BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004F05

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB84163.1|  hypothetical protein B456_N007500                       223   6e-69   Gossypium raimondii
gb|ABX57881.1|  DnaJ                                                    226   4e-68   Viola baoshanensis
gb|KJB84165.1|  hypothetical protein B456_N007500                       222   1e-67   Gossypium raimondii
ref|XP_002263156.1|  PREDICTED: dnaJ protein homolog                    224   1e-67   Vitis vinifera
ref|XP_007010484.1|  DNAJ                                               224   2e-67   Theobroma cacao [chocolate]
emb|CDO99946.1|  unnamed protein product                                224   3e-67   Coffea canephora [robusta coffee]
ref|XP_010090486.1|  DnaJ-like protein                                  223   6e-67   Morus notabilis
gb|KJB84159.1|  hypothetical protein B456_N007500                       222   8e-67   Gossypium raimondii
gb|KHG01500.1|  Chaperone dnaJ 3 -like protein                          219   1e-66   Gossypium arboreum [tree cotton]
gb|KJB84164.1|  hypothetical protein B456_N007500                       222   1e-66   Gossypium raimondii
ref|XP_009398344.1|  PREDICTED: dnaJ protein homolog 2-like             222   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008231805.1|  PREDICTED: dnaJ protein homolog                    222   1e-66   Prunus mume [ume]
ref|XP_007211787.1|  hypothetical protein PRUPE_ppa006330mg             222   2e-66   Prunus persica
gb|AAD12055.1|  DnaJ protein                                            221   2e-66   Hevea brasiliensis [jebe]
ref|XP_010031320.1|  PREDICTED: dnaJ protein homolog                    221   2e-66   Eucalyptus grandis [rose gum]
ref|XP_006485485.1|  PREDICTED: dnaJ protein homolog                    221   2e-66   Citrus sinensis [apfelsine]
ref|XP_006445792.1|  hypothetical protein CICLE_v10015385mg             221   2e-66   Citrus clementina [clementine]
gb|KDP22008.1|  hypothetical protein JCGZ_03128                         218   2e-66   Jatropha curcas
gb|AFW67421.1|  putative dnaJ chaperone family protein                  221   4e-66   
gb|KJB60379.1|  hypothetical protein B456_009G302500                    220   5e-66   Gossypium raimondii
ref|XP_002514419.1|  Chaperone protein dnaJ, putative                   220   6e-66   
emb|CBI28261.3|  unnamed protein product                                219   6e-66   Vitis vinifera
ref|XP_010907982.1|  PREDICTED: dnaJ protein homolog                    220   8e-66   Elaeis guineensis
ref|XP_002270362.1|  PREDICTED: dnaJ protein homolog isoform X1         220   8e-66   Vitis vinifera
ref|XP_008354864.1|  PREDICTED: dnaJ protein homolog                    217   1e-65   
gb|AGY48884.1|  MIP1.2                                                  219   1e-65   Nicotiana benthamiana
ref|XP_006365673.1|  PREDICTED: dnaJ protein homolog isoform X2         219   2e-65   
ref|XP_010651845.1|  PREDICTED: dnaJ protein homolog isoform X2         219   2e-65   
ref|XP_004249937.1|  PREDICTED: dnaJ protein homolog                    218   3e-65   
ref|XP_006365672.1|  PREDICTED: dnaJ protein homolog isoform X1         218   3e-65   
ref|XP_009600920.1|  PREDICTED: dnaJ protein homolog                    218   4e-65   Nicotiana tomentosiformis
ref|XP_008375557.1|  PREDICTED: dnaJ protein homolog                    218   4e-65   
ref|XP_009766164.1|  PREDICTED: dnaJ protein homolog 2-like             218   4e-65   Nicotiana sylvestris
gb|AAF64454.1|AF239932_1  DnaJ protein                                  218   5e-65   Euphorbia esula [wolf's milk]
ref|XP_011084248.1|  PREDICTED: dnaJ protein homolog                    218   6e-65   Sesamum indicum [beniseed]
ref|XP_009341572.1|  PREDICTED: dnaJ protein homolog                    217   8e-65   Pyrus x bretschneideri [bai li]
ref|XP_009623415.1|  PREDICTED: dnaJ protein homolog                    217   8e-65   Nicotiana tomentosiformis
ref|XP_008345828.1|  PREDICTED: dnaJ protein homolog                    217   8e-65   Malus domestica [apple tree]
ref|XP_010907714.1|  PREDICTED: dnaJ protein homolog                    217   9e-65   Elaeis guineensis
gb|AGY48885.1|  MIP1.3                                                  217   1e-64   Nicotiana benthamiana
ref|XP_009397426.1|  PREDICTED: dnaJ protein homolog                    216   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW67420.1|  putative dnaJ chaperone family protein                  216   2e-64   
ref|NP_001234241.1|  DnaJ-like protein                                  216   2e-64   
ref|NP_001168650.1|  putative dnaJ chaperone family protein             216   3e-64   Zea mays [maize]
ref|XP_009793841.1|  PREDICTED: dnaJ protein homolog isoform X1         215   5e-64   Nicotiana sylvestris
ref|XP_004169945.1|  PREDICTED: dnaJ protein homolog                    214   1e-63   
ref|XP_008446732.1|  PREDICTED: dnaJ protein homolog                    214   1e-63   Cucumis melo [Oriental melon]
ref|XP_004981504.1|  PREDICTED: dnaJ protein homolog                    213   4e-63   Setaria italica
ref|XP_011024143.1|  PREDICTED: dnaJ protein homolog                    213   5e-63   Populus euphratica
ref|XP_004239737.1|  PREDICTED: dnaJ protein homolog                    213   5e-63   Solanum lycopersicum
ref|XP_008787761.1|  PREDICTED: dnaJ protein homolog                    213   5e-63   Phoenix dactylifera
ref|XP_002316479.1|  DnaJ family protein                                213   5e-63   Populus trichocarpa [western balsam poplar]
gb|KDO85584.1|  hypothetical protein CISIN_1g014800mg                   207   6e-63   Citrus sinensis [apfelsine]
ref|XP_002515865.1|  Chaperone protein dnaJ, putative                   213   6e-63   Ricinus communis
dbj|BAA35121.1|  DnaJ homolog                                           212   7e-63   Salix gilgiana
ref|XP_003561819.1|  PREDICTED: dnaJ protein homolog                    212   9e-63   Brachypodium distachyon [annual false brome]
ref|NP_001267695.1|  dnaJ protein homolog                               212   1e-62   Cucumis sativus [cucumbers]
ref|XP_003558043.1|  PREDICTED: dnaJ protein homolog                    212   1e-62   Brachypodium distachyon [annual false brome]
ref|XP_007052233.1|  DNAJ                                               212   1e-62   Theobroma cacao [chocolate]
ref|XP_006378828.1|  hypothetical protein POPTR_0010s24930g             213   1e-62   
ref|XP_011032891.1|  PREDICTED: dnaJ protein homolog                    211   1e-62   Populus euphratica
ref|XP_004982304.1|  PREDICTED: dnaJ protein homolog 2-like             211   1e-62   Setaria italica
gb|ABI83623.1|  DnaJ-like protein                                       211   1e-62   Setaria italica
ref|NP_001130317.1|  chaperone DNA J2                                   211   1e-62   Zea mays [maize]
emb|CAA63965.1|  DnaJ protein                                           211   2e-62   Solanum tuberosum [potatoes]
ref|XP_002466747.1|  hypothetical protein SORBIDRAFT_01g013390          211   2e-62   Sorghum bicolor [broomcorn]
gb|ABI18985.1|  molecular chaperone DjA2                                211   2e-62   Allium ampeloprasum
ref|XP_011008852.1|  PREDICTED: dnaJ protein homolog isoform X1         211   2e-62   Populus euphratica
ref|XP_002310999.1|  DnaJ family protein                                211   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002313505.1|  seed maturation protein PM37                       211   3e-62   Populus trichocarpa [western balsam poplar]
gb|AAG24642.1|AF308737_1  J1P                                           211   3e-62   Daucus carota [carrots]
ref|XP_006826444.1|  hypothetical protein AMTR_s00004p00172570          211   3e-62   Amborella trichopoda
ref|XP_011008853.1|  PREDICTED: dnaJ protein homolog isoform X2         210   3e-62   Populus euphratica
ref|XP_010031575.1|  PREDICTED: dnaJ protein homolog                    210   4e-62   Eucalyptus grandis [rose gum]
ref|XP_009793842.1|  PREDICTED: dnaJ protein homolog isoform X2         210   5e-62   Nicotiana sylvestris
ref|XP_009418972.1|  PREDICTED: dnaJ protein homolog isoform X2         210   6e-62   
gb|AGY48883.1|  MIP1.1b                                                 210   6e-62   Nicotiana benthamiana
ref|XP_006345881.1|  PREDICTED: dnaJ protein homolog                    209   7e-62   Solanum tuberosum [potatoes]
ref|XP_010248011.1|  PREDICTED: dnaJ protein homolog 2-like             209   8e-62   Nelumbo nucifera [Indian lotus]
gb|ABB16980.1|  DnaJ-like protein                                       209   8e-62   Solanum tuberosum [potatoes]
ref|XP_009588725.1|  PREDICTED: dnaJ protein homolog                    209   1e-61   
gb|AFR66645.1|  MIP1.1a                                                 209   1e-61   Nicotiana benthamiana
gb|ABA46776.1|  DnaJ-like protein                                       209   1e-61   Solanum tuberosum [potatoes]
ref|NP_001275059.1|  DnaJ-like protein                                  209   2e-61   Solanum tuberosum [potatoes]
ref|XP_001768102.1|  predicted protein                                  208   2e-61   
ref|NP_001051497.1|  Os03g0787300                                       208   3e-61   
ref|NP_001050779.1|  Os03g0648400                                       207   4e-61   
gb|AAX95135.1|  DnaJ protein, putative                                  207   4e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008803820.1|  PREDICTED: dnaJ protein homolog 2-like             207   6e-61   
ref|XP_004236804.1|  PREDICTED: dnaJ protein homolog isoform X1         207   7e-61   Solanum lycopersicum
ref|XP_006367020.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    207   8e-61   Solanum tuberosum [potatoes]
ref|XP_010933633.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    207   8e-61   Elaeis guineensis
gb|KDO85583.1|  hypothetical protein CISIN_1g014800mg                   204   1e-60   Citrus sinensis [apfelsine]
ref|NP_001146715.1|  uncharacterized protein LOC100280317               207   1e-60   
gb|ABG78615.1|  J-domain protein                                        207   1e-60   Triticum aestivum [Canadian hard winter wheat]
gb|AFW68140.1|  putative dnaJ chaperone family protein isoform 1        206   1e-60   
gb|EAY92107.1|  hypothetical protein OsI_13813                          206   1e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_004306421.1|  PREDICTED: dnaJ protein homolog                    206   1e-60   Fragaria vesca subsp. vesca
emb|CAC12824.1|  putative DNAJ protein                                  206   1e-60   Nicotiana tabacum [American tobacco]
ref|XP_006650701.1|  PREDICTED: dnaJ protein homolog 2-like             206   2e-60   Oryza brachyantha
ref|XP_006386554.1|  hypothetical protein POPTR_0002s14200g             206   2e-60   
ref|XP_009408520.1|  PREDICTED: dnaJ protein homolog isoform X1         206   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002301248.1|  DnaJ family protein                                206   2e-60   
ref|XP_009760224.1|  PREDICTED: dnaJ protein homolog                    206   2e-60   Nicotiana sylvestris
gb|ACN39991.1|  unknown                                                 206   3e-60   Picea sitchensis
ref|XP_009418971.1|  PREDICTED: dnaJ protein homolog isoform X1         205   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010933632.1|  PREDICTED: dnaJ protein homolog isoform X1         205   3e-60   Elaeis guineensis
ref|XP_009789005.1|  PREDICTED: dnaJ protein homolog                    205   4e-60   Nicotiana sylvestris
ref|XP_006650350.1|  PREDICTED: dnaJ protein homolog 2-like             204   5e-60   
ref|XP_009406563.1|  PREDICTED: dnaJ protein homolog                    204   7e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510114.1|  PREDICTED: dnaJ protein homolog 2-like             204   9e-60   Cicer arietinum [garbanzo]
ref|XP_006445376.1|  hypothetical protein CICLE_v10020330mg             204   1e-59   Citrus clementina [clementine]
gb|AGY48887.1|  MIP1.4b                                                 204   1e-59   Nicotiana benthamiana
ref|XP_011017419.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    204   1e-59   Populus euphratica
ref|XP_010685460.1|  PREDICTED: dnaJ protein homolog ANJ1               203   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010919645.1|  PREDICTED: dnaJ protein homolog                    203   2e-59   Elaeis guineensis
gb|EMS59985.1|  Chaperone protein dnaJ 2                                200   2e-59   Triticum urartu
ref|XP_009408521.1|  PREDICTED: dnaJ protein homolog isoform X2         203   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001782829.1|  predicted protein                                  202   3e-59   
ref|XP_009592511.1|  PREDICTED: dnaJ protein homolog                    202   3e-59   Nicotiana tomentosiformis
ref|XP_010053981.1|  PREDICTED: dnaJ protein homolog                    203   4e-59   Eucalyptus grandis [rose gum]
ref|XP_001774283.1|  predicted protein                                  201   9e-59   
ref|XP_010692097.1|  PREDICTED: dnaJ protein homolog 2-like             201   9e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010089281.1|  DnaJ-like protein                                  201   1e-58   Morus notabilis
ref|XP_007015642.1|  DNAJ isoform 3                                     198   1e-58   
ref|XP_001755408.1|  predicted protein                                  201   2e-58   
gb|EMT10718.1|  DnaJ protein-like protein                               201   2e-58   
ref|XP_010258832.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    201   2e-58   Nelumbo nucifera [Indian lotus]
dbj|BAJ91943.1|  predicted protein                                      201   2e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT20603.1|  DnaJ protein-like protein                               200   3e-58   
ref|XP_010263053.1|  PREDICTED: dnaJ protein homolog                    200   3e-58   Nelumbo nucifera [Indian lotus]
ref|XP_007015641.1|  DNAJ isoform 2                                     198   1e-57   
gb|EPS59846.1|  hypothetical protein M569_14958                         193   2e-57   Genlisea aurea
sp|P42824.1|DNJH2_ALLPO  RecName: Full=DnaJ protein homolog 2; Fl...    198   2e-57   Allium ampeloprasum
ref|XP_006347934.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    198   2e-57   
ref|XP_007015640.1|  DNAJ isoform 1                                     198   3e-57   
ref|XP_004953339.1|  PREDICTED: dnaJ protein homolog 2-like             197   7e-57   Setaria italica
gb|AES67168.2|  DnaJ-class molecular chaperone                          194   9e-57   Medicago truncatula
ref|XP_002446897.1|  hypothetical protein SORBIDRAFT_06g024520          196   1e-56   Sorghum bicolor [broomcorn]
gb|KDP42967.1|  hypothetical protein JCGZ_23909                         196   1e-56   Jatropha curcas
ref|XP_004976432.1|  PREDICTED: dnaJ protein homolog 2-like             196   2e-56   Setaria italica
ref|XP_003521084.1|  PREDICTED: dnaJ protein homolog 2-like             196   2e-56   Glycine max [soybeans]
gb|ACU24346.1|  unknown                                                 196   2e-56   Glycine max [soybeans]
gb|EEE57509.1|  hypothetical protein OsJ_07792                          196   2e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002983333.1|  hypothetical protein SELMODRAFT_118063             196   2e-56   Selaginella moellendorffii
gb|EYU37228.1|  hypothetical protein MIMGU_mgv1a006942mg                195   3e-56   Erythranthe guttata [common monkey flower]
emb|CDP09461.1|  unnamed protein product                                195   4e-56   Coffea canephora [robusta coffee]
gb|EEC73725.1|  hypothetical protein OsI_08334                          195   4e-56   Oryza sativa Indica Group [Indian rice]
ref|NP_001047626.1|  Os02g0656500                                       195   4e-56   
ref|XP_006345526.1|  PREDICTED: dnaJ protein homolog isoform X1         194   5e-56   Solanum tuberosum [potatoes]
ref|XP_003529049.1|  PREDICTED: dnaJ protein homolog 2-like             194   6e-56   Glycine max [soybeans]
dbj|BAK03083.1|  predicted protein                                      186   6e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003596916.1|  DnaJ                                               194   7e-56   Medicago truncatula
gb|KJB35427.1|  hypothetical protein B456_006G117100                    189   9e-56   Gossypium raimondii
ref|XP_004506241.1|  PREDICTED: dnaJ protein homolog ANJ1-like          194   1e-55   Cicer arietinum [garbanzo]
ref|XP_006647627.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    193   2e-55   Oryza brachyantha
ref|XP_008443634.1|  PREDICTED: dnaJ protein homolog                    192   2e-55   Cucumis melo [Oriental melon]
ref|XP_006647626.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    193   2e-55   Oryza brachyantha
emb|CDP15561.1|  unnamed protein product                                192   3e-55   Coffea canephora [robusta coffee]
ref|XP_006340318.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    192   3e-55   Solanum tuberosum [potatoes]
ref|XP_004487721.1|  PREDICTED: dnaJ protein homolog                    190   3e-55   Cicer arietinum [garbanzo]
gb|KJB09149.1|  hypothetical protein B456_001G126200                    192   3e-55   Gossypium raimondii
gb|EYU37227.1|  hypothetical protein MIMGU_mgv1a006922mg                192   4e-55   Erythranthe guttata [common monkey flower]
ref|NP_001136581.1|  putative dnaJ chaperone family protein             192   5e-55   Zea mays [maize]
gb|EYU36024.1|  hypothetical protein MIMGU_mgv1a007013mg                191   7e-55   Erythranthe guttata [common monkey flower]
ref|XP_010263054.1|  PREDICTED: dnaJ protein homolog                    191   9e-55   Nelumbo nucifera [Indian lotus]
gb|AFK37703.1|  unknown                                                 191   9e-55   Medicago truncatula
ref|XP_004251216.1|  PREDICTED: dnaJ protein homolog                    191   1e-54   Solanum lycopersicum
ref|XP_004139085.1|  PREDICTED: dnaJ protein homolog                    191   1e-54   Cucumis sativus [cucumbers]
ref|XP_002511620.1|  Chaperone protein dnaJ, putative                   190   1e-54   
gb|KJB35428.1|  hypothetical protein B456_006G117100                    187   2e-54   Gossypium raimondii
ref|XP_007150008.1|  hypothetical protein PHAVU_005G118100g             190   2e-54   Phaseolus vulgaris [French bean]
gb|KHG17902.1|  Chaperone dnaJ 3 -like protein                          190   2e-54   Gossypium arboreum [tree cotton]
ref|XP_009411580.1|  PREDICTED: dnaJ protein homolog                    190   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009622737.1|  PREDICTED: dnaJ protein homolog 2-like             190   2e-54   Nicotiana tomentosiformis
ref|XP_004229763.1|  PREDICTED: dnaJ protein homolog 2-like             190   3e-54   Solanum lycopersicum
ref|XP_009382439.1|  PREDICTED: dnaJ protein homolog                    190   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
sp|P43644.1|DNJH_ATRNU  RecName: Full=DnaJ protein homolog ANJ1; ...    189   3e-54   Atriplex nummularia
gb|KHN17991.1|  DnaJ protein like                                       189   4e-54   Glycine soja [wild soybean]
ref|NP_001240264.1|  uncharacterized protein LOC100818805               189   4e-54   Glycine max [soybeans]
ref|XP_003540271.1|  PREDICTED: dnaJ protein homolog                    189   4e-54   Glycine max [soybeans]
ref|XP_009596179.1|  PREDICTED: dnaJ protein homolog                    189   5e-54   Nicotiana tomentosiformis
ref|XP_006424068.1|  hypothetical protein CICLE_v10028531mg             189   6e-54   Citrus clementina [clementine]
ref|XP_002454540.1|  hypothetical protein SORBIDRAFT_04g032970          189   7e-54   Sorghum bicolor [broomcorn]
ref|XP_003570021.1|  PREDICTED: dnaJ protein homolog 2-like             188   1e-53   Brachypodium distachyon [annual false brome]
ref|XP_007134513.1|  hypothetical protein PHAVU_010G053900g             188   2e-53   Phaseolus vulgaris [French bean]
ref|XP_003626730.1|  DnaJ protein-like protein                          188   2e-53   Medicago truncatula
gb|ACJ84518.1|  unknown                                                 188   2e-53   Medicago truncatula
gb|KJB35426.1|  hypothetical protein B456_006G117100                    187   2e-53   Gossypium raimondii
ref|XP_008230416.1|  PREDICTED: dnaJ protein homolog                    187   2e-53   Prunus mume [ume]
ref|XP_007205259.1|  hypothetical protein PRUPE_ppa006299mg             187   2e-53   Prunus persica
emb|CAA04447.1|  DnaJ-like protein                                      187   2e-53   Medicago sativa [alfalfa]
dbj|BAD25681.1|  putative DnaJ-like protein MsJ1                        187   3e-53   Oryza sativa Japonica Group [Japonica rice]
gb|KJB35429.1|  hypothetical protein B456_006G117100                    187   5e-53   Gossypium raimondii
ref|NP_001238341.1|  seed maturation protein PM37                       186   5e-53   Glycine max [soybeans]
gb|AGY48888.1|  MIP1L1                                                  187   5e-53   Nicotiana benthamiana
ref|XP_006590333.1|  PREDICTED: uncharacterized protein LOC100808...    186   5e-53   
ref|XP_006837307.1|  hypothetical protein AMTR_s00111p00054240          183   6e-53   
gb|EMS60670.1|  DnaJ protein-like protein                               187   8e-53   Triticum urartu
emb|CAH67501.1|  OSIGBa0134H18.3                                        186   8e-53   Oryza sativa [red rice]
ref|XP_007132506.1|  hypothetical protein PHAVU_011G100000g             186   8e-53   Phaseolus vulgaris [French bean]
gb|AFK48766.1|  unknown                                                 186   1e-52   Medicago truncatula
gb|AHA84223.1|  seed maturation protein PM37                            186   1e-52   Phaseolus vulgaris [French bean]
ref|NP_001242510.1|  uncharacterized protein LOC100808604               185   1e-52   
gb|ACJ85577.1|  unknown                                                 181   1e-52   Medicago truncatula
ref|XP_009779099.1|  PREDICTED: dnaJ protein homolog                    185   2e-52   Nicotiana sylvestris
gb|AHA84264.1|  seed maturation protein PM37                            185   2e-52   Phaseolus vulgaris [French bean]
dbj|BAA76883.1|  DnaJ homolog protein                                   185   2e-52   Salix gilgiana
ref|NP_001053485.1|  Os04g0549600                                       184   4e-52   
gb|ABY52936.1|  DnaJ family heat shock protein                          184   4e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010089798.1|  DnaJ-like protein                                  184   5e-52   
ref|XP_009368443.1|  PREDICTED: dnaJ protein homolog                    184   5e-52   Pyrus x bretschneideri [bai li]
ref|XP_008385581.1|  PREDICTED: dnaJ protein homolog                    184   5e-52   
ref|XP_002969107.1|  hypothetical protein SELMODRAFT_267228             184   6e-52   Selaginella moellendorffii
gb|KJB41003.1|  hypothetical protein B456_007G087000                    184   6e-52   Gossypium raimondii
ref|XP_011090296.1|  PREDICTED: dnaJ protein homolog                    184   6e-52   Sesamum indicum [beniseed]
ref|XP_011088982.1|  PREDICTED: dnaJ protein homolog                    183   7e-52   Sesamum indicum [beniseed]
gb|KHG16063.1|  DnaJ protein                                            180   8e-52   Gossypium arboreum [tree cotton]
ref|XP_010694477.1|  PREDICTED: dnaJ protein homolog                    183   9e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002877319.1|  hypothetical protein ARALYDRAFT_905503             183   9e-52   Arabidopsis lyrata subsp. lyrata
tpg|DAA41207.1|  TPA: putative dnaJ chaperone family protein            186   9e-52   
ref|XP_002874044.1|  hypothetical protein ARALYDRAFT_489058             183   1e-51   
gb|KHG16062.1|  Chaperone protein dnaJ 3                                180   1e-51   Gossypium arboreum [tree cotton]
gb|KHF97331.1|  Chaperone dnaJ 3 -like protein                          182   2e-51   Gossypium arboreum [tree cotton]
ref|XP_010535721.1|  PREDICTED: chaperone protein dnaJ 3                182   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_010521621.1|  PREDICTED: dnaJ protein homolog ANJ1-like          182   4e-51   Tarenaya hassleriana [spider flower]
ref|XP_003605981.1|  DnaJ                                               181   5e-51   
ref|XP_003605980.1|  DnaJ                                               181   6e-51   Medicago truncatula
gb|EYU36023.1|  hypothetical protein MIMGU_mgv1a007093mg                181   8e-51   Erythranthe guttata [common monkey flower]
ref|XP_006404506.1|  hypothetical protein EUTSA_v10010407mg             181   1e-50   Eutrema salsugineum [saltwater cress]
ref|XP_008359180.1|  PREDICTED: dnaJ protein homolog                    181   1e-50   
gb|KDO48715.1|  hypothetical protein CISIN_1g015695mg                   177   1e-50   Citrus sinensis [apfelsine]
emb|CAN64325.1|  hypothetical protein VITISV_005641                     179   2e-50   Vitis vinifera
gb|AGR45906.1|  DnaJ protein 2-like protein                             179   2e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002275918.1|  PREDICTED: dnaJ protein homolog 2                  179   3e-50   Vitis vinifera
ref|XP_009336413.1|  PREDICTED: dnaJ protein homolog                    179   4e-50   Pyrus x bretschneideri [bai li]
gb|AAB86799.1|  putative                                                179   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568412.1|  chaperone protein dnaJ 2                              179   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008361658.1|  PREDICTED: dnaJ protein homolog                    179   5e-50   
gb|KDO48711.1|  hypothetical protein CISIN_1g015695mg                   178   7e-50   Citrus sinensis [apfelsine]
ref|NP_850653.1|  chaperone protein dnaJ 3                              176   9e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDX70980.1|  BnaC03g10640D                                          177   1e-49   
ref|XP_006400711.1|  hypothetical protein EUTSA_v10013655mg             177   2e-49   Eutrema salsugineum [saltwater cress]
gb|KDO48710.1|  hypothetical protein CISIN_1g015695mg                   177   2e-49   Citrus sinensis [apfelsine]
gb|AAB49030.1|  DnaJ homolog                                            176   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008232370.1|  PREDICTED: dnaJ protein homolog 2-like             176   4e-49   Prunus mume [ume]
gb|AAK74013.1|  AT3g44110/F26G5_60                                      176   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189997.1|  chaperone protein dnaJ 3                              176   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287824.1|  hypothetical protein CARUB_v10001042mg             176   6e-49   Capsella rubella
emb|CBI16632.3|  unnamed protein product                                179   8e-49   Vitis vinifera
ref|XP_010493266.1|  PREDICTED: chaperone protein dnaJ 2-like iso...    175   8e-49   Camelina sativa [gold-of-pleasure]
emb|CAI64493.1|  OSJNBa0065H10.16                                       176   9e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010514755.1|  PREDICTED: chaperone protein dnaJ 3-like           175   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010454471.1|  PREDICTED: chaperone protein dnaJ 2                175   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010427107.1|  PREDICTED: chaperone protein dnaJ 3 isoform X1     175   1e-48   
ref|XP_006292339.1|  hypothetical protein CARUB_v10018551mg             175   1e-48   Capsella rubella
gb|ACJ85213.1|  unknown                                                 165   4e-48   Medicago truncatula
ref|XP_004291531.1|  PREDICTED: dnaJ protein homolog                    173   5e-48   Fragaria vesca subsp. vesca
ref|XP_009388365.1|  PREDICTED: dnaJ protein homolog                    165   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010420996.1|  PREDICTED: chaperone protein dnaJ 2 isoform X1     172   2e-47   Camelina sativa [gold-of-pleasure]
emb|CDX92385.1|  BnaA10g14240D                                          172   2e-47   
emb|CDY65546.1|  BnaCnng47600D                                          171   3e-47   Brassica napus [oilseed rape]
emb|CDX92386.1|  BnaA10g14250D                                          171   3e-47   
ref|XP_009120690.1|  PREDICTED: chaperone protein dnaJ 3-like           171   3e-47   Brassica rapa
sp|Q03363.1|DNJH1_ALLPO  RecName: Full=DnaJ protein homolog 1; Sh...    170   8e-47   Allium ampeloprasum
ref|XP_009120689.1|  PREDICTED: chaperone protein dnaJ 3-like           170   9e-47   Brassica rapa
emb|CAD41609.2|  OSJNBb0034G17.1                                        173   1e-46   Oryza sativa Japonica Group [Japonica rice]
emb|CDY09117.1|  BnaA02g05430D                                          169   2e-46   Brassica napus [oilseed rape]
ref|XP_011093285.1|  PREDICTED: chaperone protein dnaJ 3-like           169   3e-46   Sesamum indicum [beniseed]
gb|AAD09517.1|  NTFP2                                                   159   5e-46   Nicotiana tabacum [American tobacco]
ref|XP_010520679.1|  PREDICTED: chaperone protein dnaJ 3-like           169   1e-45   
ref|XP_010544327.1|  PREDICTED: dnaJ protein homolog                    167   1e-45   Tarenaya hassleriana [spider flower]
gb|KDP28841.1|  hypothetical protein JCGZ_14612                         165   5e-45   Jatropha curcas
ref|XP_009126521.1|  PREDICTED: chaperone protein dnaJ 3                165   6e-45   Brassica rapa
ref|XP_009131855.1|  PREDICTED: chaperone protein dnaJ 3-like           164   1e-44   Brassica rapa
ref|XP_004291528.1|  PREDICTED: dnaJ protein homolog                    164   1e-44   Fragaria vesca subsp. vesca
gb|KFK26344.1|  hypothetical protein AALP_AA8G235700                    164   1e-44   Arabis alpina [alpine rockcress]
gb|AGY48886.1|  MIP1.4a                                                 164   1e-44   Nicotiana benthamiana
ref|XP_001774301.1|  predicted protein                                  164   1e-44   
ref|XP_008375745.1|  PREDICTED: dnaJ protein homolog 2-like             164   2e-44   
gb|KDP36478.1|  hypothetical protein JCGZ_08608                         157   2e-44   
ref|XP_002963792.1|  hypothetical protein SELMODRAFT_230221             159   8e-43   
ref|XP_007220469.1|  hypothetical protein PRUPE_ppa006364mg             159   1e-42   
gb|KDO48709.1|  hypothetical protein CISIN_1g015695mg                   157   2e-42   
ref|XP_002974881.1|  hypothetical protein SELMODRAFT_232411             157   6e-42   
emb|CAL36997.1|  DnaJ-like protein                                      149   8e-42   
ref|XP_004170446.1|  PREDICTED: dnaJ protein homolog                    149   2e-41   
ref|XP_003058583.1|  predicted protein                                  155   4e-41   
gb|KHN36510.1|  DnaJ protein like                                       151   1e-40   
ref|XP_004307004.1|  PREDICTED: dnaJ protein homolog 2-like             152   4e-40   
ref|XP_002507968.1|  predicted protein                                  152   5e-40   
ref|XP_001419206.1|  predicted protein                                  149   7e-39   
ref|XP_005819280.1|  hypothetical protein GUITHDRAFT_121532             147   5e-38   
ref|XP_003080911.1|  DnaJ-like protein (ISS)                            144   4e-37   
ref|XP_007515206.1|  predicted protein                                  143   1e-36   
ref|XP_009830474.1|  hypothetical protein H257_06805                    140   9e-36   
emb|CCA21495.1|  conserved hypothetical protein                         140   1e-35   
gb|AAD09516.1|  NTFP1                                                   131   1e-35   
ref|XP_011457522.1|  PREDICTED: dnaJ protein homolog                    139   3e-35   
ref|XP_002900006.1|  conserved hypothetical protein                     139   4e-35   
ref|XP_002949642.1|  molecular chaperone                                138   6e-35   
ref|XP_008874469.1|  hypothetical protein H310_10010                    138   8e-35   
emb|CCI48832.1|  unnamed protein product                                141   1e-34   
emb|CCI48830.1|  unnamed protein product                                140   1e-34   
emb|CCI48829.1|  unnamed protein product                                140   1e-34   
emb|CCI48831.1|  unnamed protein product                                140   1e-34   
ref|XP_008890293.1|  hypothetical protein PPTG_00631                    137   1e-34   
ref|XP_009525521.1|  hypothetical protein PHYSODRAFT_345922             136   4e-34   
ref|XP_005645695.1|  DnaJ-like protein                                  135   6e-34   
ref|XP_005852710.1|  DnaJ subfamily A member 2-like protein             134   1e-33   
ref|XP_001691598.1|  DnaJ-like protein                                  134   3e-33   
gb|KDO48707.1|  hypothetical protein CISIN_1g015695mg                   132   8e-33   
ref|XP_009830477.1|  hypothetical protein H257_06808                    131   2e-32   
gb|EWM24221.1|  HSP40/DnaJ heat shock protein                           130   5e-32   
gb|KIZ04147.1|  putative DnaJ proteinJ1                                 130   7e-32   
ref|XP_008874481.1|  hypothetical protein H310_10021                    129   1e-31   
gb|KDO27150.1|  hypothetical protein SPRG_07857                         129   1e-31   
ref|XP_002364366.1|  DnaJ domain-containing protein                     130   1e-31   
ref|XP_008612573.1|  DnaJ like subfamily A member 2                     129   1e-31   
ref|XP_008885880.1|  DnaJ family chaperone, putative                    129   1e-31   
ref|XP_005707879.1|  molecular chaperone DnaJ                           129   2e-31   
gb|KDO48708.1|  hypothetical protein CISIN_1g015695mg                   127   4e-31   
gb|KIJ17275.1|  hypothetical protein PAXINDRAFT_162188                  127   7e-31   
ref|XP_008607517.1|  hypothetical protein SDRG_03658                    126   1e-30   
ref|XP_005707432.1|  molecular chaperone DnaJ                           126   1e-30   
gb|KCW50580.1|  hypothetical protein EUGRSUZ_J00292                     125   2e-30   
gb|EKC32228.1|  DnaJ-like protein subfamily A member 1                  124   3e-30   
ref|XP_002260632.1|  DNAJ protein                                       125   4e-30   
ref|XP_001616597.1|  DnaJ domain containing protein                     125   4e-30   
ref|XP_007396150.1|  hypothetical protein PHACADRAFT_209359             125   4e-30   
ref|XP_011416044.1|  PREDICTED: dnaJ homolog subfamily A member 1...    125   4e-30   
ref|XP_004617681.1|  PREDICTED: dnaJ homolog subfamily A member 4       125   4e-30   
gb|KDD76066.1|  hypothetical protein H632_c371p1                        125   4e-30   
ref|XP_006375231.1|  hypothetical protein POPTR_0014s05490g             121   5e-30   
ref|XP_007399859.1|  hypothetical protein PHACADRAFT_262538             124   6e-30   
ref|XP_006458405.1|  hypothetical protein AGABI2DRAFT_190689            124   8e-30   
gb|AAC27389.1|  DnaJ homolog                                            124   9e-30   
ref|XP_009689477.1|  molecular chaperone protein                        123   1e-29   
ref|XP_001610911.1|  DnaJ chaperone                                     124   1e-29   
dbj|BAN66103.1|  DnaJ chaperone, putative                               124   1e-29   
gb|EUB57005.1|  DnaJ subfamily A member                                 123   1e-29   
emb|CDI97251.1|  dnaJ subfamily A                                       123   1e-29   
emb|CDS21532.1|  dnaJ subfamily A                                       123   2e-29   
ref|XP_007478072.1|  PREDICTED: dnaJ homolog subfamily A member 4...    122   2e-29   
ref|XP_007852278.1|  mitochondrial protein import protein mas5          123   2e-29   
tpg|DAA17532.1|  TPA: DnaJ (Hsp40) homolog, subfamily A, member 4       119   2e-29   
ref|XP_009034902.1|  hypothetical protein AURANDRAFT_59942              123   2e-29   
ref|XP_007764824.1|  hypothetical protein CONPUDRAFT_87768              122   2e-29   
emb|CBJ30599.1|  Heat shock protein 40                                  123   2e-29   
gb|EUT78884.1|  hypothetical protein PFAG_05460                         122   2e-29   
gb|KDQ33681.1|  hypothetical protein PLEOSDRAFT_1099644                 122   3e-29   
ref|XP_001348533.1|  HSP40, subfamily A, putative                       122   3e-29   
gb|KDO27145.1|  hypothetical protein SPRG_07853                         122   3e-29   
ref|XP_007862829.1|  hypothetical protein GLOTRDRAFT_35434              122   4e-29   
gb|AAI51655.1|  DNAJA4 protein                                          119   4e-29   
emb|CDI76051.1|  DnaJ domain-containing protein, putative               122   4e-29   
emb|CDJ57769.1|  DnaJ domain-containing protein, putative               122   4e-29   
ref|XP_003784609.1|  PREDICTED: dnaJ homolog subfamily A member 4       122   4e-29   
ref|XP_008607516.1|  hypothetical protein SDRG_03657                    122   4e-29   
ref|XP_006888325.1|  PREDICTED: dnaJ homolog subfamily A member 4...    122   5e-29   
gb|AAI10009.1|  DNAJA4 protein                                          119   5e-29   
pir||S34632  dnaJ protein homolog - human                               117   5e-29
emb|CDI86776.1|  DnaJ domain-containing protein, putative               120   5e-29   
ref|XP_002782044.1|  molecular chaperone, putative                      119   5e-29   
ref|XP_002426657.1|  protein tumorous imaginal discs, putative          121   6e-29   
ref|NP_001187713.1|  DnaJ-like protein subfamily a member 4             121   6e-29   
emb|CDJ62663.1|  DnaJ domain-containing protein, putative               121   7e-29   
emb|CDJ42592.1|  DnaJ domain-containing protein, putative               121   7e-29   
ref|XP_005851097.1|  hypothetical protein CHLNCDRAFT_29444              121   8e-29   
ref|XP_001362945.2|  PREDICTED: dnaJ homolog subfamily A member 4...    121   8e-29   
emb|CDO70578.1|  hypothetical protein BN946_scf184636.g10               123   9e-29   
ref|XP_766227.1|  chaperone protein DnaJ                                121   9e-29   
gb|KIK77119.1|  hypothetical protein PAXRUDRAFT_835106                  120   1e-28   
ref|XP_008065754.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   1e-28   
gb|EAW99179.1|  DnaJ (Hsp40) homolog, subfamily A, member 4, isof...    119   1e-28   
ref|XP_007950028.1|  PREDICTED: dnaJ homolog subfamily A member 4       121   1e-28   
emb|CCM06079.1|  predicted protein                                      123   1e-28   
ref|XP_007364587.1|  hypothetical protein DICSQDRAFT_135488             120   1e-28   
gb|EWC85742.1|  hypothetical protein PFNF54_05408                       120   1e-28   
ref|XP_008982474.1|  PREDICTED: dnaJ homolog subfamily A member 4       120   1e-28   
gb|ETW28492.1|  hypothetical protein PFFCH_04123                        120   1e-28   
ref|XP_003699212.1|  PREDICTED: dnaJ homolog subfamily A member 1...    120   2e-28   
ref|XP_954074.1|  molecular chaperone                                   120   2e-28   
ref|XP_002131998.1|  PREDICTED: dnaJ homolog subfamily A member 1...    120   2e-28   
gb|KIL69507.1|  hypothetical protein M378DRAFT_20903                    120   2e-28   
emb|CDS28557.1|  dnaJ subfamily A                                       120   2e-28   
ref|XP_008816960.1|  DnaJ like subfamily A member 2                     120   2e-28   
gb|KIK08123.1|  hypothetical protein K443DRAFT_128494                   120   2e-28   
ref|XP_003885120.1|  DnaJ domain containing protein, related            120   2e-28   
ref|XP_001875492.1|  predicted protein                                  120   2e-28   
gb|AFR93444.1|  chaperone regulator                                     120   2e-28   
ref|XP_011059083.1|  PREDICTED: dnaJ homolog subfamily A member 1       120   2e-28   
ref|XP_003494215.1|  PREDICTED: dnaJ homolog subfamily A member 1...    120   2e-28   
ref|XP_009066210.1|  hypothetical protein LOTGIDRAFT_222951             120   2e-28   
dbj|GAA36748.2|  DnaJ homolog subfamily A member 1                      120   2e-28   
ref|XP_003395031.1|  PREDICTED: dnaJ homolog subfamily A member 1...    120   2e-28   
ref|XP_011173657.1|  PREDICTED: dnaJ homolog subfamily A member 1       120   2e-28   
ref|XP_009166302.1|  hypothetical protein T265_03526                    120   3e-28   
ref|XP_005069613.1|  PREDICTED: dnaJ homolog subfamily A member 4       120   3e-28   
gb|AAI48160.1|  DNAJA1 protein                                          117   3e-28   
gb|ACM09839.1|  DnaJ homolog subfamily A member 2                       117   3e-28   
ref|XP_011252179.1|  PREDICTED: dnaJ homolog subfamily A member 1       119   3e-28   
emb|CCF74395.1|  unnamed protein product                                119   3e-28   
ref|XP_007520454.1|  PREDICTED: dnaJ homolog subfamily A member 4       119   4e-28   
gb|KDQ59400.1|  hypothetical protein JAAARDRAFT_32961                   119   4e-28   
ref|XP_005316912.1|  PREDICTED: dnaJ homolog subfamily A member 4...    119   4e-28   
ref|XP_005283531.1|  PREDICTED: dnaJ homolog subfamily A member 1       119   4e-28   
ref|XP_003754938.1|  PREDICTED: dnaJ homolog subfamily A member 4       119   5e-28   
ref|XP_004328210.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   5e-28   
ref|XP_004581278.1|  PREDICTED: dnaJ homolog subfamily A member 1       118   5e-28   
ref|XP_004677774.1|  PREDICTED: dnaJ homolog subfamily A member 1       119   5e-28   
ref|XP_002768280.1|  chaperone protein DnaJ, putative                   119   5e-28   
gb|KIJ69543.1|  hypothetical protein HYDPIDRAFT_172911                  119   6e-28   
emb|CDR94440.1|  DnaJ chaperone, putative                               119   6e-28   
ref|NP_001012963.1|  dnaJ homolog subfamily A member 1                  119   6e-28   
ref|XP_007263805.1|  hypothetical protein FOMMEDRAFT_139033             119   6e-28   
gb|KFO76349.1|  DnaJ subfamily A member 1                               118   6e-28   
ref|XP_004387526.1|  PREDICTED: dnaJ homolog subfamily A member 4       119   7e-28   
ref|XP_007308701.1|  DnaJ-domain-containing protein                     118   7e-28   
dbj|BAC05229.1|  unnamed protein product                                119   7e-28   
ref|XP_008246667.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   8e-28   
ref|NP_001274228.1|  DnaJ (Hsp40) homolog, subfamily A, member 1        118   8e-28   
ref|XP_004781767.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   8e-28   
gb|KGB79686.1|  chaperone regulator                                     118   8e-28   
gb|KIR46609.1|  chaperone regulator                                     118   9e-28   
ref|XP_004047967.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   9e-28   
ref|XP_003191198.1|  chaperone regulator                                118   9e-28   
ref|XP_003694595.1|  PREDICTED: dnaJ homolog subfamily A member 1...    118   9e-28   
ref|XP_004017863.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   9e-28   
ref|XP_006870952.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   9e-28   
ref|XP_007471914.1|  PREDICTED: dnaJ homolog subfamily A member 4...    118   9e-28   
ref|XP_004285315.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   9e-28   
gb|KIP12385.1|  hypothetical protein PHLGIDRAFT_98388                   118   9e-28   
ref|XP_002825762.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   9e-28   
ref|NP_001095590.2|  dnaJ homolog subfamily A member 4                  118   1e-27   
gb|AAX46634.1|  DnaJ subfamily A member 2                               114   1e-27   
ref|XP_003901314.1|  PREDICTED: dnaJ homolog subfamily A member 4...    118   1e-27   
ref|XP_010953496.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    118   1e-27   
ref|XP_004403657.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   1e-27   
ref|XP_007103527.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   1e-27   
ref|XP_001107532.1|  PREDICTED: dnaJ homolog subfamily A member 4...    118   1e-27   
ref|XP_005536699.1|  DnaJ homolog, subfamily A                          118   1e-27   
ref|XP_007321427.1|  hypothetical protein SERLADRAFT_474282             118   1e-27   
ref|NP_998658.1|  dnaJ homolog subfamily A member 2                     118   1e-27   
ref|XP_004577965.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   1e-27   
ref|XP_009559470.1|  PREDICTED: dnaJ homolog subfamily A member 1       118   1e-27   
ref|XP_008821630.1|  PREDICTED: dnaJ homolog subfamily A member 4...    118   1e-27   
ref|XP_008205330.1|  PREDICTED: dnaJ homolog subfamily A member 1       118   1e-27   
ref|XP_004421927.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   1e-27   
ref|XP_007471915.1|  PREDICTED: dnaJ homolog subfamily A member 4...    118   1e-27   
ref|XP_005316913.1|  PREDICTED: dnaJ homolog subfamily A member 4...    118   1e-27   
ref|XP_010376956.1|  PREDICTED: dnaJ homolog subfamily A member 4...    118   1e-27   
ref|NP_999504.1|  dnaJ homolog subfamily A member 4                     118   1e-27   
ref|XP_850402.1|  PREDICTED: dnaJ homolog subfamily A member 4 is...    118   1e-27   
gb|EHH27514.1|  DnaJ-like protein subfamily A member 4                  118   1e-27   
ref|XP_005078961.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   1e-27   
ref|NP_067397.1|  dnaJ homolog subfamily A member 4                     118   1e-27   
ref|XP_011281002.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   1e-27   
ref|XP_010982179.1|  PREDICTED: dnaJ homolog subfamily A member 4       118   1e-27   
gb|ETE71759.1|  DnaJ-like subfamily A member 1                          117   1e-27   
ref|XP_006114888.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   1e-27   
ref|XP_007057982.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   1e-27   
ref|XP_011334056.1|  PREDICTED: dnaJ homolog subfamily A member 4       117   2e-27   
ref|XP_007617485.1|  PREDICTED: dnaJ homolog subfamily A member 4...    117   2e-27   
ref|NP_001072848.1|  DnaJ (Hsp40) homolog, subfamily A, member 4,...    117   2e-27   
emb|CDW86362.1|  dnaj protein homolog                                   117   2e-27   
ref|XP_568930.1|  chaperone regulator                                   117   2e-27   
ref|XP_004660492.1|  PREDICTED: dnaJ homolog subfamily A member 4       117   2e-27   
ref|XP_007617478.1|  PREDICTED: dnaJ homolog subfamily A member 4...    117   2e-27   
ref|XP_003813857.1|  PREDICTED: dnaJ homolog subfamily A member 4       117   2e-27   
ref|NP_001123654.1|  dnaJ homolog subfamily A member 4 isoform 2        117   2e-27   
ref|XP_510526.2|  PREDICTED: dnaJ homolog subfamily A member 4 is...    117   2e-27   
ref|XP_011150153.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   2e-27   
ref|XP_001833569.1|  chaperone dnaJ 3                                   117   2e-27   
ref|XP_003275501.1|  PREDICTED: dnaJ homolog subfamily A member 4...    117   2e-27   
ref|NP_061072.3|  dnaJ homolog subfamily A member 4 isoform 1           117   2e-27   
ref|XP_003413890.1|  PREDICTED: dnaJ homolog subfamily A member 4...    117   2e-27   
ref|XP_005822285.1|  hypothetical protein GUITHDRAFT_97880              117   2e-27   
ref|XP_004015779.1|  PREDICTED: dnaJ homolog subfamily A member 1...    117   2e-27   
ref|XP_008821629.1|  PREDICTED: dnaJ homolog subfamily A member 4...    118   2e-27   
gb|AFS63890.1|  HSP40A1                                                 117   2e-27   
gb|KDR81343.1|  hypothetical protein GALMADRAFT_239173                  117   2e-27   
ref|XP_007427944.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   2e-27   
ref|XP_004765430.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   2e-27   
ref|XP_001511550.1|  PREDICTED: dnaJ homolog subfamily A member 4       117   2e-27   
ref|XP_009095019.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   2e-27   
ref|XP_004833174.1|  DnaJ domain containing protein                     117   2e-27   
ref|XP_009542430.1|  hypothetical protein HETIRDRAFT_407567             117   2e-27   
gb|KJA27264.1|  hypothetical protein HYPSUDRAFT_198055                  117   2e-27   
ref|XP_005530024.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   2e-27   
ref|XP_004417871.1|  PREDICTED: LOW QUALITY PROTEIN: DnaJ (Hsp40)...    117   3e-27   
emb|CDJ47480.1|  DnaJ domain-containing protein, putative               117   3e-27   
emb|CCD75013.1|  putative hsp40, subfamily A, members 1,2,4             115   3e-27   
ref|NP_001040292.1|  DnaJ (Hsp40) homolog 2                             117   3e-27   
ref|XP_005234859.1|  PREDICTED: dnaJ homolog subfamily A member 1       117   3e-27   
ref|XP_006511388.1|  PREDICTED: dnaJ homolog subfamily A member 4...    118   3e-27   
gb|KDN47527.1|  putative YDJ1-mitochondrial and ER import protein       117   3e-27   
gb|KIO13237.1|  hypothetical protein M404DRAFT_992794                   117   3e-27   
ref|XP_008575009.1|  PREDICTED: dnaJ homolog subfamily A member 1       116   3e-27   
ref|XP_009028927.1|  hypothetical protein HELRODRAFT_95902              117   3e-27   



>gb|KJB84163.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=248

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGG HDPFDIFQSFFGGNPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVI  147



>gb|ABX57881.1| DnaJ [Viola baoshanensis]
Length=417

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRKGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVI  147



>gb|KJB84165.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=333

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGG HDPFDIFQSFFGGNPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVI  147



>ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 ref|XP_010658892.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 emb|CBI24994.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYY++LGVSKNASQEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDVLGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVI  147



>ref|XP_007010484.1| DNAJ [Theobroma cacao]
 gb|EOY19294.1| DNAJ [Theobroma cacao]
Length=417

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRN++
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNII  147



>emb|CDO99946.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 147/147 (100%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPK+SDNTKYYE+LGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKRSDNTKYYEVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG+HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGVHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVL  147



>ref|XP_010090486.1| DnaJ-like protein [Morus notabilis]
 gb|EXB39585.1| DnaJ-like protein [Morus notabilis]
Length=417

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYE+LGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTKYYEVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGT+KKLSLSRNVL
Sbjct  121  VIHPLKVSLEDLYNGTAKKLSLSRNVL  147



>gb|KJB84159.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84160.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84161.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84162.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84166.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGG HDPFDIFQSFFGGNPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVI  147



>gb|KHG01500.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
 gb|KHG06497.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=318

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGG HDPFDIFQSFFGGNPFG  GSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGASGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRN  560
            V+HPLKVSLEDLYNGTSKKLSLSRN
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRN  145



>gb|KJB84164.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGG HDPFDIFQSFFGGNPFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHDPFDIFQSFFGGNPFGAGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVI  147



>ref|XP_009398344.1| PREDICTED: dnaJ protein homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGG H+PFDIF+SFFGG+ FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGGHNPFDIFESFFGGSTFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVI  147



>ref|XP_008231805.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=417

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSK ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRN++
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNII  147



>ref|XP_007211787.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
 gb|EMJ12986.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
Length=417

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSK ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRN++
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNII  147



>gb|AAD12055.1| DnaJ protein [Hevea brasiliensis]
Length=415

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGG HDPFDIFQ  F G    GGG S   R++ GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGAHDPFDIFQ-SFFGGNPFGGGGSSRGRRKEGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVI  146



>ref|XP_010031320.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 ref|XP_010031321.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50579.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=417

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYY++LGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDVLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKL+LSRNV+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLALSRNVI  147



>ref|XP_006485485.1| PREDICTED: dnaJ protein homolog [Citrus sinensis]
Length=416

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQ  F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQ-SFFGGSPFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVI  146



>ref|XP_006445792.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
 gb|ESR59032.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
Length=416

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQ  F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQ-SFFGGSPFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVI  146



>gb|KDP22008.1| hypothetical protein JCGZ_03128 [Jatropha curcas]
Length=326

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LS PEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSAPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVI  147



>gb|AFW67421.1| putative dnaJ chaperone family protein [Zea mays]
Length=417

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGG    GGGSSRGRRQRRG+D
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGGSPFGGGSSRGRRQRRGDD  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVL  147



>gb|KJB60379.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60380.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60381.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60382.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60383.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
Length=418

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRN++
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNII  147



>ref|XP_002514419.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|ABH06547.1| molecular chaperone [Ricinus communis]
 gb|EEF47915.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  DVIHPLKVSLEDLYNGTSKKLSLSRNVI  148



>emb|CBI28261.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYE LGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGG GG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYIGTSKKLSLSRNVI  147



>ref|XP_010907982.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   220 bits (560),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNT+YYEILGV KNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRPPKKSDNTRYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRNVI  147



>ref|XP_002270362.1| PREDICTED: dnaJ protein homolog isoform X1 [Vitis vinifera]
 emb|CAN64692.1| hypothetical protein VITISV_030671 [Vitis vinifera]
Length=417

 Score =   220 bits (560),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYE LGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGG GG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYIGTSKKLSLSRNVI  147



>ref|XP_008354864.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=322

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGVSK ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRN  560
            V+HPLKVSLEDLYNGTSKKLSL+RN
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLARN  145



>gb|AGY48884.1| MIP1.2 [Nicotiana benthamiana]
Length=419

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG  FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGGFGGGGSSRGRRQRKGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY+GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYSGTSKKLSLSRNVL  147



>ref|XP_006365673.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
Length=412

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 137/147 (93%), Gaps = 5/147 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K ASQEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQ     + FGGGGSSR RRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQ-----SFFGGGGSSRARRQRRGED  115

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  116  VIHPLKVSLEDLYNGTSKKLSLSRNVL  142



>ref|XP_010651845.1| PREDICTED: dnaJ protein homolog isoform X2 [Vitis vinifera]
Length=417

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYE LGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYETLGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGG GG HDPFDIFQSFFGG+PF GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGHDPFDIFQSFFGGSPFAGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYIGTSKKLSLSRNVI  147



>ref|XP_004249937.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 140/149 (94%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K ASQEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQ--sffggnpfggggssrgrrqrrg  479
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQ     GGNPFGGGGSSR RRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGNPFGGGGSSRARRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDV+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  EDVIHPLKVSLEDLYNGTSKKLSLSRNVL  149



>ref|XP_006365672.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
Length=419

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K ASQEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg--  479
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG     GG    R +R+   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGSPFGGGGSSRARRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDV+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  EDVIHPLKVSLEDLYNGTSKKLSLSRNVL  149



>ref|XP_009600920.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009600921.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=417

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKR+IYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRKGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLED+YNGTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDVYNGTSKKLSLSRNVL  147



>ref|XP_008375557.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGVSK ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRN  560
            V+HPLKVSLEDLYNGTSKKLSLSRN
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLSRN  145



>ref|XP_009766164.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
 ref|XP_009766166.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
Length=419

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG  FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGGFGGGGSSRGRRQRKGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  VVHSLKVSLEDLYNGTSKKLSLSRNVL  147



>gb|AAF64454.1|AF239932_1 DnaJ protein [Euphorbia esula]
Length=418

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKR+IYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VTHPLKVSLEDLYNGTSKKLSLSRNVI  147



>ref|XP_011084248.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
 ref|XP_011084249.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=418

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 142/148 (96%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNASQ+DLKKAYRKSAIKNHPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASQDDLKKAYRKSAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE    GGG  H+PFDIF+SFFGGNPFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGGAGHNPFDIFESFFGGNPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DV+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  DVIHPLKVSLEDLYNGTSKKLSLSRNVL  148



>ref|XP_009341572.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=417

 Score =   217 bits (553),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGVSK ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRN  560
            V+HPLKVSLEDLYNGTSKKLSL+RN
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLARN  145



>ref|XP_009623415.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009623416.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   217 bits (553),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDN+KYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYE+
Sbjct  1    MFGRTPKKSDNSKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEI  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG  FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGGFGGGGSSRGRRQRKGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY+GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYSGTSKKLSLSRNVL  147



>ref|XP_008345828.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   217 bits (553),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN+KYYEILGVSK ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNSKYYEILGVSKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRN  560
            V+HPLKVSLEDLYNGTSKKLSL+RN
Sbjct  121  VIHPLKVSLEDLYNGTSKKLSLARN  145



>ref|XP_010907714.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=415

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDIFQ  F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQ-SFFGGNPFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVI  145



>gb|AGY48885.1| MIP1.3 [Nicotiana benthamiana]
Length=418

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 136/148 (92%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg-E  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG    GGG S   R++R  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+YNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEDVYNGTSKKLSLSRNVL  148



>ref|XP_009397426.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=416

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV KNASQEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG H+PFDIF+SFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHNPFDIFESFFGGNPFGGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVI  146



>gb|AFW67420.1| putative dnaJ chaperone family protein [Zea mays]
Length=415

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQ           G  RGRRQRRG+D
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQ--SFFGGGSPFGGIRGRRQRRGDD  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  119  VVHPLKVSLEDLYNGTSKKLSLSRNVL  145



>ref|NP_001234241.1| DnaJ-like protein [Solanum lycopersicum]
 gb|AAF28382.1|AF124139_1 DnaJ-like protein [Solanum lycopersicum]
Length=419

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 133/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K ASQEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg--  479
            LSDPEKREIYDQYGEDALKEGMGGGGG H+PFDIFQSFFGG     GG    R +R+   
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHEPFDIFQSFFGGGGNPFGGGGSSRVRRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDV+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  EDVIHPLKVSLEDLYNGTSKKLSLSRNVL  149



>ref|NP_001168650.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACN29044.1| unknown [Zea mays]
 tpg|DAA51803.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=418

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 145/148 (98%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQ-sffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQ  F GG+PFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGGSPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNGTSKKLSLSR+VL
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRSVL  148



>ref|XP_009793841.1| PREDICTED: dnaJ protein homolog isoform X1 [Nicotiana sylvestris]
Length=418

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg-E  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG    GGG S   R++R  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+YNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEDVYNGTSKKLSLSRNVL  148



>ref|XP_004169945.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 sp|Q04960.1|DNJH_CUCSA RecName: Full=DnaJ protein homolog; AltName: Full=DNAJ-1; Flags: 
Precursor [Cucumis sativus]
 emb|CAA47925.1| cs DnaJ-1 [Cucumis sativus]
 gb|KGN52169.1| hypothetical protein Csa_5G613470 [Cucumis sativus]
Length=413

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  59

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  60   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVI  145



>ref|XP_008446732.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  59

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  60   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVI  145



>ref|XP_004981504.1| PREDICTED: dnaJ protein homolog [Setaria italica]
Length=418

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 137/148 (93%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg-E  482
            LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGG    GGG S   R++R  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGGSPFGGGGSSRGRRQRKGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSL++LYNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLDELYNGTSKKLSLSRNVL  148



>ref|XP_011024143.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011024144.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=422

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 142/150 (95%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE--gmgggggmHDPFDIFQ-sffggnpfggggssrgrrqrr  476
            LSDPEKREIYDQYGEDALKE  G  GGGG HDPFDIFQ  F GGNPFGGGGSSRGRRQRR
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGSGGGGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDV+HPLKVSLED+YNGTSKKLSLSRNV+
Sbjct  121  GEDVIHPLKVSLEDIYNGTSKKLSLSRNVI  150



>ref|XP_004239737.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 136/148 (92%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K A+QEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  148



>ref|XP_008787761.1| PREDICTED: dnaJ protein homolog [Phoenix dactylifera]
Length=415

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDIFQ  F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQ-SFFGGNPFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGT+KKLSLSRNV+
Sbjct  119  VIHPLKVSLEDLYNGTAKKLSLSRNVI  145



>ref|XP_002316479.1| DnaJ family protein [Populus trichocarpa]
 gb|ABK95315.1| unknown [Populus trichocarpa]
 gb|EEF02650.1| DnaJ family protein [Populus trichocarpa]
Length=422

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 143/150 (95%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE--gmgggggmHDPFDIFQ-sffggnpfggggssrgrrqrr  476
            LSDPEKREIYDQYGEDALKE  G GGGGG HDPFDIFQ  F GGNPFGGGGSSRGRRQRR
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDV+HPLKVSLED+YNGTSKKLSLSRNV+
Sbjct  121  GEDVIHPLKVSLEDIYNGTSKKLSLSRNVI  150



>gb|KDO85584.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=247

 Score =   207 bits (527),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++S+NTKYYEILGVSK+A++++LKKAYRK+A+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKR+IYDQYGEDALKEGMGG G  H+PFDIF+SFFGG  FG GGSSRGRR+++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGT+KKLSLSRN+L
Sbjct  121  VVHTLKVSLEDLYNGTTKKLSLSRNIL  147



>ref|XP_002515865.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF46534.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNA+Q+DLKKAY+++AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNATQDDLKKAYKRAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGG  H+PFDIF+SFFGG+PFGGG S  GRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGAGHNPFDIFESFFGGSPFGGGSSRGGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GT KKLSLSRN++
Sbjct  121  VVHPLKVSLEDLYLGTIKKLSLSRNMI  147



>dbj|BAA35121.1| DnaJ homolog [Salix gilgiana]
Length=420

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 133/149 (89%), Positives = 139/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYE+LGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQ-sffggnpfggggssrgrrqrrg  479
            LSDPEKREIYDQYGEDALKE    GG G HDPFDIFQ  F GGNPFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGSGGSGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDV+HPLKVS EDLYNGTSKKLSLSRNV+
Sbjct  121  EDVIHPLKVSFEDLYNGTSKKLSLSRNVI  149



>ref|XP_003561819.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   212 bits (539),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV KNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG  DPFDIF SFFG +  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLK SLEDLYNGTSKKLSLSRNVL
Sbjct  121  VIHPLKASLEDLYNGTSKKLSLSRNVL  147



>ref|NP_001267695.1| dnaJ protein homolog [Cucumis sativus]
 gb|ADF30255.1| heat shock protein [Cucumis sativus]
Length=413

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAY V
Sbjct  1    MFGR-PKKSDNTKYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYGV  59

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQR GED
Sbjct  60   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRGGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVI  145



>ref|XP_003558043.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 139/148 (94%), Positives = 144/148 (97%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSDNT+YYEILGV K ASQ+DLKKAYRKSAIKNHPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRGPPKKSDNTRYYEILGVPKEASQDDLKKAYRKSAIKNHPDKGGDPEKFKEIAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLE+LYNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEELYNGTSKKLSLSRNVL  148



>ref|XP_007052233.1| DNAJ [Theobroma cacao]
 gb|EOX96390.1| DNAJ [Theobroma cacao]
Length=421

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYE+LGVSK ASQ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRVPKKSDNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGG   H+PFDIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGASSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGT+KKLSLSRN L
Sbjct  121  VVHSLKVSLEDLYNGTTKKLSLSRNAL  147



>ref|XP_006378828.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
 gb|ERP56625.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
Length=459

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 143/150 (95%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE--gmgggggmHDPFDIFQ-sffggnpfggggssrgrrqrr  476
            LSDPEKREIYDQYGEDALKE  G GGGGG HDPFDIFQ  F GGNPFGGGGSSRGRRQRR
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDV+HPLKVSLED+YNGTSKKLSLSRNV+
Sbjct  121  GEDVIHPLKVSLEDIYNGTSKKLSLSRNVI  150



>ref|XP_011032891.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011032892.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=420

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 141/149 (95%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYE+LGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQ-sffggnpfggggssrgrrqrrg  479
            LSDPEKREIYDQYGEDALKE   GGGGG HDPFDIFQ  F GGNPFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDV+HPLKVS EDLYNGTSKKLSLSRNV+
Sbjct  121  EDVIHPLKVSFEDLYNGTSKKLSLSRNVI  149



>ref|XP_004982304.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG  DPFDIF SFFG +  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVI  147



>gb|ABI83623.1| DnaJ-like protein [Setaria italica]
Length=419

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG  DPFDIF SFFG +  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVI  147



>ref|NP_001130317.1| chaperone DNA J2 [Zea mays]
 gb|AAC08009.1| DnaJ-related protein ZMDJ1 [Zea mays]
 gb|ACF78499.1| unknown [Zea mays]
 gb|ACG32917.1| dnaJ protein [Zea mays]
 gb|ACL53813.1| unknown [Zea mays]
 gb|ACN34490.1| unknown [Zea mays]
 gb|ACR38444.1| unknown [Zea mays]
 tpg|DAA50285.1| TPA: chaperone DNA J2 [Zea mays]
Length=419

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGG   DPFDIF SFFG +  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVI  147



>emb|CAA63965.1| DnaJ protein [Solanum tuberosum]
Length=419

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 136/148 (92%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP+KSDNTKYYEILGV K A+QEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPEKSDNTKYYEILGVPKTAAQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  148



>ref|XP_002466747.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
 gb|EER93745.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
Length=419

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGG   DPFDIF SFFG +  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGAHVDPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVI  147



>gb|ABI18985.1| molecular chaperone DjA2 [Allium ampeloprasum]
Length=418

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV KNAS +DLKKAYRK+AIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKNASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGDHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLE+LYNGTSKKLSLSRNV+
Sbjct  121  VVHPLKVSLEELYNGTSKKLSLSRNVI  147



>ref|XP_011008852.1| PREDICTED: dnaJ protein homolog isoform X1 [Populus euphratica]
Length=415

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGE+ALKEGMGGGGG H+PFDIF+  F G    GGG SRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGGGGGGHNPFDIFE-SFFGGNPFGGGGSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSL+RNV+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLTRNVI  146



>ref|XP_002310999.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE88366.1| DnaJ family protein [Populus trichocarpa]
Length=420

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 133/149 (89%), Positives = 140/149 (94%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYE+LGVSK+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQ-sffggnpfggggssrgrrqrrg  479
            LSDPEKREIYDQYGEDALKE   GGG G HDPFDIFQ  F GGNPFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSGAHDPFDIFQSFFGGGNPFGGGGSSRGRRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDV+HPLKVS ED+YNGTSKKLSLSRNV+
Sbjct  121  EDVIHPLKVSFEDIYNGTSKKLSLSRNVI  149



>ref|XP_002313505.1| seed maturation protein PM37 [Populus trichocarpa]
 gb|EEE87460.1| seed maturation protein PM37 [Populus trichocarpa]
Length=415

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 136/147 (93%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGE+ALKEGMGGGG  H+PFDIF+  F G    GGG SRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGGGGAGHNPFDIFE-SFFGGNPFGGGGSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSL+RNV+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLTRNVI  146



>gb|AAG24642.1|AF308737_1 J1P [Daucus carota]
 gb|AAG24643.1|AF308738_1 J2P [Daucus carota]
Length=418

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 140/148 (95%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K AS +DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DV+HPLKVSLEDL NGTSKKLSLSRNV+
Sbjct  121  DVIHPLKVSLEDLCNGTSKKLSLSRNVI  148



>ref|XP_006826444.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
 gb|ERM93681.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
Length=419

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRA-PKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGRA PKKSDNT+YYEILGVSKNASQEDLK+AYRK+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRAAPKKSDNTRYYEILGVSKNASQEDLKRAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSD EKREIYDQYGEDALKEGMGGG G HDPFDIFQ  F G    GGGSSRGRRQRRGE
Sbjct  61   VLSDREKREIYDQYGEDALKEGMGGGAGGHDPFDIFQ-SFFGGNPFGGGSSRGRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLE+LYNGTSKKLSLSRN++
Sbjct  120  DVVHPLKVSLEELYNGTSKKLSLSRNII  147



>ref|XP_011008853.1| PREDICTED: dnaJ protein homolog isoform X2 [Populus euphratica]
Length=409

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 135/147 (92%), Gaps = 7/147 (5%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGE+ALKEGMGGGGG H+PFDIF+          GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEEALKEGMGGGGGGHNPFDIFE-------SFFGGSSRGRRQRRGED  113

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSL+RNV+
Sbjct  114  VVHPLKVSLEDLYLGTSKKLSLTRNVI  140



>ref|XP_010031575.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50935.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=416

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 136/147 (93%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYE+LGVSKNASQEDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVSKNASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGSGFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLK SLEDLY GT+KKLSLSRNV+
Sbjct  120  VVHPLKASLEDLYLGTTKKLSLSRNVI  146



>ref|XP_009793842.1| PREDICTED: dnaJ protein homolog isoform X2 [Nicotiana sylvestris]
Length=412

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 136/147 (93%), Gaps = 5/147 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRTPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI       + FGGGGSSRGRRQR+GED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-----FQSFFGGGGSSRGRRQRKGED  115

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLED+YNGTSKKLSLSRNVL
Sbjct  116  VVHPLKVSLEDVYNGTSKKLSLSRNVL  142



>ref|XP_009418972.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 140/147 (95%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKRE+YDQYGEDALKE   GGGG HDPFDIF SFFGG PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGPFGGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVI  146



>gb|AGY48883.1| MIP1.1b [Nicotiana benthamiana]
Length=418

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 138/148 (93%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K+AS EDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg-E  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF SFFGG+PFGGGG S   R+++  E
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQKRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSL+DLYNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLDDLYNGTSKKLSLSRNVL  148



>ref|XP_006345881.1| PREDICTED: dnaJ protein homolog [Solanum tuberosum]
 gb|ABB16989.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K A+ EDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  148



>ref|XP_010248011.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
 ref|XP_010248012.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
Length=417

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP+KSDNTKYYEILGVSKNASQ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRKSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSD EKREIYDQYGEDALKEGMGGGG  H+PFDIF+  F G  FGGGGSSRGRRQ++GED
Sbjct  61   LSDTEKREIYDQYGEDALKEGMGGGGASHNPFDIFE-SFFGGGFGGGGSSRGRRQKQGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGTSKKLSLSRN+L
Sbjct  120  VVHTLKVSLEDLYNGTSKKLSLSRNIL  146



>gb|ABB16980.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K A+ EDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  148



>ref|XP_009588725.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009588726.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 133/150 (89%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K AS EDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI---FQsffggnpfggggssrgrrqrr  476
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI   F          GGGSSRGRRQ+R
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGMGGGSSRGRRQKR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVHPLKVSL+DLYNGTSKKLSLSRNVL
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLSRNVL  150



>gb|AFR66645.1| MIP1.1a [Nicotiana benthamiana]
Length=420

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 133/150 (89%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K AS EDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI---FQsffggnpfggggssrgrrqrr  476
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI   F          GGGSSRGRRQ+R
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGMGGGSSRGRRQKR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVHPLKVSL+DLYNGTSKKLSLSRNVL
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLSRNVL  150



>gb|ABA46776.1| DnaJ-like protein [Solanum tuberosum]
Length=443

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K A+ EDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  148



>ref|NP_001275059.1| DnaJ-like protein [Solanum tuberosum]
 gb|ABB55383.1| DnaJ-like protein-like [Solanum tuberosum]
Length=445

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K A+ EDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTAAPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  148



>ref|XP_001768102.1| predicted protein [Physcomitrella patens]
 gb|EDQ66975.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 138/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYE LGVSK+ASQ++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRMPKKSDNTKYYETLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQs--ffggnpfggggssrgrrqrrg  479
            LSDPEKRE+YDQYGEDALKEGMGGGGG H+PFDIF+S    GG+PFGG G   GRRQRRG
Sbjct  61   LSDPEKRELYDQYGEDALKEGMGGGGGGHNPFDIFESFFGGGGSPFGGNGRGGGRRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  149



>ref|NP_001051497.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|AAT75262.1| putative DnaJ like protein [Oryza sativa Japonica Group]
 gb|ABF99246.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13411.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|EAZ28837.1| hypothetical protein OsJ_12871 [Oryza sativa Japonica Group]
 dbj|BAG87697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYE+LGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGGMHDPFDI           GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGPGGGMHDPFDI--FSSFFGGGFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLE+LYNGTSKKLSLSRNVL
Sbjct  119  VVHPLKVSLEELYNGTSKKLSLSRNVL  145



>ref|NP_001050779.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|AAO72551.1| DNAJ-like protein [Oryza sativa Japonica Group]
 gb|AAU89194.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97899.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF97901.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12693.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|EAY94672.1| hypothetical protein OsI_16451 [Oryza sativa Indica Group]
 gb|EAZ27951.1| hypothetical protein OsJ_11911 [Oryza sativa Japonica Group]
 gb|ACA50510.1| DnaJ protein [Oryza sativa Japonica Group]
 dbj|BAG97073.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 136/147 (93%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGG   DPFDI  S F G  FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDI-FSSFFGPSFGGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVL  146



>gb|AAX95135.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97900.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
Length=416

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 132/147 (90%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGG   DPFDI        P  GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDI--FSSFFGPSFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVL  145



>ref|XP_008803820.1| PREDICTED: dnaJ protein homolog 2-like [Phoenix dactylifera]
Length=417

 Score =   207 bits (527),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP+KS+NTKYYEILGVSKNASQ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRKSNNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGG  H+PFDIF+  F G    GG SSRG RQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGASHNPFDIFE-QFFGGGAFGGSSSRGHRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLEDLYNGTSKKLSLSRNVL
Sbjct  120  DVVHTLKVSLEDLYNGTSKKLSLSRNVL  147



>ref|XP_004236804.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum lycopersicum]
Length=418

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV   AS +DLKKAYRK+AIKNHPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPNTASPDDLKKAYRKAAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            L+DPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNG SKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYNGISKKLSLSRNVL  147



>ref|XP_006367020.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
Length=419

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV   AS +DLKKAYRK+AIKNHPDKGGDPEKFKE+AQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPNTASPDDLKKAYRKAAIKNHPDKGGDPEKFKEIAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            L+DPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNG SKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYNGISKKLSLSRNVL  147



>ref|XP_010933633.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Elaeis guineensis]
Length=416

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++SDNTKYYEILGVSKNASQ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPRRSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYD+YGEDALKEGMGGGG  H+PFDIF+  F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDEYGEDALKEGMGGGGTSHNPFDIFE-QFFGGSAFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGT+KKLSLSRN L
Sbjct  120  VVHSLKVSLEDLYNGTTKKLSLSRNAL  146



>gb|KDO85583.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=334

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++S+NTKYYEILGVSK+A++++LKKAYRK+A+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKR+IYDQYGEDALKEGMGG G  H+PFDIF+SFFGG  FG GGSSRGRR+++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGT+KKLSLSRN+L
Sbjct  121  VVHTLKVSLEDLYNGTTKKLSLSRNIL  147



>ref|NP_001146715.1| uncharacterized protein LOC100280317 [Zea mays]
 gb|ACL54611.1| unknown [Zea mays]
Length=419

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGG   DPFDIF SFFG +  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHADPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNG SKKLSLSRNV+
Sbjct  121  VVHSLKVSLEDLYNGISKKLSLSRNVI  147



>gb|ABG78615.1| J-domain protein [Triticum aestivum]
Length=420

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 133/149 (89%), Positives = 140/149 (94%), Gaps = 3/149 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQ--sffggnpfggggssrgrrqrrg  479
            LSDPEKREIYDQYGEDALKE   GGGGMHDPFDIFQ     GGNPFGGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRRG  119

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVHPLKVSLE+LYNGTSKKLSL+RNVL
Sbjct  120  EDVVHPLKVSLEELYNGTSKKLSLARNVL  148



>gb|AFW68140.1| putative dnaJ chaperone family protein isoform 1 [Zea mays]
 gb|AFW68141.1| putative dnaJ chaperone family protein isoform 2 [Zea mays]
Length=419

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGG   DPFDIF SFFG +  GGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHADPFDIFSSFFGPSFGGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNG SKKLSLSRNV+
Sbjct  121  VVHSLKVSLEDLYNGISKKLSLSRNVI  147



>gb|EAY92107.1| hypothetical protein OsI_13813 [Oryza sativa Indica Group]
Length=417

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 133/147 (90%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYE+LGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGGMHDP DI           GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGPGGGMHDPLDICS--SFFGGGFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLE+LYNGTSKKLSLSRNVL
Sbjct  119  VVHPLKVSLEELYNGTSKKLSLSRNVL  145



>ref|XP_004306421.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=410

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 127/148 (86%), Gaps = 10/148 (7%)
 Frame = +3

Query  126  MFGRA-PKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR  PKKSDN+KYYEILGV K ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGVPKKSDNSKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQ                RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQ---------SFFGGGSRRQRRGE  111

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DV+HPLKVSLEDLY+GTSKKLSLSRN++
Sbjct  112  DVIHPLKVSLEDLYSGTSKKLSLSRNII  139



>emb|CAC12824.1| putative DNAJ protein [Nicotiana tabacum]
Length=418

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNT+YYEILGVSKNAS +++KKAYRK+A+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSD +KREIYDQYGEDALKEGMGGGGGMHDPFDIF+SFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY+G +KKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYSGITKKLSLSRNVI  147



>ref|XP_006650701.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=418

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYE+LGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMG GGGMHDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGPGGGMHDPFDI-FSSFFGGGGFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSL++LYNGTSKKLSLSRNV+
Sbjct  120  VVHPLKVSLDELYNGTSKKLSLSRNVI  146



>ref|XP_006386554.1| hypothetical protein POPTR_0002s14200g [Populus trichocarpa]
 gb|ERP64351.1| hypothetical protein POPTR_0002s14200g [Populus trichocarpa]
Length=424

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 142/149 (95%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP++SDNTKYYE+LGVSK ASQ++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE--gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg  479
            LSDP+KR+IYDQYGEDALKE  G GGGGG H+P+DIF+SFFGG  FGGGGSSRGRRQ++G
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMGPGGGGGGHNPYDIFESFFGGGGFGGGGSSRGRRQKQG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVHPLKVSLEDLYNGTSKKLSLSRN+L
Sbjct  121  EDVVHPLKVSLEDLYNGTSKKLSLSRNIL  149



>ref|XP_009408520.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPK SD+T+YYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKTSDSTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGM GGGG H+PFDIF+SFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMRGGGGGHNPFDIFESFFGGSPFGVGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
             +HPLKVSLEDLY+G SKKLSLS+ V+
Sbjct  121  AIHPLKVSLEDLYSGISKKLSLSQKVI  147



>ref|XP_002301248.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE80521.1| DnaJ family protein [Populus trichocarpa]
Length=425

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 142/149 (95%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP++SDNTKYYE+LGVSK ASQ++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE--gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg  479
            LSDP+KR+IYDQYGEDALKE  G GGGGG H+P+DIF+SFFGG  FGGGGSSRGRRQ++G
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMGPGGGGGGHNPYDIFESFFGGGGFGGGGSSRGRRQKQG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVHPLKVSLEDLYNGTSKKLSLSRN+L
Sbjct  121  EDVVHPLKVSLEDLYNGTSKKLSLSRNIL  149



>ref|XP_009760224.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009760225.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=420

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRA KKSDNTKYYEILGV K AS EDLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRATKKSDNTKYYEILGVPKTASPEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI---FQsffggnpfggggssrgrrqrr  476
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI   F          GGGSSRGRRQ+R
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGMGGGSSRGRRQKR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVHPLKVSL+DLYNGTSKKLSLSRNVL
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLSRNVL  150



>gb|ACN39991.1| unknown [Picea sitchensis]
Length=421

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 136/150 (91%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYY+ILGVSK+A+ ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYDILGVSKSATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQ---sffggnpfggggssrgrrqrr  476
            LSDPEKREIYDQYGEDALKEGMGGGG  H+PFDIF+       G    GGGSSRGRRQ++
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGASHNPFDIFESFFGGSFGGSSFGGGSSRGRRQKQ  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVHPLKVSL+DLYNGTS+KLSLSRNV+
Sbjct  121  GEDVVHPLKVSLDDLYNGTSRKLSLSRNVI  150



>ref|XP_009418971.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKRE+YDQYGEDALKE   GGGG HDPFDI    F GG   GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGPFGGGGGSSRGRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DV+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  120  DVIHPLKVSLEDLYNGTSKKLSLSRNVI  147



>ref|XP_010933632.1| PREDICTED: dnaJ protein homolog isoform X1 [Elaeis guineensis]
Length=421

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 134/151 (89%), Gaps = 4/151 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++SDNTKYYEILGVSKNASQ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPRRSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQs----ffggnpfggggssrgrrqr  473
            LSDPEKREIYD+YGEDALKEGMGGGG  H+PFDIF+        G    GGGSSRGRRQR
Sbjct  61   LSDPEKREIYDEYGEDALKEGMGGGGTSHNPFDIFEQFFGGSAFGGGAFGGGSSRGRRQR  120

Query  474  rgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            RGEDVVH LKVSLEDLYNGT+KKLSLSRN L
Sbjct  121  RGEDVVHSLKVSLEDLYNGTTKKLSLSRNAL  151



>ref|XP_009789005.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=418

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNT+YYEILGVSKNAS +++KKAYRK+A+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSD +KREIYDQYGEDALKEGMGGGGGMHDPFDIF+SFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY+G +KKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYSGITKKLSLSRNVI  147



>ref|XP_006650350.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=417

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 136/147 (93%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K+ASQ+DLKKAYRK+AIKN PDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKSASQDDLKKAYRKAAIKNPPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGG   DPFDI  S F G  FGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSHADPFDI-FSSFFGPSFGGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  120  VIHPLKVSLEDLYNGTSKKLSLSRNVL  146



>ref|XP_009406563.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=414

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKS+NTKYYE+LGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTKYYEVLGVPKSASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLYNGTSKKLSLSRNV+
Sbjct  119  VIHPLKVSLEDLYNGTSKKLSLSRNVI  145



>ref|XP_004510114.1| PREDICTED: dnaJ protein homolog 2-like [Cicer arietinum]
Length=421

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P+KSDNTKYY+ILGV+KNAS++++KKAYRK+A+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRGPRKSDNTKYYDILGVAKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEK+E+YDQYGEDALKEGMGGG   H+PFDIF+SFFGG  FGGGG SRGRRQ++GED
Sbjct  61   LSDPEKKEMYDQYGEDALKEGMGGGSSFHNPFDIFESFFGGAGFGGGGPSRGRRQKQGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLED+YNGT+KKLSLSRNVL
Sbjct  121  VVHSLKVSLEDVYNGTTKKLSLSRNVL  147



>ref|XP_006445376.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006464459.1| PREDICTED: dnaJ protein homolog 2-like [Citrus sinensis]
 gb|ESR58616.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|KDO85581.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
 gb|KDO85582.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=418

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++S+NTKYYEILGVSK+A++++LKKAYRK+A+KNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRTPRRSNNTKYYEILGVSKSATEDELKKAYRKAAMKNHPDKGGDPEKFKELGQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKR+IYDQYGEDALKEGMGG G  H+PFDIF+SFFGG  FG GGSSRGRR+++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGAGAAHNPFDIFESFFGGGTFGAGGSSRGRRRKQGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGT+KKLSLSRN+L
Sbjct  121  VVHTLKVSLEDLYNGTTKKLSLSRNIL  147



>gb|AGY48887.1| MIP1.4b [Nicotiana benthamiana]
Length=418

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNT+YYEILGV KNAS++++KKAYRK+A+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVPKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSD +KREIYDQYGEDALKEGMGGGGGMHDPFDIF+SFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY+G +KKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYSGITKKLSLSRNVI  147



>ref|XP_011017419.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Populus euphratica]
Length=423

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 140/148 (95%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP++SDN KYYE+LGVSK ASQ++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNNKYYEVLGVSKGASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmg-ggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDP+KR+IYDQYGEDALKEGMG GG   H+P+DIF+SFFGG  FGGGGSSRGRRQ++GE
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMGPGGSDGHNPYDIFESFFGGGGFGGGGSSRGRRQKQGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNGTSKKLSLSRN+L
Sbjct  121  DVVHPLKVSLEDLYNGTSKKLSLSRNIL  148



>ref|XP_010685460.1| PREDICTED: dnaJ protein homolog ANJ1 [Beta vulgaris subsp. vulgaris]
Length=417

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGV K+AS EDLK+AY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASPEDLKRAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIF SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDL+ GTSKKLSLSRNVL
Sbjct  121  VIHPLKVSLEDLFMGTSKKLSLSRNVL  147



>ref|XP_010919645.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
 ref|XP_010919646.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRA ++S+NTKYYEILGVSKNASQ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAQRRSNNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGG  H+PFDIF+  F G    GG SSRG RQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGASHNPFDIFE-QFFGGGAFGGSSSRGHRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLEDLYNGTSKKLSLSRNVL
Sbjct  120  DVVHTLKVSLEDLYNGTSKKLSLSRNVL  147



>gb|EMS59985.1| Chaperone protein dnaJ 2 [Triticum urartu]
Length=317

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYE+LGV KNA+Q+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPKNAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmH-DPFDI-FQsffggnpfggggssrgrrqrrg  479
            LSDPEKREIYDQYGEDALKEGMGGGGG   DPFDI    F      GGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGVDPFDIFSSFFGPSFGGGGGGSSRGRRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVHPLK SLEDLYNGTSKKLSLSR+VL
Sbjct  121  EDVVHPLKASLEDLYNGTSKKLSLSRSVL  149



>ref|XP_009408521.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPK SD+T+YYEILGVSKNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKTSDSTRYYEILGVSKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGM GGGG H+PFDIF+  F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMRGGGGGHNPFDIFE-SFFGGSPFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
             +HPLKVSLEDLY+G SKKLSLS+ V+
Sbjct  120  AIHPLKVSLEDLYSGISKKLSLSQKVI  146



>ref|XP_001782829.1| predicted protein [Physcomitrella patens]
 gb|EDQ52343.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYY++LGVSK+ASQ++LK+AYRK+AIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRMPKKSDNTKYYDVLGVSKSASQDELKRAYRKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKR++YDQYGEDALKEGMGGGGG H+PFDIF+        G G     RRQRRGED
Sbjct  61   LSDPEKRDLYDQYGEDALKEGMGGGGGGHNPFDIFE--SFFGGGGSGSGRGSRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLE+LYNGTSKKLSLSRN++
Sbjct  119  VVHPLKVSLEELYNGTSKKLSLSRNII  145



>ref|XP_009592511.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=418

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNT+YYEILGVSKNAS +++KKAYRK+A+KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGPKKSDNTRYYEILGVSKNASDDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSD +KREIYDQYGEDALKEGMGGGGGMHDPFDIF+SFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDSQKREIYDQYGEDALKEGMGGGGGMHDPFDIFESFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLY+G +KKLSLSRNV+
Sbjct  121  VVHTLKVSLEDLYSGITKKLSLSRNVI  147



>ref|XP_010053981.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW78355.1| hypothetical protein EUGRSUZ_D02530 [Eucalyptus grandis]
Length=433

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 134/156 (86%), Gaps = 9/156 (6%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P+KSDNTKYYE+LGV KNASQ++LKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRVPRKSDNTKYYEVLGVPKNASQDELKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfgg---------ggssr  458
            LSDPEKR++YDQYGEDALKEGMGGG   HDPFDIF+SFFGG+ F G           SSR
Sbjct  61   LSDPEKRDMYDQYGEDALKEGMGGGSAGHDPFDIFESFFGGDSFFGGGFGGRFGGASSSR  120

Query  459  grrqrrgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
             RRQ++GEDVV  LKVSLEDLYNGT KKLSLSRNVL
Sbjct  121  RRRQKQGEDVVQVLKVSLEDLYNGTMKKLSLSRNVL  156



>ref|XP_001774283.1| predicted protein [Physcomitrella patens]
 gb|EDQ60919.1| predicted protein [Physcomitrella patens]
Length=417

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTKYYE LGVSK+ASQ++LK+AYRK+AIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSDNTKYYEALGVSKSASQDELKRAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpf-ggggssrgrrqrrgE  482
            LSDPEKRE+YDQYGEDALKE   GGGG H+PFDIF+SFFGG+ F GG G    RRQRRGE
Sbjct  61   LSDPEKRELYDQYGEDALKE-GMGGGGGHNPFDIFESFFGGDSFPGGSGRGGSRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  120  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  147



>ref|XP_010692097.1| PREDICTED: dnaJ protein homolog 2-like [Beta vulgaris subsp. 
vulgaris]
Length=420

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 134/149 (90%), Gaps = 3/149 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYE+LGVSK+ASQ++LKKAYRKSAIKNHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKSASQDELKKAYRKSAIKNHPDKGGDPEKFKELGQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrrg  479
            LSDPEKREIYDQYGEDALKEGMGGGGG   H+PFDIF+  F      GGGSS  RRQ++G
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGPFHNPFDIFE-QFFSTSGFGGGSSSRRRQQQG  119

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDV+H +KVSLEDLYNGT+KK+S+SRN+L
Sbjct  120  EDVIHTMKVSLEDLYNGTTKKVSISRNIL  148



>ref|XP_010089281.1| DnaJ-like protein [Morus notabilis]
 gb|EXB37606.1| DnaJ-like protein [Morus notabilis]
Length=419

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKS-DNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P++S DNTKYYE+LGVSK+ASQE+LKKAYRK+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRMPRRSSDNTKYYEVLGVSKSASQEELKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VL+DPEKREIYDQYGEDALKEGMGGGG  H PFDIF+  F G  FGGG SSRGRR+++GE
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGPSHSPFDIFE-SFFGGGFGGGPSSRGRRKKQGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLEDLYNGT+KKLSLSRN+L
Sbjct  120  DVVHTLKVSLEDLYNGTTKKLSLSRNIL  147



>ref|XP_007015642.1| DNAJ isoform 3 [Theobroma cacao]
 gb|EOY33261.1| DNAJ isoform 3 [Theobroma cacao]
Length=320

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+A KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALK+   G  G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKD-GMGATGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+H +KVSLEDLY GTSKKLSLSRN+L
Sbjct  119  VIHNMKVSLEDLYLGTSKKLSLSRNIL  145



>ref|XP_001755408.1| predicted protein [Physcomitrella patens]
 gb|EDQ79888.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 136/150 (91%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGRAP KKSDN+KYY++LGV K+ASQ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRAPSKKSDNSKYYDVLGVPKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQs--ffggnpfggggssrgrrqrr  476
            VLSDPEKREIYDQYGEDALKEGMGGGGG H+PFDIF+S      NPFGG     GRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHNPFDIFESFFGGASNPFGGSSGRGGRRQRR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVHPLKVSL+DLYNGTSKKLSLSRNV+
Sbjct  121  GEDVVHPLKVSLDDLYNGTSKKLSLSRNVI  150



>gb|EMT10718.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 139/150 (93%), Gaps = 4/150 (3%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSD+T+YYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQ--sffggnpfggggssrgrrqrr  476
            VLSDPEKREIYDQYGEDALKE   GGGGMHDPFDIFQ     GGNPFGGGGSSRGRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKE-GMGGGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRR  119

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVHPLKVSLE+LYNGTSKKLSL+RNVL
Sbjct  120  GEDVVHPLKVSLEELYNGTSKKLSLARNVL  149



>ref|XP_010258832.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Nelumbo nucifera]
Length=413

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 133/147 (90%), Gaps = 5/147 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MF  AP+KSDNTKYYEILGVSKNASQ++LKKAYRK+AIKNHPDKGGDPEKFK+LAQAYEV
Sbjct  1    MFSCAPRKSDNTKYYEILGVSKNASQDELKKAYRKAAIKNHPDKGGDPEKFKDLAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKR+IYDQYGEDALKEGMG GG  H+PFDI       + FGGGGSSRGRRQ++GED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGVGGASHNPFDI-----FESFFGGGGSSRGRRQKQGED  115

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGTSKKLSLSRN+L
Sbjct  116  VVHTLKVSLEDLYNGTSKKLSLSRNIL  142



>dbj|BAJ91943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 139/150 (93%), Gaps = 4/150 (3%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSD+T+YYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQ--sffggnpfggggssrgrrqrr  476
            VLSDPEKREIYDQYGEDALKE   GGGGMHDPFDIFQ     GGNPFGGGGSSRGRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKE-GMGGGGMHDPFDIFQSFFGGGGNPFGGGGSSRGRRQRR  119

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVHPLKVSLE+LYNGTSKKLSL+RNVL
Sbjct  120  GEDVVHPLKVSLEELYNGTSKKLSLARNVL  149



>gb|EMT20603.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYE+LGV KNA+Q+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPKNAAQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmH-DPFDI-FQsffggnpfggggssrgrrqrrg  479
            LSDPEKREIYDQYGEDALKEGMGGGGG   DPFDI    F      GGGGSSRGRRQRRG
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGVDPFDIFSSFFGPSFGGGGGGSSRGRRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVHPLK SLEDLYNGTSKKLSLSR+VL
Sbjct  121  EDVVHPLKASLEDLYNGTSKKLSLSRSVL  149



>ref|XP_010263053.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=417

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQEDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDP+KR+IYDQYGEDALKEGM GGGG HDPFDIFQSFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPDKRDIYDQYGEDALKEGMSGGGGGHDPFDIFQSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  121  VIHPLKVSLEDLYMGTSKKLSLSRNVI  147



>ref|XP_007015641.1| DNAJ isoform 2 [Theobroma cacao]
 gb|EOY33260.1| DNAJ isoform 2 [Theobroma cacao]
Length=414

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+A KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALK+   G  G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKD-GMGATGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+H +KVSLEDLY GTSKKLSLSRN+L
Sbjct  119  VIHNMKVSLEDLYLGTSKKLSLSRNIL  145



>gb|EPS59846.1| hypothetical protein M569_14958, partial [Genlisea aurea]
Length=247

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 138/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN++YY+ILGV K+AS +DLK+AYRK+AIKNHPDKGGDPEKFKEL+ AY+V
Sbjct  2    MFGRAPKKSDNSRYYDILGVPKSASPDDLKRAYRKAAIKNHPDKGGDPEKFKELSHAYDV  61

Query  306  LSDPEKREIYDQYGEDALKE--gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg  479
            LSDPEKREIY+QYGEDALKE  G GGGGGMHDPFDIF SFFGG+ FG GGSSRGRRQR+G
Sbjct  62   LSDPEKREIYNQYGEDALKEGMGGGGGGGMHDPFDIFSSFFGGSHFGAGGSSRGRRQRKG  121

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            +D+V PLKVSLEDLY GTSKKLSLSRNV+
Sbjct  122  DDLVQPLKVSLEDLYTGTSKKLSLSRNVI  150



>sp|P42824.1|DNJH2_ALLPO RecName: Full=DnaJ protein homolog 2; Flags: Precursor [Allium 
ampeloprasum]
 emb|CAA54720.1| LDJ2 [Allium ampeloprasum]
Length=418

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYE+LGVSKNA+ EDLKKAYRK+AIKNHPDKGGDPEKFKE+ QAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVSKNATPEDLKKAYRKAAIKNHPDKGGDPEKFKEIGQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            L+DPEKREIYDQYGE+ LKEGMGGGGG+HDPFDIFQSFFGG  FGGGGSSRGRRQRRGED
Sbjct  61   LNDPEKREIYDQYGEEGLKEGMGGGGGVHDPFDIFQSFFGGGGFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNGTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYNGTSKKLSLSRNVL  147



>ref|XP_006347934.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
 ref|XP_006347935.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Solanum tuberosum]
Length=420

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 134/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP++SDN+KYYE+LGVSK+ASQ++LKKAYRK+AI+NHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKR+IYDQYGEDALKE    GGGG+H+ FDIF+SFF G+  GGG   R  RQ+RGE
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGSGGGGVHNHFDIFESFFSGSFGGGGSRFRASRQKRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH L+VSLEDLYNGT+KKLSLSR++L
Sbjct  121  DVVHTLRVSLEDLYNGTTKKLSLSRSIL  148



>ref|XP_007015640.1| DNAJ isoform 1 [Theobroma cacao]
 gb|EOY33259.1| DNAJ isoform 1 [Theobroma cacao]
Length=431

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+A KNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKTAFKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALK+   G  G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKD-GMGATGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+H +KVSLEDLY GTSKKLSLSRN+L
Sbjct  119  VIHNMKVSLEDLYLGTSKKLSLSRNIL  145



>ref|XP_004953339.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=421

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 135/150 (90%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKK-SDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P+K S+NTKYYE+LGVSK+ASQ++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAYE
Sbjct  1    MFGRMPRKTSNNTKYYEVLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrr  476
            VLSDPEKREIYDQYGEDALKEGMGGG     H PFDIF+  F G+   GGGSSRGRRQ+R
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDIFEQLFPGSGTFGGGSSRGRRQKR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVH +KVSLEDLYNGT+KKLSLSR+VL
Sbjct  121  GEDVVHTMKVSLEDLYNGTTKKLSLSRSVL  150



>gb|AES67168.2| DnaJ-class molecular chaperone [Medicago truncatula]
Length=327

 Score =   194 bits (492),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNAS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKRE+YDQYGEDALKEGMGGGGG HDPFDIF SFFGG  F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGFPGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVL  147



>ref|XP_002446897.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
 gb|EES11225.1| hypothetical protein SORBIDRAFT_06g024520 [Sorghum bicolor]
Length=418

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP++S+NTKYYE+LGVS  ASQ++LKKAYRK+AIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSNNTKYYEVLGVSNTASQDELKKAYRKAAIKSHPDKGGDPEKFKELSQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGED LKEGMGGG   H+PFDIF+  F G    GG SSR RRQ+RG+D
Sbjct  61   LSDPEKREIYDQYGEDGLKEGMGGGSDYHNPFDIFE-QFFGGGAFGGSSSRVRRQKRGDD  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLED+YNG +K+LSLSRNVL
Sbjct  120  VVHSLKVSLEDVYNGATKRLSLSRNVL  146



>gb|KDP42967.1| hypothetical protein JCGZ_23909 [Jatropha curcas]
Length=418

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG H PFDIF+SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHSPFDIFESFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GT+KKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYLGTTKKLSLSRNVI  147



>ref|XP_004976432.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++S+NTKYYE+LGVS  ASQ++LKKAYRK+AIK+HPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPRRSNNTKYYEVLGVSSTASQDELKKAYRKAAIKSHPDKGGDPEKFKELSQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGED LKEGMGGGG  H+PFDIF+  F G    GG  SR RRQ+RGED
Sbjct  61   LSDPEKREIYDQYGEDGLKEGMGGGGDFHNPFDIFE-QFFGGGSFGGSRSRVRRQKRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLED+YNG +KKLSLSRNVL
Sbjct  120  VVHSLKVSLEDVYNGATKKLSLSRNVL  146



>ref|XP_003521084.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN43746.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 139/148 (94%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRA-PKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR  P++SDN+KYY+ILG+SKNAS++++KKAYRK+A+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGISKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEK+E+YDQYGEDALKEGMGGGG  H+PFDIF+SFFGG  FGGGGSSRGRRQ+ GE
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLED+YNGT+KKLSLSRN+L
Sbjct  121  DVVHSLKVSLEDVYNGTTKKLSLSRNIL  148



>gb|ACU24346.1| unknown [Glycine max]
Length=420

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 139/148 (94%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRA-PKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR  P++SDN+KYY+ILG+SKNAS++++KKAYRK+A+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGISKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEK+E+YDQYGEDALKEGMGGGG  H+PFDIF+SFFGG  FGGGGSSRGRRQ+ GE
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLED+YNGT+KKLSLSRN+L
Sbjct  121  DVVHSLKVSLEDVYNGTTKKLSLSRNIL  148



>gb|EEE57509.1| hypothetical protein OsJ_07792 [Oryza sativa Japonica Group]
Length=452

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 131/162 (81%), Gaps = 9/162 (6%)
 Frame = +3

Query  87   PSTLPSILIDS*KMFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGD  266
            P T P + +    M+GR PKKS+NTKYYE+LGVSK A+Q++LKKAYRK+AIKNHPDKGGD
Sbjct  24   PPTKPFLSV----MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGD  79

Query  267  PEKFKELAQAYEVLSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfg  440
            PEKFKELAQAYEVL+DPEKREIYDQYGEDALKEGMGGG     H PFD+F+         
Sbjct  80   PEKFKELAQAYEVLNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDLFE---QIFQNR  136

Query  441  gggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GG   RG RQ+RGEDVVH +KVSLEDLYNGT+KKLSLSRN L
Sbjct  137  GGFGGRGHRQKRGEDVVHTMKVSLEDLYNGTTKKLSLSRNAL  178



>ref|XP_002983333.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
 ref|XP_002987616.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ11191.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ15675.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
Length=419

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDN+KYY+ILGVSK+AS ++LKKAYRK+AIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRPPKKSDNSKYYDILGVSKSASADELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEK+EIYDQYGEDALKE   GGGG H+PFDIF SFFGG PFGGG S  GRRQRRGED
Sbjct  61   LSDPEKKEIYDQYGEDALKE-GMGGGGGHNPFDIFDSFFGGKPFGGGSSRGGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLYNG+ KKLSLSRN +
Sbjct  120  VVHPLKVSLEDLYNGSVKKLSLSRNAI  146



>gb|EYU37228.1| hypothetical protein MIMGU_mgv1a006942mg [Erythranthe guttata]
Length=425

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 130/152 (86%), Gaps = 5/152 (3%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKS+NTKYYEILGV KNAS +DLKKAYRK AIKNHPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRGPPKKSNNTKYYEILGVEKNASPDDLKKAYRKLAIKNHPDKGGDPEKFKEIAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQs---ffggnpfggggssrgrrq  470
            VL+DPEKREIYDQYGEDALKE   GGGGG H+PFDIF+S     G    GGGGS   RR 
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGGGGHNPFDIFESFFGASGNPFGGGGGSRGQRRV  120

Query  471  rrgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            RRGEDVVHPLKVSL+DLYNGTSKKLSLSRNVL
Sbjct  121  RRGEDVVHPLKVSLDDLYNGTSKKLSLSRNVL  152



>emb|CDP09461.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 4/147 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP++S+N+KYYE+LGVSK+ASQ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPRRSNNSKYYEVLGVSKSASQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKRE+YDQYGEDALKE   GGGG+HDPFDIF+                 R+++GED
Sbjct  61   LSDPEKRELYDQYGEDALKE-GMGGGGVHDPFDIFE---SFFSPLHRRDGFRGRKKQGED  116

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSL+DLY GTSKKLSLSRN L
Sbjct  117  VVHTLKVSLDDLYKGTSKKLSLSRNKL  143



>gb|EEC73725.1| hypothetical protein OsI_08334 [Oryza sativa Indica Group]
Length=420

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 126/149 (85%), Gaps = 5/149 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            M+GR PKKS+NTKYYE+LGVSK A+Q++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrrg  479
            L+DPEKREIYDQYGEDALKEGMGGG     H PFD+F+         GG   RG RQ+RG
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDLFE---QIFQNRGGFGGRGHRQKRG  117

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVH +KVSLEDLYNGT+KKLSLSRN L
Sbjct  118  EDVVHTMKVSLEDLYNGTTKKLSLSRNAL  146



>ref|NP_001047626.1| Os02g0656500 [Oryza sativa Japonica Group]
 emb|CAC39071.1| DnaJ-like protein [Oryza sativa]
 dbj|BAF09540.1| Os02g0656500 [Oryza sativa Japonica Group]
Length=420

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 126/149 (85%), Gaps = 5/149 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            M+GR PKKS+NTKYYE+LGVSK A+Q++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrrg  479
            L+DPEKREIYDQYGEDALKEGMGGG     H PFD+F+         GG   RG RQ+RG
Sbjct  61   LNDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDLFE---QIFQNRGGFGGRGHRQKRG  117

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVH +KVSLEDLYNGT+KKLSLSRN L
Sbjct  118  EDVVHTMKVSLEDLYNGTTKKLSLSRNAL  146



>ref|XP_006345526.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
 ref|XP_006345527.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
 ref|XP_006345528.1| PREDICTED: dnaJ protein homolog isoform X3 [Solanum tuberosum]
 ref|XP_006345529.1| PREDICTED: dnaJ protein homolog isoform X4 [Solanum tuberosum]
Length=419

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR  ++SDN+KYYE+LGVSKN+SQ++LKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVSKNSSQDELKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKRE+YDQYGEDALKE   GGGG H+PFDI    F G  FGGGGS RG R+++GED
Sbjct  61   LSDPEKRELYDQYGEDALKE-GMGGGGGHNPFDI-FESFFGGAFGGGGSFRGSRKKKGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH L+VSLEDLYNGT+KKLSLSRN+L
Sbjct  119  VVHTLRVSLEDLYNGTTKKLSLSRNIL  145



>ref|XP_003529049.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN34491.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 138/148 (93%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRA-PKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR  P++SDN+KYY+ILGVSKNAS++++KKAYRK+A+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRRSDNSKYYDILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEK+++YDQYGEDALKEGMGGGG  H+PFDIF+SFFGG  FGGGGSSRGRRQ+ GE
Sbjct  61   VLSDPEKKDLYDQYGEDALKEGMGGGGSFHNPFDIFESFFGGASFGGGGSSRGRRQKHGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLED+YNGT+KKLSLSRNV 
Sbjct  121  DVVHSLKVSLEDVYNGTTKKLSLSRNVF  148



>dbj|BAK03083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 4/151 (3%)
 Frame = +3

Query  126  MFGRAPKK-SDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P+K S+NTKYYE+LGVSK A+ ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAY+
Sbjct  1    MFGRMPRKTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYD  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIF-Qsffggnpfggggssrgrrqr  473
            VL+DPEKREIYDQYGEDALKEGMGGGG    H PFDIF Q F GG    GGGSSRGRRQ+
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGSSDMHSPFDIFEQLFGGGGGGFGGGSSRGRRQK  120

Query  474  rgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            RGEDVVH +KVSLEDLYNG +KKLSLSRNVL
Sbjct  121  RGEDVVHTMKVSLEDLYNGATKKLSLSRNVL  151



>ref|XP_003596916.1| DnaJ [Medicago truncatula]
 gb|AES67167.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=417

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGVSKNAS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKRE+YDQYGEDALKEGMGGGGG HDPFDIF SFFGG  F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGFPGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVL  147



>gb|KJB35427.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=248

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKS NT+YYEILGVS NASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGG G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVI  146



>ref|XP_004506241.1| PREDICTED: dnaJ protein homolog ANJ1-like [Cicer arietinum]
Length=418

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSD+T+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRQPKKSDSTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYD YGEDALKEGMGGGGG HDPFDIF SFFGGN FGGGG SRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGNHFGGGGGSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVL  147



>ref|XP_006647627.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Oryza brachyantha]
Length=422

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 125/149 (84%), Gaps = 5/149 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKS+NTKYYE+LGVSK A+Q++LKKAYRK+AIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrrg  479
            L+DPEKR+IYDQYGEDALKEGMGGG     H PFD+F+          G   RG RQ+RG
Sbjct  61   LNDPEKRDIYDQYGEDALKEGMGGGSSSDFHSPFDLFE---QLFQGRSGFGGRGHRQKRG  117

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVH +KVSLEDLYNGT+KKLSLSRN L
Sbjct  118  EDVVHTMKVSLEDLYNGTTKKLSLSRNAL  146



>ref|XP_008443634.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 135/147 (92%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDIFQ  F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQ-SFFGGSPFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  119  VVHPLKVSLEDLYLGTSKKLSLSRNVI  145



>ref|XP_006647626.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Oryza brachyantha]
Length=423

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 126/149 (85%), Gaps = 4/149 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKS+NTKYYE+LGVSK A+Q++LKKAYRK+AIKNHPDKGGDPEKFKE++QAYEV
Sbjct  1    MFGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKEISQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrrg  479
            L+DPEKR+IYDQYGEDALKEGMGGG     H PFD+F+         G G  RG RQ+RG
Sbjct  61   LNDPEKRDIYDQYGEDALKEGMGGGSSSDFHSPFDLFE--QLFQGRSGFGVGRGHRQKRG  118

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVH +KVSLEDLYNGT+KKLSLSRN L
Sbjct  119  EDVVHTMKVSLEDLYNGTTKKLSLSRNAL  147



>emb|CDP15561.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNAS EDLKKAY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQ  F        GSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQ-TFFNGDPFNRGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY+GT+KKLSLSRNV+
Sbjct  120  VVHPLKVSLEDLYSGTTKKLSLSRNVI  146



>ref|XP_006340318.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X1 [Solanum 
tuberosum]
Length=419

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRA-PKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR   KKSDNT++YEILGVSKNAS++++KKAYRK+A+KNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGGKKKSDNTRFYEILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSD +KREIYDQYGE+ALKEGMGGGGG HDPFD+F SFF G+PFGGGG  RG+R+RRG+
Sbjct  61   VLSDSQKREIYDQYGEEALKEGMGGGGGTHDPFDLFNSFFSGSPFGGGGGRRGQRERRGD  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY G +KKLSLSRNV+
Sbjct  121  DVVHPLKVSLEDLYTGITKKLSLSRNVI  148



>ref|XP_004487721.1| PREDICTED: dnaJ protein homolog [Cicer arietinum]
Length=343

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP KSDNTKYYEILGVSK+ASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPTKSDNTKYYEILGVSKSASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI  S F G     GG  R RRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGGFSGGGGRVRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVL  146



>gb|KJB09149.1| hypothetical protein B456_001G126200 [Gossypium raimondii]
Length=416

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNAS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGG   HDPFDIF S F G    GG SSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAAAHDPFDIF-SSFFGGSPFGGASSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVI  146



>gb|EYU37227.1| hypothetical protein MIMGU_mgv1a006922mg [Erythranthe guttata]
Length=426

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 130/152 (86%), Gaps = 5/152 (3%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGRAP KKSDN KYYEILGV K AS +DLKKAYRK AIKNHPDKGGDPEKFKE+AQAYE
Sbjct  1    MFGRAPPKKSDNNKYYEILGVEKTASPDDLKKAYRKLAIKNHPDKGGDPEKFKEIAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQs---ffggnpfggggssrgrrq  470
            VL+DPEKREIYDQYGEDALKE   GGGGG H+PFDIF+S     G    GGGGS   RRQ
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGGGGGHNPFDIFESFFGGSGHPFGGGGGSRGQRRQ  120

Query  471  rrgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            RRGEDVVHPLKVSL++LYNGTSKKLSLSRNVL
Sbjct  121  RRGEDVVHPLKVSLDNLYNGTSKKLSLSRNVL  152



>ref|NP_001136581.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACF82216.1| unknown [Zea mays]
 gb|AFW72634.1| putative dnaJ chaperone family protein [Zea mays]
Length=422

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKS-DNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P+KS +NTKYYE+LGVSK ASQ++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAY+
Sbjct  1    MFGRMPRKSSNNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYD  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrr  476
            VLSDPEKREIYDQYGEDALKEGMGGG     H PFDIF+  F G+   GGGSSRGRRQ+R
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGSSSDFHSPFDIFEQLFPGSSTFGGGSSRGRRQKR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVH +KVSL+DLYNGT+KKLSLSR+ L
Sbjct  121  GEDVVHTMKVSLDDLYNGTTKKLSLSRSAL  150



>gb|EYU36024.1| hypothetical protein MIMGU_mgv1a007013mg [Erythranthe guttata]
Length=422

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 138/150 (92%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGRAP  KSDNTKYYE+LGV K AS +DLKKAYRK+AIKNHPDKGGDPEKFKELA AYE
Sbjct  1    MFGRAPPSKSDNTKYYEVLGVPKTASPDDLKKAYRKAAIKNHPDKGGDPEKFKELAHAYE  60

Query  303  VLSDPEKREIYDQYGEDALKE--gmgggggmHDPFDIFQsffggnpfggggssrgrrqrr  476
            VLSDPEKREIYDQYGEDALKE  G GGGGGMHDPFDIF SFFGG+PFGGGGSSRGRRQRR
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVH LKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  GEDVVHALKVSLEDLYLGTSKKLSLSRNVL  150



>ref|XP_010263054.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=416

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNT+YYEILGV KNAS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRQPKKSDNTRYYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+HPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  VIHPLKVSLEDLYVGTSKKLSLSRNVI  146



>gb|AFK37703.1| unknown [Medicago truncatula]
Length=417

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEI GVSKNAS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEIPGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKRE+YDQYGEDALKEGMGGGGG HDPFDIF SFFGG  F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGFPGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVL  147



>ref|XP_004251216.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=418

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRA-PKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR   KKSDNTK+YEILGVSKNAS++++KKAYRK+A+KNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGGKKKSDNTKFYEILGVSKNASEDEIKKAYRKAAMKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSD +KREIYDQYGE+ALKEGMGGGGG HDPFD+F   F      GGG  RG+R+RRG+
Sbjct  61   VLSDSQKREIYDQYGEEALKEGMGGGGGTHDPFDLFN-SFFSGSPFGGGGRRGQRERRGD  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLYNG +KKLSLSRNV+
Sbjct  120  DVVHPLKVSLEDLYNGMTKKLSLSRNVI  147



>ref|XP_004139085.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 gb|KGN66611.1| DnaJ [Cucumis sativus]
Length=413

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 135/147 (92%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDIFQ  F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFQ-SFFGGSPFGGGSSRGRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  119  VVHPLKVSLEDLYLGTSKKLSLSRNVI  145



>ref|XP_002511620.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF50289.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=391

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFG  P++SDNTKYYE+LGV KNASQ+++KKAYRK+AIKNHPDKGGD EKFKEL+ AYEV
Sbjct  1    MFGYGPRRSDNTKYYEVLGVPKNASQDEMKKAYRKAAIKNHPDKGGDSEKFKELSHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDP+KREIYDQYGE ALKEGMGGGG  H+PFDIF S FG   FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPQKREIYDQYGEAALKEGMGGGGSGHNPFDIFDSLFGRGAFGGGGSSRGRRQKRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V+H  KVSLEDLYNGT++KLSLSRNV 
Sbjct  121  VLHATKVSLEDLYNGTTRKLSLSRNVF  147



>gb|KJB35428.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=318

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKS NT+YYEILGVS NASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGG G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVI  146



>ref|XP_007150008.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
 gb|ESW22002.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
Length=418

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGV+KNAS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVAKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSD EKREIYD YGEDALKEGM GGGG HDPFDIF SFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDAEKREIYDTYGEDALKEGMSGGGGGHDPFDIFSSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVL  147



>gb|KHG17902.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=417

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 136/147 (93%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKS+NT+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGG G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVI  146



>ref|XP_009411580.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=425

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 8/155 (5%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYE+LGV  +A+Q++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEVLGVPNSANQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggm----HDPFDIFQs----ffggnpfggggssrg  461
            LSDPEKREIYD+YGEDALKEGMGGG G     H PFDIF+        G    GGGSSRG
Sbjct  61   LSDPEKREIYDKYGEDALKEGMGGGSGGGGGFHSPFDIFEQFFGGSTFGGGSFGGGSSRG  120

Query  462  rrqrrgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            RRQ++GEDVVH LKVSLED+YNGTSKKLSLSR+ L
Sbjct  121  RRQKQGEDVVHSLKVSLEDVYNGTSKKLSLSRSAL  155



>ref|XP_009622737.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
 ref|XP_009622738.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
Length=421

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP++SDN+KYYE+LGVSK+ASQ++LKKAYRK+AI+NHPDKGGDPEKFK LAQAY+V
Sbjct  1    MFGRAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKGLAQAYDV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggm-HDPFDIFQ-sffggnpfggggssrgrrqrrg  479
            LSDPEKR+IYDQYGEDALKEGMG  GG  H  FDIF+  F GG+  GG    R  RQ++G
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGSSGGGVHSHFDIFESFFGGGSFGGGSSRFRASRQKQG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVH L+VSLEDLYNGT+KKLSLSRN L
Sbjct  121  EDVVHTLRVSLEDLYNGTTKKLSLSRNRL  149



>ref|XP_004229763.1| PREDICTED: dnaJ protein homolog 2-like [Solanum lycopersicum]
Length=424

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 135/152 (89%), Gaps = 5/152 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFG+AP++SDN+KYYE+LGVSK+ASQ++LKKAYRK+AI+NHPDKGGDPEKFKEL QAYEV
Sbjct  1    MFGQAPRRSDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELGQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-----gmgggggmHDPFDIFQsffggnpfggggssrgrrq  470
            L DPEKR+IYDQYGEDALKE     G GGGGG+H+ FDIF+SFFGG+  GGG   R  RQ
Sbjct  61   LIDPEKRDIYDQYGEDALKEGMGSGGGGGGGGVHNHFDIFESFFGGSFGGGGSHFRASRQ  120

Query  471  rrgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            +RGEDVVH L+VSLEDLYNGT+KKLSLSR++L
Sbjct  121  KRGEDVVHTLRVSLEDLYNGTTKKLSLSRSIL  152



>ref|XP_009382439.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=423

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MF RA +KSDNTKYYEILGV K+ASQ++LKKAYRK+AI+NHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFARAQRKSDNTKYYEILGVPKSASQDELKKAYRKAAIRNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQs----ffggnpfggggssrgrr  467
            LSDPEKREIYD+YGEDALKEG+GGGGG   H+PF+IF+        G    GGGSSRGRR
Sbjct  61   LSDPEKREIYDKYGEDALKEGIGGGGGGSFHNPFEIFEQFFGGSSFGGGSFGGGSSRGRR  120

Query  468  qrrgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            Q+RGEDVVH LKVSLEDLYNGTSKKLSLSRN L
Sbjct  121  QKRGEDVVHSLKVSLEDLYNGTSKKLSLSRNAL  153



>sp|P43644.1|DNJH_ATRNU RecName: Full=DnaJ protein homolog ANJ1; Flags: Precursor [Atriplex 
nummularia]
Length=417

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGV K+AS EDLKKAY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVPKDASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGG+PFGG GSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFQSFFGGSPFGGVGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDL+ GT+KKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLFTGTTKKLSLSRNVI  147



>gb|KHN17991.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGVSKNAS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYD YGEDALKEGMGGGGG HDPFDIF SFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGSGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVL  147



>ref|NP_001240264.1| uncharacterized protein LOC100818805 [Glycine max]
 gb|ACU23708.1| unknown [Glycine max]
Length=417

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGVSKNAS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYD YGEDALKEGMGGGGG HDPFDIF SFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGSGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVL  147



>ref|XP_003540271.1| PREDICTED: dnaJ protein homolog [Glycine max]
Length=417

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGVSKNAS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKNASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYD YGEDALKEGMGGGGG HDPFDIF SFFGG+PFG GGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGSGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  VVHPLKVSLEDLYLGTSKKLSLSRNVL  147



>ref|XP_009596179.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596180.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596181.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596182.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009596183.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=421

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR  ++SDN+KYYE+LGVSKN+SQ++LKKAYRK+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVSKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI---FQsffggnpfggggssrgrrqrr  476
            LSDPEKREIYDQYGEDALKEGMGGGGG H+PFDI   F     G  FGGGGS RG R+++
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHNPFDIFESFFGGGFGGAFGGGGSFRGSRKKQ  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GE+ VH L+VSLEDLY+GT+KKLSLSRN+L
Sbjct  121  GENAVHTLRVSLEDLYSGTTKKLSLSRNIL  150



>ref|XP_006424068.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 ref|XP_006487844.1| PREDICTED: dnaJ protein homolog ANJ1-like [Citrus sinensis]
 gb|ESR37308.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 gb|KDO48965.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=416

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKS+NT+YYEILGVSKNAS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSNNTRYYEILGVSKNASAEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGG G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVI  146



>ref|XP_002454540.1| hypothetical protein SORBIDRAFT_04g032970 [Sorghum bicolor]
 gb|EES07516.1| hypothetical protein SORBIDRAFT_04g032970 [Sorghum bicolor]
Length=420

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 130/150 (87%), Gaps = 4/150 (3%)
 Frame = +3

Query  126  MFGRAPKKS-DNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P+KS +NTKYYE+LGVSK ASQ++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAY+
Sbjct  1    MFGRMPRKSSNNTKYYEVLGVSKTASQDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYD  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrr  476
            VLSDPEKREIYDQYGEDALKEGMGGGG    H PFDIF+        G GG SRGRRQ+R
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGSSDFHSPFDIFE-QLFPGSSGFGGGSRGRRQKR  119

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVH +KVSLEDLYNGT+KKLSLSR+ L
Sbjct  120  GEDVVHTMKVSLEDLYNGTTKKLSLSRSAL  149



>ref|XP_003570021.1| PREDICTED: dnaJ protein homolog 2-like [Brachypodium distachyon]
Length=423

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKK-SDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR PKK S+NTKYYE+LGVSK A+ ++LKKAYRK+AIKNHPDKGGDPEKFKELA AY+
Sbjct  1    MFGRMPKKTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYD  60

Query  303  VLSDPEKREIYDQYGEDALKEgmggggg-mHDPFDIF-Qsffggnpfggggssrgrrqrr  476
            VL+DPEKREIYDQYGEDALKEGMGGG   MH PFDIF Q F GG    GGGSSRGRRQ+R
Sbjct  61   VLNDPEKREIYDQYGEDALKEGMGGGSSDMHSPFDIFEQLFGGGGGGFGGGSSRGRRQKR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVH +KVSLEDLYNG +KKLSLSRNVL
Sbjct  121  GEDVVHTMKVSLEDLYNGATKKLSLSRNVL  150



>ref|XP_007134513.1| hypothetical protein PHAVU_010G053900g [Phaseolus vulgaris]
 gb|ESW06507.1| hypothetical protein PHAVU_010G053900g [Phaseolus vulgaris]
Length=423

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 139/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRA-PKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR  P+KSDN+KYY+ILGVSKNA+++++KKAYRK+A+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGGPRKSDNSKYYDILGVSKNATEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggm-HDPFDIFQsffggnpfggggssrgrrqrrg  479
            VL DPEK+E+YDQYGEDALK+GMGGGG   H+PFDIF+SFFGG+ FGGGGSSRGRRQ++G
Sbjct  61   VLGDPEKKEMYDQYGEDALKDGMGGGGSSFHNPFDIFESFFGGSSFGGGGSSRGRRQKQG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVH LKVSLED+YNG +KKLSLSRNVL
Sbjct  121  EDVVHSLKVSLEDVYNGANKKLSLSRNVL  149



>ref|XP_003626730.1| DnaJ protein-like protein [Medicago truncatula]
 gb|AET01206.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=423

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P +KSDNTKYY+ILGVSK+AS++++KKAYRK+A+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrr  476
            VLSDPEK+E+YDQYGEDALKEGMGGG G   H+PFDIF+  F G  FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDIFE-SFFGAGFGGGGPSRARRQKQ  119

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVH +KVSLED+YNGT+KKLSLSRN L
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLSRNAL  149



>gb|ACJ84518.1| unknown [Medicago truncatula]
Length=423

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P +KSDNTKYY+ILGVSK+AS++++KKAYRK+A+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrr  476
            VLSDPEK+E+YDQYGEDALKEGMGGG G   H+PFDIF+  F G  FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDIFE-SFFGAGFGGGGPSRARRQKQ  119

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVH +KVSLED+YNGT+KKLSLSRN L
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLSRNAL  149



>gb|KJB35426.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=417

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKS NT+YYEILGVS NASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGG G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVI  146



>ref|XP_008230416.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=418

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVS+NAS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLED+Y GTSKKLSLSRNVL
Sbjct  121  VVHSLKVSLEDIYLGTSKKLSLSRNVL  147



>ref|XP_007205259.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
 gb|EMJ06458.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
Length=418

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVS+NAS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQNASHDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLED+Y GTSKKLSLSRNVL
Sbjct  121  VVHSLKVSLEDIYLGTSKKLSLSRNVL  147



>emb|CAA04447.1| DnaJ-like protein [Medicago sativa]
 gb|AAC19391.1| DnaJ-like protein MsJ1 [Medicago sativa]
Length=423

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P +KSDNTKYY+ILGVSK+AS++++KKAYRK+A+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNTKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrr  476
            VLSDPEK+E+YDQYGEDALKEGMGGG G   H+PFDIF+  F G  FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDIFE-SFFGAGFGGGGPSRARRQKQ  119

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVH +KVSLED+YNGT+KKLSLSRN L
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLSRNAL  149



>dbj|BAD25681.1| putative DnaJ-like protein MsJ1 [Oryza sativa Japonica Group]
Length=416

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 5/144 (3%)
 Frame = +3

Query  141  PKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEVLSDPE  320
            PKKS+NTKYYE+LGVSK A+Q++LKKAYRK+AIKNHPDKGGDPEKFKELAQAYEVL+DPE
Sbjct  2    PKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLNDPE  61

Query  321  KREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrrgEDVVH  494
            KREIYDQYGEDALKEGMGGG     H PFD+F+         GG   RG RQ+RGEDVVH
Sbjct  62   KREIYDQYGEDALKEGMGGGSSSDFHSPFDLFE---QIFQNRGGFGGRGHRQKRGEDVVH  118

Query  495  PLKVSLEDLYNGTSKKLSLSRNVL  566
             +KVSLEDLYNGT+KKLSLSRN L
Sbjct  119  TMKVSLEDLYNGTTKKLSLSRNAL  142



>gb|KJB35429.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=444

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKS NT+YYEILGVS NASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSTNTRYYEILGVSNNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGG G HDPFDI  S F G    GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGAGAHDPFDI-FSSFFGGSPFGGGSSRGRRQRRGED  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  VVHPLKVSLEDLYLGTSKKLSLSRNVI  146



>ref|NP_001238341.1| seed maturation protein PM37 [Glycine max]
 gb|AAD51625.1|AF169022_1 seed maturation protein PM37 [Glycine max]
 gb|KHN21201.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDI    F GG+PFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVI  147



>gb|AGY48888.1| MIP1L1 [Nicotiana benthamiana]
Length=423

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 129/150 (86%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR  ++SDN+KYYE+LGV KN+SQ++LKKAYRK+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSDNSKYYEVLGVPKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI---FQsffggnpfggggssrgrrqrr  476
            +SDPEKREIYDQYGEDAL EGMGGGGG H+PFDI   F        FGGGGS RG R+++
Sbjct  61   ISDPEKREIYDQYGEDALNEGMGGGGGGHNPFDIFESFFGGGFDGAFGGGGSFRGSRKKQ  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GE+ VH L+VSLEDLYNGT+KKLSLSRN+L
Sbjct  121  GENAVHTLRVSLEDLYNGTTKKLSLSRNIL  150



>ref|XP_006590333.1| PREDICTED: uncharacterized protein LOC100808604 isoform X1 [Glycine 
max]
 gb|KHN13055.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDI    F GG+PFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVI  147



>ref|XP_006837307.1| hypothetical protein AMTR_s00111p00054240 [Amborella trichopoda]
 gb|ERN00161.1| hypothetical protein AMTR_s00111p00054240 [Amborella trichopoda]
Length=304

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP++ DN++YY+ILGVSKNASQ++LKKAY+K+AIKNHPDKGGDPEKFKELAQAY+V
Sbjct  1    MFGRAPRRGDNSRYYDILGVSKNASQDELKKAYKKAAIKNHPDKGGDPEKFKELAQAYDV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKRE+YDQYGEDALKEGMGG G  H+PFDIF+  F G    GGGSSRGRRQ++G+D
Sbjct  61   LSDPEKREVYDQYGEDALKEGMGGAGPSHNPFDIFE-SFFGGGGFGGGSSRGRRQKQGDD  119

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGTSKKLSLSRNVL
Sbjct  120  VVHSLKVSLEDLYNGTSKKLSLSRNVL  146



>gb|EMS60670.1| DnaJ protein-like protein [Triticum urartu]
Length=446

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 139/175 (79%), Gaps = 29/175 (17%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEK---------  275
            MFGR P KKSD+T+YYEILGV K+ASQ+DLKKAYRK+AIKNHPDKGGDPEK         
Sbjct  1    MFGRGPPKKSDSTRYYEILGVPKDASQDDLKKAYRKAAIKNHPDKGGDPEKVSARRISHP  60

Query  276  ----------------FKELAQAYEVLSDPEKREIYDQYGEDALKEgmgggggmHDPFDI  407
                            FKELAQAYEVLSDPEKREIYDQYGEDALKE   GGGGMHDPFDI
Sbjct  61   STTDLFPIGITRLVDLFKELAQAYEVLSDPEKREIYDQYGEDALKE-GMGGGGMHDPFDI  119

Query  408  FQ--sffggnpfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            FQ     GGNPFGGGGSSRGRRQRRGEDVVHPLKVSLE+LYNGTSKKLSL+RNVL
Sbjct  120  FQSFFGGGGNPFGGGGSSRGRRQRRGEDVVHPLKVSLEELYNGTSKKLSLARNVL  174



>emb|CAH67501.1| OSIGBa0134H18.3 [Oryza sativa Indica Group]
 gb|EAY95074.1| hypothetical protein OsI_16890 [Oryza sativa Indica Group]
Length=416

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P+ S+NTKYYE+LGV K AS+++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            L+DPEKR+IYDQYGEDALK+GMGGG   H+PFDIF+  F G    GG SSR RRQRRGED
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDIFE-QFFGGGAFGGSSSRVRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLED+YNG+ KKLSLSRN+L
Sbjct  119  VVHTLKVSLEDVYNGSMKKLSLSRNIL  145



>ref|XP_007132506.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
 gb|ESW04500.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
Length=418

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKRE+YDQYGEDALKE   GGGG HDPFDI    F GG+PFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVI  147



>gb|AFK48766.1| unknown [Medicago truncatula]
Length=423

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 133/150 (89%), Gaps = 4/150 (3%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P +KSDN KYY+ILGVSK+AS++++KKAYRK+A+KNHPDKGGDPEKFKEL QAYE
Sbjct  1    MFGRGPTRKSDNAKYYDILGVSKSASEDEIKKAYRKAAMKNHPDKGGDPEKFKELGQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggm--HDPFDIFQsffggnpfggggssrgrrqrr  476
            VLSDPEK+E+YDQYGEDALKEGMGGG G   H+PFDIF+  F G  FGGGG SR RRQ++
Sbjct  61   VLSDPEKKELYDQYGEDALKEGMGGGAGSSFHNPFDIFE-SFFGAGFGGGGPSRARRQKQ  119

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVH +KVSLED+YNGT+KKLSLSRN L
Sbjct  120  GEDVVHSIKVSLEDVYNGTTKKLSLSRNAL  149



>gb|AHA84223.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKRE+YDQYGEDALKE   GGGG HDPFDI    F GG+PFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVI  147



>ref|NP_001242510.1| uncharacterized protein LOC100808604 [Glycine max]
 gb|ACU21221.1| unknown [Glycine max]
Length=410

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 133/147 (90%), Gaps = 7/147 (5%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT++YEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRHYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKE   GGGG HDPFDI       + F GGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKE-GMGGGGGHDPFDI------FSSFFGGGSSRGRRQRRGED  113

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  114  VVHPLKVSLEDLYLGTSKKLSLSRNVI  140



>gb|ACJ85577.1| unknown [Medicago truncatula]
Length=263

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 132/148 (89%), Gaps = 4/148 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGVSK ASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYD YGEDALKE   GGGGG HDPFDIF         GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGGHDPFDIFS---SFFGGGGGGSSRGRRQRRGE  117

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  118  DVVHPLKVSLEDLYLGTSKKLSLSRNVL  145



>ref|XP_009779099.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009779100.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=423

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 129/150 (86%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR  ++S+N+KYYE+LGV KN+SQ++LKKAYRK+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRGARRSENSKYYEVLGVPKNSSQDELKKAYRKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI---FQsffggnpfggggssrgrrqrr  476
            LSDPEKREIYDQYGEDAL EGMGGGGG H PFDI   F     G  FGGGGS RG R+++
Sbjct  61   LSDPEKREIYDQYGEDALNEGMGGGGGGHSPFDIFESFFGGGFGGAFGGGGSFRGSRKKQ  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GE+ VH L+VSLEDLYNGT+KKLSLSRN+L
Sbjct  121  GENAVHALRVSLEDLYNGTTKKLSLSRNIL  150



>gb|AHA84264.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKRE+YDQYGEDALKE   GGGG HDPFDI    F GG+PFG GGSSRGRRQRRGE
Sbjct  61   LSDPEKREVYDQYGEDALKE-GMGGGGGHDPFDIFSSFFGGGSPFGSGGSSRGRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GTSKKLSLSRNV+
Sbjct  120  DVVHPLKVSLEDLYLGTSKKLSLSRNVI  147



>dbj|BAA76883.1| DnaJ homolog protein [Salix gilgiana]
 dbj|BAA76888.1| DnaJ homolog protein [Salix gilgiana]
Length=423

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 139/149 (93%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAP++SDNTKYYE+L VSK ASQ++LKKAY+K+AIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRAPRRSDNTKYYEVLAVSKGASQDELKKAYKKAAIKNHPDKGGDPEKFKELSQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE--gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrg  479
            LSDP+KREIYDQYGEDALKE  G GGGGG H+PFDIF+SFFGG  FGGG SSRGRRQ++G
Sbjct  61   LSDPDKREIYDQYGEDALKEGMGPGGGGGGHNPFDIFESFFGGGGFGGGSSSRGRRQKQG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDV HPLKVSLEDLYNGTSKKLSLSRN+L
Sbjct  121  EDVAHPLKVSLEDLYNGTSKKLSLSRNIL  149



>ref|NP_001053485.1| Os04g0549600 [Oryza sativa Japonica Group]
 dbj|BAF15399.1| Os04g0549600 [Oryza sativa Japonica Group]
 dbj|BAG95310.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61449.1| hypothetical protein OsJ_15688 [Oryza sativa Japonica Group]
Length=416

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P+ S+NTKYYE+LGV K AS+++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            L+DPEKR+IYDQYGEDALK+GMGGG   H+PFDIF+  F G    GG SSR RRQRRGED
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDIFE-QFFGGGAFGGSSSRVRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V H LKVSLED+YNG+ KKLSLSRN+L
Sbjct  119  VAHTLKVSLEDVYNGSMKKLSLSRNIL  145



>gb|ABY52936.1| DnaJ family heat shock protein [Oryza sativa Japonica Group]
Length=416

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P+ S+NTKYYE+LGV K AS+++LKKAYRK+AIKNHPDKGGDPEKFKEL+QAYEV
Sbjct  1    MFGRVPR-SNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEV  59

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            L+DPEKR+IYDQYGEDALK+GMGGG   H+PFDIF+  F G    GG SSR RRQRRGED
Sbjct  60   LTDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDIFE-QFFGGGAFGGSSSRVRRQRRGED  118

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            V H LKVSLED+YNG+ KKLSLSRN+L
Sbjct  119  VAHTLKVSLEDVYNGSMKKLSLSRNIL  145



>ref|XP_010089798.1| DnaJ-like protein [Morus notabilis]
 gb|EXB38414.1| DnaJ-like protein [Morus notabilis]
Length=440

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +3

Query  138  APKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEVLSDP  317
            APKKSDNT+YY+ILGVSKNASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEVLSDP
Sbjct  28   APKKSDNTRYYDILGVSKNASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDP  87

Query  318  EKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgEDVVHP  497
            EKREIYDQYGEDALKEGMGGG   HDPFDIFQ  F G    GG S  GRRQRRGED+VHP
Sbjct  88   EKREIYDQYGEDALKEGMGGGADGHDPFDIFQ-SFFGGNPFGGSSKGGRRQRRGEDIVHP  146

Query  498  LKVSLEDLYNGTSKKLSLSRNVL  566
            LKVSLEDLY GT+KKLSLSRNV+
Sbjct  147  LKVSLEDLYLGTTKKLSLSRNVI  169



>ref|XP_009368443.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 140/148 (95%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSK+AS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGGG HDPFDIF SFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  DVVHALKVSLEDLYLGTSKKLSLSRNVL  148



>ref|XP_008385581.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 140/148 (95%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSK+AS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGGG HDPFDIF SFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  DVVHALKVSLEDLYLGTSKKLSLSRNVL  148



>ref|XP_002969107.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
 ref|XP_002973957.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ24912.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ30223.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
Length=414

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 124/147 (84%), Gaps = 5/147 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++S+ TKYY+ILGVSK+ S EDLKKAYRK+AIKNHPDKGGDPE+FKE++QAYEV
Sbjct  1    MFGRGPRRSNETKYYDILGVSKDVSPEDLKKAYRKAAIKNHPDKGGDPEQFKEISQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEK+EIYDQYGE+ LKEGMGG      PFDIF+        GGGGS  G R+RRGED
Sbjct  61   LSDPEKKEIYDQYGEEGLKEGMGGPSAG-SPFDIFE----SLFSGGGGSRGGSRKRRGED  115

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGTSKKL+LSRN+L
Sbjct  116  VVHTLKVSLEDLYNGTSKKLTLSRNIL  142



>gb|KJB41003.1| hypothetical protein B456_007G087000 [Gossypium raimondii]
 gb|KJB41005.1| hypothetical protein B456_007G087000 [Gossypium raimondii]
Length=423

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTK+YE+LGV K+ASQ++LKKAY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRVPKKSDNTKFYEVLGVPKSASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGG  H+PFDIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGSSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLE+LYNGT+KKLSLSRN +
Sbjct  121  VVHALKVSLEELYNGTTKKLSLSRNAI  147



>ref|XP_011090296.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=417

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YY+ILGV K AS +DLKKAY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYDILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIF SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GT+KKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYLGTTKKLSLSRNVI  147



>ref|XP_011088982.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=413

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDN++YYEILGV K AS +DLKKAY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNSRYYEILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIF SFFGG+PFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGMHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVHPLKVSLEDLY GT+KKLSLSRNV+
Sbjct  121  VVHPLKVSLEDLYLGTTKKLSLSRNVI  147



>gb|KHG16063.1| DnaJ protein [Gossypium arboreum]
Length=299

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLK  503
            V+HPLK
Sbjct  121  VIHPLK  126



>ref|XP_010694477.1| PREDICTED: dnaJ protein homolog [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 134/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSD+T+YYEILGV KNAS EDLKKAY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRPPKKSDSTRYYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI-FQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI    F G    GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFSSFFGGSPFGGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DV+HPLKVSLED+YNGTSKKLSLSRNV+
Sbjct  121  DVIHPLKVSLEDIYNGTSKKLSLSRNVI  148



>ref|XP_002877319.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53578.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 137/148 (93%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSDNTK+YEILGV KNAS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF SFFG +PFG GGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGRSPFGDGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  121  DVVHPLKVSLEDVYLGTMKKLSLSRNAL  148



>tpg|DAA41207.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=581

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +3

Query  159  TKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYD  338
            ++YYEILGVSK+ASQ+DLKKAYRK+AIK+HP+KGGDPEKFKELAQAYEV SDPEKREIYD
Sbjct  335  SRYYEILGVSKDASQDDLKKAYRKAAIKDHPNKGGDPEKFKELAQAYEVPSDPEKREIYD  394

Query  339  QYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgEDVVHPLKVSLED  518
            QYGEDALKEGMGGGGGMHDPFD+FQSFFGG    GGGSSRGR QR G+DVVHPLKVSLED
Sbjct  395  QYGEDALKEGMGGGGGMHDPFDLFQSFFGGGSPFGGGSSRGRTQRWGDDVVHPLKVSLED  454

Query  519  LYNGTSKKLSLSRNVL  566
            LYNGTSKKLSLS NVL
Sbjct  455  LYNGTSKKLSLSHNVL  470



>ref|XP_002874044.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50303.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 133/148 (90%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P +KSDNTK+YEILGV K AS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF SFFGG     GG SRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGNPFGGHSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+Y GT+KKLSLSR VL
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLSRKVL  148



>gb|KHG16062.1| Chaperone protein dnaJ 3 [Gossypium arboreum]
Length=321

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNTKYYEILGV K ASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGNPFGGGGSSRGRRQRRGED  120

Query  486  VVHPLK  503
            V+HPLK
Sbjct  121  VIHPLK  126



>gb|KHF97331.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=422

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR PKKSDNTK+YE+LGV K+ASQ++LKKAY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRVPKKSDNTKFYEVLGVPKSASQDELKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKR+IYDQYGEDALKEGMGGGG  H+PFDIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGGSSHNPFDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLE+LYNGT+KKLSLSRN +
Sbjct  121  VVHALKVSLEELYNGTAKKLSLSRNAI  147



>ref|XP_010535721.1| PREDICTED: chaperone protein dnaJ 3 [Tarenaya hassleriana]
Length=423

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSDNTK+YEILGV KNASQEDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKNASQEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGG GG HDPFDI  S F G    GGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGPGGGHDPFDI-FSSFFGGGPFGGGSSRGRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GT+KKLSL+RN L
Sbjct  120  DVVHPLKVSLEDLYLGTTKKLSLTRNAL  147



>ref|XP_010521621.1| PREDICTED: dnaJ protein homolog ANJ1-like [Tarenaya hassleriana]
Length=423

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 135/150 (90%), Gaps = 3/150 (2%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSKNAS EDLKKAY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKNASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDI---FQsffggnpfggggssrgrrqrr  476
            LSDPEKR+IYDQYGEDALKEGMGGG G HDPFDI   F    GG  FGGGGSSRGRRQRR
Sbjct  61   LSDPEKRDIYDQYGEDALKEGMGGGPGGHDPFDIFSSFFGGGGGGGFGGGGSSRGRRQRR  120

Query  477  gEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            GEDVVHPLKVSLEDLY  T+KKLSLSRNVL
Sbjct  121  GEDVVHPLKVSLEDLYLSTTKKLSLSRNVL  150



>ref|XP_003605981.1| DnaJ [Medicago truncatula]
Length=413

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 132/148 (89%), Gaps = 7/148 (5%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGVSK ASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYD YGEDALKE   GGGGG HDPFDI       + F GGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGGHDPFDI------FSSFFGGGSSRGRRQRRGE  114

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  115  DVVHPLKVSLEDLYLGTSKKLSLSRNVL  142



>ref|XP_003605980.1| DnaJ [Medicago truncatula]
 gb|AES88177.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=416

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 132/148 (89%), Gaps = 4/148 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSD+T+YYEILGVSK ASQ+DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDSTRYYEILGVSKTASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYD YGEDALKE   GGGGG HDPFDI   F      GGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDTYGEDALKEGMGGGGGGGHDPFDI---FSSFFGGGGGGSSRGRRQRRGE  117

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  118  DVVHPLKVSLEDLYLGTSKKLSLSRNVL  145



>gb|EYU36023.1| hypothetical protein MIMGU_mgv1a007093mg [Erythranthe guttata]
Length=420

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 138/148 (93%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGRAP  KSDNTKYYEILGV K AS +DLKKAY+K+AIKNHPDKGGDPEKFKELA AYE
Sbjct  1    MFGRAPPSKSDNTKYYEILGVPKTASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF SFFGG+PFGGGGS RG+RQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSGRGQRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  DVVHPLKVSLEDLYLGTSKKLSLSRNVL  148



>ref|XP_006404506.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
 gb|ESQ45959.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
Length=421

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 139/148 (94%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSDNTK+YEILGV K AS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF SFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+Y GT+KKLSLSRN L
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLSRNAL  148



>ref|XP_008359180.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=424

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 133/152 (88%), Gaps = 5/152 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVSK+AS +DLKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSKSASPDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQs----ffggnpfggggssrgrrq  470
            LSDPEKREIYDQYGEDALKE   GGGGG HDPFDIF S       G    GGGSSRGRRQ
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGXKNPGGGSSRGRRQ  120

Query  471  rrgEDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            RRGEDVVH LKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  RRGEDVVHALKVSLEDLYLGTSKKLSLSRNVL  152



>gb|KDO48715.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=315

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = +3

Query  189  KNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEg  368
            KNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  369  mgggggmHDPFDIFQsffggnpfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLS  548
            MGGGGG HDPFDIFQ  F G    GGGSSRGRRQRRGEDV+HPLKVSLEDLYNGTSKKLS
Sbjct  68   MGGGGGAHDPFDIFQ-SFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLS  126

Query  549  LSRNVL  566
            LSRNV+
Sbjct  127  LSRNVI  132



>emb|CAN64325.1| hypothetical protein VITISV_005641 [Vitis vinifera]
Length=403

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++SD+TKYY+ILGVSKNA+Q++LKKAY+K+AIKNHPDKGGDPEKFKEL+QAY+V
Sbjct  1    MFGRPPRRSDSTKYYDILGVSKNANQDELKKAYKKAAIKNHPDKGGDPEKFKELSQAYDV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDP+KREIYDQYGED LKEGMGGGGG H+P DIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPDKREIYDQYGEDGLKEGMGGGGGFHNPVDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VVHTLKVSLEDLYNGTSKKLSLSRNVM  147



>gb|AGR45906.1| DnaJ protein 2-like protein [Triticum aestivum]
Length=421

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 3/144 (2%)
 Frame = +3

Query  144  KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEVLSDPEK  323
            K S+NTKYYE+LGVSK A+ ++LKKAYRK+AIKNHPDKGGDPEKFKELAQAY+VL+DPEK
Sbjct  4    KTSNNTKYYEVLGVSKTATPDELKKAYRKAAIKNHPDKGGDPEKFKELAQAYDVLNDPEK  63

Query  324  REIYDQYGEDALKEgmgggggm--HDPFDIF-QsffggnpfggggssrgrrqrrgEDVVH  494
            REIYDQYGEDA+KEGMGG GG   H PFDIF Q F GG    GGGSSRGRRQ+RGEDVVH
Sbjct  64   REIYDQYGEDAIKEGMGGSGGADMHSPFDIFEQLFGGGGGGFGGGSSRGRRQKRGEDVVH  123

Query  495  PLKVSLEDLYNGTSKKLSLSRNVL  566
             +KVSLEDLYNG +KKLSLSRNVL
Sbjct  124  TMKVSLEDLYNGATKKLSLSRNVL  147



>ref|XP_002275918.1| PREDICTED: dnaJ protein homolog 2 [Vitis vinifera]
Length=419

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++SD+TKYY+ILGVSKNA+Q++LKKAY+K+AIKNHPDKGGDPEKFKEL+QAY+V
Sbjct  1    MFGRPPRRSDSTKYYDILGVSKNANQDELKKAYKKAAIKNHPDKGGDPEKFKELSQAYDV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDP+KREIYDQYGED LKEGMGGGGG H+P DIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPDKREIYDQYGEDGLKEGMGGGGGFHNPVDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VVHTLKVSLEDLYNGTSKKLSLSRNVM  147



>ref|XP_009336413.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 138/148 (93%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVS++AS +DLKKAY+K+AIKNHPDKGGDPEKFKELA AYEV
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQSASSDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEV  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGGG HDPFDIF SFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLEDL  GTSKKLSLSRNVL
Sbjct  121  DVVHALKVSLEDLCLGTSKKLSLSRNVL  148



>gb|AAB86799.1| putative [Arabidopsis thaliana]
 prf||2118338A AtJ2 protein
Length=419

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P +KSDNTK+YEILGV K A+ EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF SFFG      G  SRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFGSHSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+Y GT+KKLSLSR  L
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLSRKAL  148



>ref|NP_568412.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
 sp|P42825.2|DNAJ2_ARATH RecName: Full=Chaperone protein dnaJ 2; Short=AtDjA2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC34499.1| DNAJ PROTEIN HOMOLOG ATJ [Arabidopsis thaliana]
 dbj|BAC42997.1| putative DnaJ protein homolog ATJ [Arabidopsis thaliana]
 gb|ABH04586.1| At5g22060 [Arabidopsis thaliana]
 gb|AED92977.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
Length=419

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P +KSDNTK+YEILGV K A+ EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF SFFG      G  SRGRRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFGSHSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+Y GT+KKLSLSR  L
Sbjct  121  DVVHPLKVSLEDVYLGTTKKLSLSRKAL  148



>ref|XP_008361658.1| PREDICTED: dnaJ protein homolog [Malus domestica]
 ref|XP_008355256.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 138/148 (93%), Gaps = 1/148 (1%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGRAPKKSDNT+YYEILGVS++AS +DLKKAY+K+AIKNHPDKGGDPEKFKELA AYE 
Sbjct  1    MFGRAPKKSDNTRYYEILGVSQSASSDDLKKAYKKAAIKNHPDKGGDPEKFKELAHAYEX  60

Query  306  LSDPEKREIYDQYGEDALKE-gmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            LSDPEKREIYDQYGEDALKE   GGGGG HDPFDIF SFFGG+PFGGGGSSRGRRQRRGE
Sbjct  61   LSDPEKREIYDQYGEDALKEGMGGGGGGGHDPFDIFSSFFGGSPFGGGGSSRGRRQRRGE  120

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVH LKVSLEDLY GTSKKLSLSRNVL
Sbjct  121  DVVHALKVSLEDLYLGTSKKLSLSRNVL  148



>gb|KDO48711.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48712.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48713.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=402

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = +3

Query  189  KNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEg  368
            KNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  369  mgggggmHDPFDIFQsffggnpfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLS  548
            MGGGGG HDPFDIFQ  F G    GGGSSRGRRQRRGEDV+HPLKVSLEDLYNGTSKKLS
Sbjct  68   MGGGGGAHDPFDIFQ-SFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLS  126

Query  549  LSRNVL  566
            LSRNV+
Sbjct  127  LSRNVI  132



>ref|NP_850653.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 gb|AEE77864.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=343

 Score =   176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSDNTK+YEILGV K+AS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLSRNAL  147



>emb|CDX70980.1| BnaC03g10640D [Brassica napus]
Length=407

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 113/148 (76%), Gaps = 14/148 (9%)
 Frame = +3

Query  126  MFGRAPK-KSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MF R P  KSDNTK+YEILGV K+AS EDLKKAY+++AIKNHPDKGGDPEKFKEL +AY 
Sbjct  1    MFRRGPSSKSDNTKFYEILGVPKSASPEDLKKAYKRAAIKNHPDKGGDPEKFKELGEAYG  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGE+ +K+    G   HDPFDIF                 RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEEGIKD----GIDRHDPFDIF---------SSFFGRNERRQRRGE  107

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPL+VSLEDLY GT+KKLSLSRN L
Sbjct  108  DVVHPLRVSLEDLYLGTTKKLSLSRNAL  135



>ref|XP_006400711.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
 gb|ESQ42164.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
Length=420

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 129/149 (87%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P +KSDNTK+YEILGV K AS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQs-ffggnpfggggssrgrrqrrg  479
            VLSDPEKRE+YDQYGEDALKEGMGG GG HDPFDIF S F       GGGSSR RRQRRG
Sbjct  61   VLSDPEKREVYDQYGEDALKEGMGGPGGGHDPFDIFSSFFGQSGNPFGGGSSRARRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVHPLKVSLEDLY GT+KKLSLSR  L
Sbjct  121  EDVVHPLKVSLEDLYLGTTKKLSLSRKAL  149



>gb|KDO48710.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=401

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 115/126 (91%), Gaps = 2/126 (2%)
 Frame = +3

Query  189  KNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEg  368
            KNASQ+DLKKAYRK+AIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct  8    KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG  67

Query  369  mgggggmHDPFDIFQsffggnpfggggssrgrrqrrgEDVVHPLKVSLEDLYNGTSKKLS  548
            MGGGGG HDPFDIFQ          GGSSRGRRQRRGEDV+HPLKVSLEDLYNGTSKKLS
Sbjct  68   MGGGGGAHDPFDIFQ--SFFGGSPFGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLS  125

Query  549  LSRNVL  566
            LSRNV+
Sbjct  126  LSRNVI  131



>gb|AAB49030.1| DnaJ homolog [Arabidopsis thaliana]
Length=420

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSDNTK+YEILGV K+AS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLSRNAL  147



>ref|XP_008232370.1| PREDICTED: dnaJ protein homolog 2-like [Prunus mume]
Length=415

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 122/147 (83%), Gaps = 5/147 (3%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFG A +KSDNTKYY +LGVSKN+S ++LKKAY+K+AIKNHPDKGGDPEKFKELAQAYEV
Sbjct  1    MFGHASRKSDNTKYYGVLGVSKNSSADELKKAYKKAAIKNHPDKGGDPEKFKELAQAYEV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDPEKREIYDQYGED LKEG GGG   H+PFD+F+             S  RRQ++GED
Sbjct  61   LSDPEKREIYDQYGEDGLKEGAGGGSTSHNPFDLFE-----AFLNPRYRSHVRRQKQGED  115

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH L+VSLEDLYNGT+KKLSLSRN+L
Sbjct  116  VVHTLRVSLEDLYNGTTKKLSLSRNIL  142



>gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thaliana]
Length=420

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSDNTK+YEILGV K+AS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLSRNAL  147



>ref|NP_189997.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 sp|Q94AW8.2|DNAJ3_ARATH RecName: Full=Chaperone protein dnaJ 3; Short=AtDjA3; Short=AtJ3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86892.1| AtJ3 [Arabidopsis thaliana]
 emb|CAB88419.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAK59592.1| putative dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAM44926.1| putative DnaJ-like protein atj3 [Arabidopsis thaliana]
 gb|AAM65624.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 dbj|BAE98606.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AEE77863.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=420

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P KKSDNTK+YEILGV K+AS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgE  482
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDI  S F G    GG +SR RRQRRGE
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDI-FSSFFGGGPFGGNTSRQRRQRRGE  119

Query  483  DVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            DVVHPLKVSLED+Y GT KKLSLSRN L
Sbjct  120  DVVHPLKVSLEDVYLGTMKKLSLSRNAL  147



>ref|XP_006287824.1| hypothetical protein CARUB_v10001042mg [Capsella rubella]
 gb|EOA20722.1| hypothetical protein CARUB_v10001042mg [Capsella rubella]
Length=421

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 132/149 (89%), Gaps = 2/149 (1%)
 Frame = +3

Query  126  MFGRAP-KKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYE  302
            MFGR P +KSDNTK+YEILGV K AS EDLKKAY+K+AIKNHPDKGGDPEKFKELAQAYE
Sbjct  1    MFGRGPSRKSDNTKFYEILGVPKTASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE  60

Query  303  VLSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQ-sffggnpfggggssrgrrqrrg  479
            VLSDPEKREIYDQYGEDALKEGMGGGGG HDPFDIF   F GG    GGGSSRGRRQRRG
Sbjct  61   VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGHPFGGGSSRGRRQRRG  120

Query  480  EDVVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            EDVVHPLKVSLED+Y GT+KKLSLSR  L
Sbjct  121  EDVVHPLKVSLEDVYLGTTKKLSLSRKAL  149



>emb|CBI16632.3| unnamed protein product [Vitis vinifera]
Length=692

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  MFGRAPKKSDNTKYYEILGVSKNASQEDLKKAYRKSAIKNHPDKGGDPEKFKELAQAYEV  305
            MFGR P++SD+TKYY+ILGVSKNA+Q++LKKAY+K+AIKNHPDKGGDPEKFKEL+QAY+V
Sbjct  1    MFGRPPRRSDSTKYYDILGVSKNANQDELKKAYKKAAIKNHPDKGGDPEKFKELSQAYDV  60

Query  306  LSDPEKREIYDQYGEDALKEgmgggggmHDPFDIFQsffggnpfggggssrgrrqrrgED  485
            LSDP+KREIYDQYGED LKEGMGGGGG H+P DIF+SFFGG  FGGGGSSRGRRQ+RGED
Sbjct  61   LSDPDKREIYDQYGEDGLKEGMGGGGGFHNPVDIFESFFGGGAFGGGGSSRGRRQKRGED  120

Query  486  VVHPLKVSLEDLYNGTSKKLSLSRNVL  566
            VVH LKVSLEDLYNGTSKKLSLSRNV+
Sbjct  121  VVHTLKVSLEDLYNGTSKKLSLSRNVM  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380