BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004F07

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB27075.1|  hypothetical protein B456_004G276400                  68.2    3e-10   Gossypium raimondii
gb|KJB27076.1|  hypothetical protein B456_004G276400                  67.8    4e-10   Gossypium raimondii
gb|KJB27079.1|  hypothetical protein B456_004G276400                  67.4    5e-10   Gossypium raimondii
gb|KJB27078.1|  hypothetical protein B456_004G276400                  67.4    5e-10   Gossypium raimondii
gb|EYU18249.1|  hypothetical protein MIMGU_mgv1a002604mg              65.9    2e-09   Erythranthe guttata [common monkey flower]
gb|KJB27077.1|  hypothetical protein B456_004G276400                  65.5    2e-09   Gossypium raimondii
ref|XP_011084120.1|  PREDICTED: TBC1 domain family member 15          65.5    2e-09   Sesamum indicum [beniseed]
ref|XP_004251725.1|  PREDICTED: TBC1 domain family member 17-like     65.5    2e-09   Solanum lycopersicum
ref|XP_006345222.1|  PREDICTED: TBC1 domain family member 15-like     63.9    6e-09   Solanum tuberosum [potatoes]
gb|KHG01737.1|  TBC1 domain family member 15                          63.9    8e-09   Gossypium arboreum [tree cotton]
ref|XP_010445069.1|  PREDICTED: TBC1 domain family member 15-like...  63.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010445073.1|  PREDICTED: TBC1 domain family member 15-like...  63.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010482625.1|  PREDICTED: TBC1 domain family member 15-like...  63.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010482626.1|  PREDICTED: TBC1 domain family member 15-like...  63.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010442797.1|  PREDICTED: TBC1 domain family member 15-like     63.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002864184.1|  hypothetical protein ARALYDRAFT_495330           62.4    2e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_010482627.1|  PREDICTED: TBC1 domain family member 15-like...  62.0    3e-08   Camelina sativa [gold-of-pleasure]
dbj|BAA98076.1|  unnamed protein product                              60.1    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009624893.1|  PREDICTED: TBC1 domain family member 15-like     60.1    1e-07   Nicotiana tomentosiformis
gb|EPS58476.1|  hypothetical protein M569_16338                       58.9    2e-07   Genlisea aurea
ref|XP_007013520.1|  RabGAP/TBC domain-containing protein isoform 1   59.7    2e-07   
ref|NP_200071.2|  RabGAP/TBC domain-containing protein                59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190524.1|  RabGAP/TBC domain-containing protein             59.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013521.1|  RabGAP/TBC domain-containing protein isoform 2   59.3    2e-07   
ref|XP_006280129.1|  hypothetical protein CARUB_v10026023mg           58.9    3e-07   Capsella rubella
gb|KJB54007.1|  hypothetical protein B456_009G016100                  58.9    3e-07   Gossypium raimondii
ref|XP_006381118.1|  hypothetical protein POPTR_0006s06510g           57.8    4e-07   
gb|KHG10934.1|  TBC1 domain family member 17                          55.5    4e-07   Gossypium arboreum [tree cotton]
ref|XP_008354495.1|  PREDICTED: GTPase-activating protein gyp7-like   57.4    7e-07   
ref|XP_008362894.1|  PREDICTED: TBC1 domain family member 17-like     57.4    1e-06   
ref|XP_011017820.1|  PREDICTED: TBC1 domain family member 17-like...  56.6    2e-06   Populus euphratica
ref|XP_011017818.1|  PREDICTED: TBC1 domain family member 15-like...  56.2    2e-06   Populus euphratica
ref|XP_011017816.1|  PREDICTED: TBC1 domain family member 15-like...  56.2    2e-06   Populus euphratica
gb|KJB64720.1|  hypothetical protein B456_010G061900                  56.2    2e-06   Gossypium raimondii
ref|XP_008377303.1|  PREDICTED: TBC1 domain family member 17          56.2    2e-06   
ref|XP_008456989.1|  PREDICTED: TBC1 domain family member 15          55.8    3e-06   Cucumis melo [Oriental melon]
gb|KDP30256.1|  hypothetical protein JCGZ_17038                       55.8    3e-06   Jatropha curcas
gb|KJB64721.1|  hypothetical protein B456_010G061900                  55.5    3e-06   Gossypium raimondii
ref|XP_007204093.1|  hypothetical protein PRUPE_ppa002904mg           55.5    3e-06   
gb|KJB64719.1|  hypothetical protein B456_010G061900                  55.5    4e-06   Gossypium raimondii
ref|XP_008242808.1|  PREDICTED: TBC1 domain family member 17          55.5    4e-06   Prunus mume [ume]
ref|XP_006401806.1|  hypothetical protein EUTSA_v10012867mg           55.1    6e-06   
ref|XP_004139297.1|  PREDICTED: TBC1 domain family member 15-like     54.7    7e-06   Cucumis sativus [cucumbers]
ref|XP_006401805.1|  hypothetical protein EUTSA_v10012867mg           54.7    7e-06   Eutrema salsugineum [saltwater cress]
ref|XP_009127224.1|  PREDICTED: TBC1 domain family member 15          54.7    7e-06   Brassica rapa
emb|CDY65323.1|  BnaC02g44880D                                        54.7    7e-06   Brassica napus [oilseed rape]
ref|XP_004159423.1|  PREDICTED: TBC1 domain family member 15-like     54.3    9e-06   
emb|CDY27056.1|  BnaA02g10760D                                        53.9    1e-05   Brassica napus [oilseed rape]
emb|CDP10442.1|  unnamed protein product                              53.5    2e-05   Coffea canephora [robusta coffee]
ref|XP_011020167.1|  PREDICTED: TBC1 domain family member 15          53.5    2e-05   Populus euphratica
ref|XP_010112473.1|  hypothetical protein L484_008961                 53.1    2e-05   
gb|KFK26862.1|  hypothetical protein AALP_AA8G303600                  52.8    3e-05   Arabis alpina [alpine rockcress]
ref|XP_010047970.1|  PREDICTED: TBC1 domain family member 15          52.8    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010241554.1|  PREDICTED: TBC1 domain family member 17 isof...  52.4    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010241555.1|  PREDICTED: TBC1 domain family member 17 isof...  52.4    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010241556.1|  PREDICTED: TBC1 domain family member 15 isof...  52.4    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_003542634.1|  PREDICTED: TBC1 domain family member 15-like     52.4    4e-05   Glycine max [soybeans]
gb|KHN22122.1|  TBC1 domain family member 15                          52.4    4e-05   Glycine soja [wild soybean]
ref|XP_010557604.1|  PREDICTED: TBC1 domain family member 15          52.0    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_002324638.2|  hypothetical protein POPTR_0018s12770g           51.2    9e-05   
ref|XP_009758337.1|  PREDICTED: TBC1 domain family member 15-like     49.7    3e-04   Nicotiana sylvestris
ref|XP_009363991.1|  PREDICTED: TBC1 domain family member 15          49.7    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_003549744.1|  PREDICTED: TBC1 domain family member 15-like     49.7    3e-04   
gb|KDO80156.1|  hypothetical protein CISIN_1g005652mg                 49.7    3e-04   Citrus sinensis [apfelsine]
ref|XP_010687932.1|  PREDICTED: TBC1 domain family member 15 isof...  49.7    3e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687933.1|  PREDICTED: TBC1 domain family member 15 isof...  49.7    3e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009789608.1|  PREDICTED: TBC1 domain family member 17-like...  48.5    7e-04   Nicotiana sylvestris
ref|XP_009789609.1|  PREDICTED: TBC1 domain family member 17-like...  48.5    7e-04   Nicotiana sylvestris



>gb|KJB27075.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=544

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78


 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSM  464
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPL  355



>gb|KJB27076.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=626

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78


 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQP  458
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQP  353



>gb|KJB27079.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=683

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSM  464
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPL  355



>gb|KJB27078.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=656

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>gb|EYU18249.1| hypothetical protein MIMGU_mgv1a002604mg [Erythranthe guttata]
Length=655

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAASIQQGSAS++++  R+ STSN+ D   I    D V ++P QYAS+ I
Sbjct  5    ELHDLSDDADYAASIQQGSASISQNESRRQSTSNEPDGAEIVYTKDNVTIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGNALF  78



>gb|KJB27077.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=639

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSM  464
            K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +
Sbjct  269  KVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPL  311



>ref|XP_011084120.1| PREDICTED: TBC1 domain family member 15 [Sesamum indicum]
Length=654

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAASIQQGSASMTRS+ R+ S++++ +   +    + VA++P QYAS+ I
Sbjct  5    ELHDLSDDADYAASIQQGSASMTRSDSRRLSSTSEPEGAEVVYSKENVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGNSLF  78



>ref|XP_004251725.1| PREDICTED: TBC1 domain family member 17-like [Solanum lycopersicum]
Length=656

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+QQGSASM RSN  K  +S + +   I  + D VA++P QYAS+ I
Sbjct  5    DVHDLSDDADYAASVQQGSASMNRSNSSKQGSSGEQEGAEIVYVKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>ref|XP_006345222.1| PREDICTED: TBC1 domain family member 15-like [Solanum tuberosum]
Length=656

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+Q GSASM RSN  K  +S + +   I  + D VA++P QYAS+ I
Sbjct  5    DVHDLSDDADYAASVQHGSASMNRSNSSKQGSSGEQEGAEIVYVKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>gb|KHG01737.1| TBC1 domain family member 15 [Gossypium arboreum]
Length=683

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS Q+GSASM R +  K STS++++   I  L D VA++P QYA
Sbjct  1    MQEAELHDLSDDADYAASQQEGSASMMRCDSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
             + I+ +L+ I QG  + 
Sbjct  61   FERISGRLKLIKQGSALF  78


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSM  464
            + K  +R+H+ D E AT V    LI+Y +FD +SLVWGKPRQP +
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELISYKEFDKLSLVWGKPRQPPL  355



>ref|XP_010445069.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010445073.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010482625.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010482626.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010442797.1| PREDICTED: TBC1 domain family member 15-like [Camelina sativa]
Length=672

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_002864184.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40443.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
Length=674

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S+ ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSDSGKRSSPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_010482627.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Camelina 
sativa]
Length=679

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>dbj|BAA98076.1| unnamed protein product [Arabidopsis thaliana]
Length=327

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPILTKSSFRKH  362
            AS+ I+++        P     S R+H
Sbjct  62   ASERISDRSLYTITAVPFTEVRSIRRH  88



>ref|XP_009624893.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana tomentosiformis]
Length=649

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            +I D SD+  YAASIQQGSASM RS+  K S+S + +   I  L D VA++P QYAS+ I
Sbjct  5    DIHDLSDDADYAASIQQGSASMNRSDSSKQSSSGEQEGAEIVYLKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>gb|EPS58476.1| hypothetical protein M569_16338, partial [Genlisea aurea]
Length=340

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD++ YAASIQQGSAS+ R++  K S +++ +      + D V ++P Q+A
Sbjct  1    MHETELSDLSDDVDYAASIQQGSASIYRTDSGKRSQTSEPEGAEAVYIKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ + QG  + 
Sbjct  61   SERISGRLKLLKQGNALF  78



>ref|XP_007013520.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY31139.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
Length=743

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGSASM R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEPELHDLSDDADYAASQQQGSASMMRCDRGKRSSSSEPEGAEIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  258  VAVNPMQYASDWINNQLRQINQGKPILTKSSFRKHDHDEEPATKVQP--LINYNKFDNVS  431
            VA +P++     +  Q   +     +  K+ +RKH+HD+E AT V    LI++ +FD +S
Sbjct  306  VAPDPLELERFQVLCQDHPMPTSTLVKQKAPYRKHNHDDEAATNVGTFELIDFKEFDKLS  365

Query  432  LVWGKPRQPSM  464
            LVWGKPRQP +
Sbjct  366  LVWGKPRQPPL  376



>ref|NP_200071.2| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96237.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=673

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|NP_001190524.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96238.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=690

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_007013521.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY31140.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
Length=656

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGSASM R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEPELHDLSDDADYAASQQQGSASMMRCDRGKRSSSSEPEGAEIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>ref|XP_006280129.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
 gb|EOA13027.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
Length=672

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM R +  K S+ ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRCDSGKRSSPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>gb|KJB54007.1| hypothetical protein B456_009G016100 [Gossypium raimondii]
Length=657

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   EI D SD+  YAAS QQGSASM R    K S+SN+ +   +  + D V ++P Q+A
Sbjct  1    MQETEIHDLSDDADYAASQQQGSASMMRCESGKRSSSNEPEGAEVVYMKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I Q   + 
Sbjct  61   SERISGRLKLIKQSSSLF  78



>ref|XP_006381118.1| hypothetical protein POPTR_0006s06510g, partial [Populus trichocarpa]
 gb|ERP58915.1| hypothetical protein POPTR_0006s06510g, partial [Populus trichocarpa]
Length=301

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            E+ D SD+  YAAS+QQGSA+M  TR++  + ++S+  +   I  L D V ++P QYAS+
Sbjct  5    ELHDLSDDADYAASLQQGSANMMITRTDSGRSTSSSVPEGAEIVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>gb|KHG10934.1| TBC1 domain family member 17 [Gossypium arboreum]
Length=142

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   EI D SD+  YAAS  QGSASM R    K S+SN+ +   +  + D V ++P Q+A
Sbjct  1    MQETEIHDLSDDADYAASQHQGSASMMRCESGKRSSSNEPEGAEVVYMEDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I Q     
Sbjct  61   SERISGRLKLIKQSSSFF  78



>ref|XP_008354495.1| PREDICTED: GTPase-activating protein gyp7-like [Malus domestica]
Length=398

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D VA++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLQXGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVAIHPTQFVSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>ref|XP_008362894.1| PREDICTED: TBC1 domain family member 17-like [Malus domestica]
Length=659

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D VA++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLQXGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVAIHPTQFVSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>ref|XP_011017820.1| PREDICTED: TBC1 domain family member 17-like isoform X3 [Populus 
euphratica]
Length=637

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>ref|XP_011017818.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Populus 
euphratica]
Length=661

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>ref|XP_011017816.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011017817.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
Length=676

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>gb|KJB64720.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=527

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>ref|XP_008377303.1| PREDICTED: TBC1 domain family member 17 [Malus domestica]
Length=660

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASLQHGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I  G  + 
Sbjct  65   SGRLRLIKHGSSLF  78



>ref|XP_008456989.1| PREDICTED: TBC1 domain family member 15 [Cucumis melo]
Length=655

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + STS++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSTSSELEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQG  326
            S+ I+ +LR I QG
Sbjct  61   SERISGRLRLIKQG  74



>gb|KDP30256.1| hypothetical protein JCGZ_17038 [Jatropha curcas]
Length=687

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = +3

Query  354  RKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSM  464
            RKH+H EE AT V P  LIN+ +FD ++LVWGKPRQP +
Sbjct  319  RKHEHGEEAATNVGPFQLINFKEFDKLTLVWGKPRQPPL  357



>gb|KJB64721.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=550

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>ref|XP_007204093.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
 gb|EMJ05292.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
Length=622

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQHGSASMMRSDSGKHSSSSEHDGAEVVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>gb|KJB64719.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=653

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>ref|XP_008242808.1| PREDICTED: TBC1 domain family member 17 [Prunus mume]
Length=661

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQHGSASMMRSDSGKHSSSSEHDGAEVVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>ref|XP_006401806.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43259.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=681

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS  QGSASM R +  K S S++ +   +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQLQGSASMMRCDSEKRSLSSEHEGAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_004139297.1| PREDICTED: TBC1 domain family member 15-like [Cucumis sativus]
 gb|KGN60701.1| hypothetical protein Csa_2G007450 [Cucumis sativus]
Length=655

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + S+S++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSSSSEHEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQG  326
            S+ I+ +LR I QG
Sbjct  61   SERISGRLRLIKQG  74



>ref|XP_006401805.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43258.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=675

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS  QGSASM R +  K S S++ +   +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQLQGSASMMRCDSEKRSLSSEHEGAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_009127224.1| PREDICTED: TBC1 domain family member 15 [Brassica rapa]
Length=672

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R +  K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCDSDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>emb|CDY65323.1| BnaC02g44880D [Brassica napus]
Length=672

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R +  K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCDSDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>ref|XP_004159423.1| PREDICTED: TBC1 domain family member 15-like [Cucumis sativus]
Length=485

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + S+S++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSSSSEHEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQG  326
            S+ I+ +LR I QG
Sbjct  61   SERISGRLRLIKQG  74



>emb|CDY27056.1| BnaA02g10760D [Brassica napus]
Length=672

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R    K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCESDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>emb|CDP10442.1| unnamed protein product [Coffea canephora]
Length=692

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS+QQGS+S  RS+  + S+S ++D   I  L D V ++P Q+A
Sbjct  1    MHETEVNDLSDDADYAASMQQGSSSFARSDSGRRSSSGETDGAEIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I  +L+ I QG  + 
Sbjct  61   SERIRGRLKLIKQGTALF  78



>ref|XP_011020167.1| PREDICTED: TBC1 domain family member 15 [Populus euphratica]
Length=660

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            E+ D SD+  YAAS+QQGSASM  TRS+  + ++S+  +   I  L D V ++P QYAS+
Sbjct  5    ELHDLSDDADYAASLQQGSASMMITRSDSGRSTSSSVPEGAEIVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>ref|XP_010112473.1| hypothetical protein L484_008961 [Morus notabilis]
 gb|EXC33717.1| hypothetical protein L484_008961 [Morus notabilis]
Length=508

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNI-RKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            M   ++ D SD+  YAAS QQGSAS+ RS+  R+  +S+ SD   +    D V ++P Q+
Sbjct  1    MQETDLHDLSDDADYAASQQQGSASIMRSDSGRQSCSSSDSDGAEVVYWKDNVTIHPTQF  60

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+ I QG  + 
Sbjct  61   ASERISGRLKLIKQGTSLF  79



>gb|KFK26862.1| hypothetical protein AALP_AA8G303600 [Arabis alpina]
Length=675

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +3

Query  102  AMLAREIIDPSDNI-YYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQ  278
            +M A E+ D SD+  Y AAS QQGSASM R +  K S+S++ +   +    D VA++P Q
Sbjct  2    SMEASELQDLSDDADYAAASQQQGSASMMRCDSEKRSSSSEHEGAELIYTKDNVAIHPTQ  61

Query  279  YASDWINNQLRQINQ  323
            +AS+ I+ +L+   Q
Sbjct  62   FASERISGRLKLTKQ  76



>ref|XP_010047970.1| PREDICTED: TBC1 domain family member 15 [Eucalyptus grandis]
 gb|KCW80044.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=654

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS +QGS SM RS+  K S+S + +   +  + D V ++P Q+A
Sbjct  1    MHETELHDLSDDADYAASQRQGSVSMQRSDSAKTSSSAEPEGAELVYVKDNVTIHPSQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            ++ I  +L  I QG  +L
Sbjct  61   AERIGGRLMLIKQGACLL  78



>ref|XP_010241554.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nelumbo nucifera]
Length=707

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_010241555.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nelumbo nucifera]
Length=700

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_010241556.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nelumbo nucifera]
Length=673

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_003542634.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
Length=656

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+  +  +  I  L D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPREGAE--IVFLKDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPI  335
            AS+ I+ +L+ I Q   +
Sbjct  59   ASERISGRLKLIKQSSSL  76



>gb|KHN22122.1| TBC1 domain family member 15 [Glycine soja]
Length=656

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+  +  +  I  L D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPREGAE--IVFLKDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPI  335
            AS+ I+ +L+ I Q   +
Sbjct  59   ASERISGRLKLIKQSSSL  76



>ref|XP_010557604.1| PREDICTED: TBC1 domain family member 15 [Tarenaya hassleriana]
Length=669

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E  D SD+  YAAS QQGSASM R +  K S+ ++ +   I  L D VA++P Q+A
Sbjct  1    MEESEFQDLSDDADYAASQQQGSASMMRCDSGKRSSPSEQEGGEIVYLKDNVAIHPTQFA  60

Query  285  SDWINNQLR  311
            S+ I+ +L+
Sbjct  61   SERISGRLK  69



>ref|XP_002324638.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|EEF03203.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=661

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQGSASM  TRS+  K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDADYAASLQQGSASMMMTRSDSGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>ref|XP_009758337.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana sylvestris]
Length=649

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            +I D SD+  YAASIQQGS+SM RS+  K S+S + +   I  L D VA++P QYAS+ I
Sbjct  5    DIHDLSDDADYAASIQQGSSSMNRSDSSKQSSSGEQEGAEIVYLKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>ref|XP_009363991.1| PREDICTED: TBC1 domain family member 15 [Pyrus x bretschneideri]
Length=658

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS++ GSASM RS+  K S+S++ D   +  L D V ++P Q+ 
Sbjct  1    MQEPELHDLSDDADYAASLRHGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVTIHPTQFT  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +LR I  G  + 
Sbjct  61   SERISGRLRLIKHGSSLF  78



>ref|XP_003549744.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
 gb|KHN15067.1| TBC1 domain family member 15 [Glycine soja]
Length=655

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+     ++  +   D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPRNGAEIVFS--KDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+ I Q   + 
Sbjct  59   ASERISGRLKLIKQSSSLF  77



>gb|KDO80156.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=685

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSM  464
            K S RKH HDEE  T V    LI+  +FD ++LVWGKPRQP +
Sbjct  314  KISSRKHIHDEEAVTNVGTFELIDCKEFDKLTLVWGKPRQPPL  356



>ref|XP_010687932.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=656

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M+  E+ D SD+  YAAS QQGS S+ RS+  + S    ++   +  + D V+++P QY 
Sbjct  1    MIETELHDLSDDADYAASQQQGSQSIMRSDSGRRSEPEGAE---VVYVKDNVSIHPTQYM  57

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  ++
Sbjct  58   SERISGRLKLIKQGDSLI  75



>ref|XP_010687933.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M+  E+ D SD+  YAAS QQGS S+ RS+  + S    ++   +  + D V+++P QY 
Sbjct  1    MIETELHDLSDDADYAASQQQGSQSIMRSDSGRRSEPEGAE---VVYVKDNVSIHPTQYM  57

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  ++
Sbjct  58   SERISGRLKLIKQGDSLI  75



>ref|XP_009789608.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Nicotiana 
sylvestris]
Length=676

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +3

Query  126  DPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQ  305
            D SD+  YAAS+ QGS SMT S   K S+S++   V I  L D VA++P Q+A + I  +
Sbjct  8    DLSDDADYAASMHQGSTSMTTSGGSKPSSSSEQVGVEIVYLKDNVAIHPTQHAWERIRGR  67

Query  306  LRQINQGKPIL  338
            L+ I QG  +L
Sbjct  68   LKLIKQGSSLL  78



>ref|XP_009789609.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Nicotiana 
sylvestris]
Length=626

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +3

Query  126  DPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQ  305
            D SD+  YAAS+ QGS SMT S   K S+S++   V I  L D VA++P Q+A + I  +
Sbjct  8    DLSDDADYAASMHQGSTSMTTSGGSKPSSSSEQVGVEIVYLKDNVAIHPTQHAWERIRGR  67

Query  306  LRQINQGKPIL  338
            L+ I QG  +L
Sbjct  68   LKLIKQGSSLL  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750