Sbjct  106  IEASVSPGGGAWLGGQLFSAMVLRKPADRFLDDLGI  141



>ref|XP_002797266.1| thiazole biosynthesis enzyme [Paracoccidioides sp. 'lutzii' Pb01]
Length=332

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 78/96 (81%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  46   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FLD+L +
Sbjct  106  IEASVSPGGGAWLGGQLFSAMVLRKPADRFLDDLGI  141



>gb|EPY53594.1| thiazole biosynthetic enzyme [Schizosaccharomyces cryophilus 
OY26]
Length=326

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +2

Query  221  SVSASHTPYSLD-SFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            +++ S   Y LD +F F PI+ES V+R MTRRY  D+  YA++D+++VGAGSAGL+ AY 
Sbjct  33   TLAKSFPTYQLDDAFNFSPIRESTVSRAMTRRYFADLDKYAESDIVIVGAGSAGLTAAYY  92

Query  398  I-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            + ++ P++++AIIE SV+PGGGAWLGGQLFSAMVVRKPA  FL E+ V
Sbjct  93   LGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADAFLREIGV  140



>ref|XP_002172093.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
 gb|EEB05800.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
Length=326

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI-SKNPNVRVAI  430
            + FKF PI+ESIVAR M +RY  D+  YA++D+++VGAGSAGL+CAY I ++ P++++AI
Sbjct  41   EDFKFAPIRESIVARAMIKRYWKDLETYAESDIVIVGAGSAGLTCAYYIGTRRPDLKIAI  100

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE  V+PGGGAWLGGQL SAMVVRKPA  FL+E+ V
Sbjct  101  IEAGVAPGGGAWLGGQLMSAMVVRKPADAFLNEIGV  136



>gb|EEH19379.2| thiazole biosynthetic enzyme, mitochondrial [Paracoccidioides 
brasiliensis Pb03]
Length=332

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 78/96 (81%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  46   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FLD+L +
Sbjct  106  IEASVSPGGGAWLGGQLFSAMVLRKPADRFLDDLGI  141



>ref|XP_009844134.1| thiazole biosynthesis enzyme, variant 2 [Aphanomyces astaci]
 gb|ETV66359.1| thiazole biosynthesis enzyme, variant 2 [Aphanomyces astaci]
Length=270

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  302  MTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  481
            MT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK+PN+RVAIIEQSV+PGGGAWLGGQL
Sbjct  1    MTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSKHPNIRVAIIEQSVAPGGGAWLGGQL  60

Query  482  FSAMVVRKPAQVFLDELEV  538
            FS+M+VRKPA  FLDELE+
Sbjct  61   FSSMIVRKPAHHFLDELEI  79



>gb|EFQ30532.1| Thi4 family protein [Colletotrichum graminicola M1.001]
Length=329

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSF F PI+ES V+R MTRRY  D+  +A++D+++VGAGS GLS AY ++K  P++R+AI
Sbjct  48   DSFAFAPIRESQVSRAMTRRYFADLDAHAESDIVIVGAGSCGLSAAYVLAKARPDLRIAI  107

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            +E  V+PGGGAWLGGQLFSAMV+RKPA+VFLDE+ V
Sbjct  108  VEAGVAPGGGAWLGGQLFSAMVMRKPAEVFLDEVGV  143



>ref|NP_982405.1| AAL137Wp [Ashbya gossypii ATCC 10895]
 sp|Q75F65.1|THI4_ASHGO RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Ashbya gossypii ATCC 10895]
 gb|AAS50229.1| AAL137Wp [Ashbya gossypii ATCC 10895]
 gb|AEY94514.1| FAAL137Wp [Ashbya gossypii FDAG1]
Length=331

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            +++ H LS       +S   F+F PI+E+ V+R MT RY  D+  YA +DV++VGAGS+G
Sbjct  26   STTRHALSDIVREKDWS--DFQFAPIREATVSRAMTTRYFEDLYRYAVSDVVIVGAGSSG  83

Query  380  LSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            LS AY ++KN P++R+AIIE +V+PGGGAWLGGQLFSAM++RKP  +FLDELE+
Sbjct  84   LSAAYVLAKNRPDLRIAIIEANVAPGGGAWLGGQLFSAMIMRKPTHLFLDELEI  137



>gb|ENH83973.1| thiazole biosynthetic enzyme [Colletotrichum orbiculare MAFF 
240422]
Length=329

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A   ++++N            DSF F PI+ES V+R MTRRY  D+  YA++D+++VGAG
Sbjct  29   ATTTATNNNSETKVEDMFGKWDSFTFAPIRESQVSRAMTRRYFADLDAYAESDIVIVGAG  88

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            S GLS AY ++K  P++R+AI+E  V+PGGGAWLGGQLFSAMV+RKPA VFL EL V
Sbjct  89   SCGLSTAYVLAKARPDLRIAIVEAGVAPGGGAWLGGQLFSAMVMRKPADVFLRELGV  145



>ref|XP_008026201.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
 gb|EOA86208.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
Length=335

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            AVKA++    + + +   ++ DSF F PI+ES V+R MTRRY  D+  YA++DV++VGAG
Sbjct  30   AVKAAASGQ-AKTVAELEHNWDSFAFAPIRESQVSRAMTRRYFADLDTYAESDVVIVGAG  88

Query  371  SAGLSCAYEI-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            S GLS A+ + +K P++++AIIE  V+PGGGAWLGGQLFSAMV+RKPA++FL+E+ V
Sbjct  89   SCGLSTAFTLATKRPDLKIAIIESGVAPGGGAWLGGQLFSAMVMRKPAELFLNEVGV  145



>ref|XP_007821738.1| thiazole biosynthetic enzyme variant 1 [Metarhizium robertsii 
ARSEF 23]
 gb|EFY99491.1| thiazole biosynthetic enzyme variant 1 [Metarhizium robertsii 
ARSEF 23]
 gb|EXV04465.1| Thi4 family protein [Metarhizium robertsii]
 gb|KFG84393.1| thiazole biosynthetic enzyme variant 1 [Metarhizium anisopliae]
 gb|KID68776.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
anisopliae ARSEF 549]
 gb|KID80311.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
brunneum ARSEF 3297]
Length=323

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+  YA++D++++GAG
Sbjct  26   AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDTYAESDIVIIGAG  83

Query  371  SAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            S GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V
Sbjct  84   SCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGV  140



>ref|XP_009154920.1| thiazole biosynthetic enzyme, mitochondrial [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY54459.1| thiazole biosynthetic enzyme, mitochondrial [Exophiala dermatitidis 
NIH/UT8656]
Length=331

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 87/115 (76%), Gaps = 7/115 (6%)
 Frame = +2

Query  215  NLSVSASHTPY------SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSA  376
            N + +A+HT          D+FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS 
Sbjct  33   NANGNATHTKLLDEFGGKWDAFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSC  92

Query  377  GLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            GLS AY ++K  P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V
Sbjct  93   GLSTAYTLAKARPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAEEFLNDIGV  147



>gb|KID99833.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
majus ARSEF 297]
Length=323

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 87/117 (74%), Gaps = 3/117 (3%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+  YA++D++++GAG
Sbjct  26   AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFQDLDTYAESDIVIIGAG  83

Query  371  SAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            S GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V
Sbjct  84   SCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGV  140



>gb|KIX99472.1| thiamine thiazole synthase [Fonsecaea multimorphosa CBS 102226]
Length=329

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  50   DGFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTLAKARPDLKIAI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V
Sbjct  110  IEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIGV  145



>gb|KIV92747.1| thiamine thiazole synthase [Exophiala mesophila]
 gb|KIV92748.1| thiamine thiazole synthase, variant 1 [Exophiala mesophila]
 gb|KIV92749.1| thiamine thiazole synthase, variant 2 [Exophiala mesophila]
Length=330

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY + K  P++++AI
Sbjct  51   DSFKFAPIRESQVSRAMTRRYFADLDKYAESDVVIVGAGSCGLSAAYTLGKARPDLKIAI  110

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            IE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V
Sbjct  111  IEASVSPGGGCWLGGQLFSAMVLRKPAEEFLNDIGV  146



>ref|XP_499918.1| YALI0A09768p [Yarrowia lipolytica]
 sp|Q3V7I4.1|THI4_YARLI RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Yarrowia lipolytica CLIB122]
 emb|CAG83845.1| YALI0A09768p [Yarrowia lipolytica CLIB122]
Length=317

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 87/111 (78%), Gaps = 4/111 (4%)
 Frame = +2

Query  209  HHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSC  388
            +  L+ S  HT    +SFKF PI+ES V+R MTRRY  D+  YA++DV+++GAGS GLS 
Sbjct  26   NQKLTKSDEHT---WESFKFAPIRESTVSRAMTRRYFEDLDKYAESDVVIIGAGSCGLSA  82

Query  389  AYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            AY ++K+ P++++AI+E  V+PGGGAWLGGQLFSAMV+RKPA+ FL+E+ V
Sbjct  83   AYVLAKSRPDLKIAIVEAGVAPGGGAWLGGQLFSAMVMRKPAEQFLEEIGV  133



>gb|EPX71211.1| thiazole biosynthetic enzyme [Schizosaccharomyces octosporus 
yFS286]
Length=327

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +2

Query  221  SVSASHTPYSLDS-FKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            +++ S   Y LD+ F F PI+ES V+R MTRRY  D+  YA++D+++VGAGSAGL+ AY 
Sbjct  34   ALTKSFPNYQLDNEFTFSPIRESTVSRAMTRRYFADLDKYAESDIVIVGAGSAGLTAAYY  93

Query  398  I-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            + ++ P++++AIIE SV+PGGGAWLGGQLFSAMVVRKPA  FL E+ V
Sbjct  94   LGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADAFLREIGV  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645