BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004E14

Length=334
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHL44983.1|  4-coumarate:coenzyme A ligase 4                         115   9e-28   Fraxinus mandshurica [Manchurian ash]
ref|XP_007016850.1|  AMP-dependent synthetase and ligase family p...    114   1e-27   
ref|XP_007016849.1|  AMP-dependent synthetase and ligase family p...    114   3e-27   
ref|XP_010111818.1|  4-coumarate--CoA ligase-like 7                     114   6e-27   
ref|XP_009786809.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          113   7e-27   Nicotiana sylvestris
ref|XP_009603383.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          113   7e-27   Nicotiana tomentosiformis
gb|KHG22750.1|  4-coumarate--CoA ligase-like 7                          112   9e-27   Gossypium arboreum [tree cotton]
gb|KHG26822.1|  4-coumarate--CoA ligase-like 7                          111   1e-26   Gossypium arboreum [tree cotton]
ref|XP_006340129.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     112   2e-26   Solanum tuberosum [potatoes]
gb|ADG46006.1|  4-coumarate coenzyme A ligase                           111   4e-26   Isatis tinctoria [woad]
ref|XP_004251107.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          111   4e-26   Solanum lycopersicum
ref|XP_011089239.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    111   4e-26   
ref|XP_010538202.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          110   7e-26   Tarenaya hassleriana [spider flower]
ref|XP_006396625.1|  hypothetical protein EUTSA_v10028563mg             110   9e-26   Eutrema salsugineum [saltwater cress]
ref|XP_006424490.1|  hypothetical protein CICLE_v10028138mg             110   1e-25   Citrus clementina [clementine]
ref|XP_006488032.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     110   1e-25   Citrus sinensis [apfelsine]
ref|XP_006396627.1|  hypothetical protein EUTSA_v10028562mg             108   3e-25   Eutrema salsugineum [saltwater cress]
ref|XP_004291645.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          108   3e-25   Fragaria vesca subsp. vesca
gb|AIR95612.1|  4-coumarate:CoA ligase-like protein                     108   4e-25   Betula pendula [white birch]
ref|XP_010455853.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          108   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002523698.1|  AMP dependent CoA ligase, putative                 108   4e-25   Ricinus communis
gb|KJB83875.1|  hypothetical protein B456_013G269100                    107   5e-25   Gossypium raimondii
ref|XP_010431672.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          108   6e-25   Camelina sativa [gold-of-pleasure]
gb|AID56315.1|  4-coumarate coenzyme A ligase 2                         101   6e-25   Eriobotrya japonica [loquat]
gb|KDP43987.1|  hypothetical protein JCGZ_05454                         107   7e-25   Jatropha curcas
gb|KJB83876.1|  hypothetical protein B456_013G269100                    107   1e-24   Gossypium raimondii
ref|XP_010267197.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          107   1e-24   Nelumbo nucifera [Indian lotus]
ref|NP_192425.1|  4-coumarate--CoA ligase-like 7                        107   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008226338.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          107   1e-24   
ref|XP_010422413.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          107   1e-24   Camelina sativa [gold-of-pleasure]
gb|KJB83874.1|  hypothetical protein B456_013G269100                    107   2e-24   Gossypium raimondii
ref|XP_008359628.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          106   3e-24   
gb|AGA17924.1|  CCL7                                                    105   4e-24   Humulus lupulus [common hop]
ref|XP_009356915.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          105   4e-24   Pyrus x bretschneideri [bai li]
ref|XP_009345749.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          103   6e-24   
ref|XP_010529378.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    105   6e-24   Tarenaya hassleriana [spider flower]
emb|CDY39153.1|  BnaC09g21910D                                          105   7e-24   Brassica napus [oilseed rape]
emb|CDY39155.1|  BnaC09g21890D                                          104   1e-23   Brassica napus [oilseed rape]
ref|XP_002872738.1|  hypothetical protein ARALYDRAFT_490166             104   1e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_009335967.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          104   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_007208457.1|  hypothetical protein PRUPE_ppa003893mg             103   2e-23   Prunus persica
ref|XP_010042863.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          102   2e-23   Eucalyptus grandis [rose gum]
gb|AGO89328.1|  Ca4CL11                                                 103   3e-23   Salix arbutifolia
ref|XP_002305282.1|  4-coumarate--CoA ligase family protein             103   3e-23   Populus trichocarpa [western balsam poplar]
gb|EPS70306.1|  hypothetical protein M569_04447                         103   3e-23   Genlisea aurea
gb|KDO60233.1|  hypothetical protein CISIN_1g0436011mg                  101   4e-23   Citrus sinensis [apfelsine]
emb|CDY46375.1|  BnaA09g19890D                                          102   5e-23   Brassica napus [oilseed rape]
gb|AIA24410.1|  4-coumarate-CoA ligase                                  102   5e-23   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_010689117.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          102   5e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006287440.1|  hypothetical protein CARUB_v10000646mg             102   6e-23   Capsella rubella
ref|XP_011004441.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          102   6e-23   Populus euphratica
ref|XP_002276353.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          102   7e-23   Vitis vinifera
gb|EYU18792.1|  hypothetical protein MIMGU_mgv1a004091mg                102   8e-23   Erythranthe guttata [common monkey flower]
ref|XP_010045319.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          102   9e-23   Eucalyptus grandis [rose gum]
ref|XP_008384715.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          102   1e-22   
gb|AGW27195.1|  4-coumarate:coenzyme A ligase 5                         101   2e-22   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009114500.1|  PREDICTED: 4-coumarate--CoA ligase-like 7          101   2e-22   Brassica rapa
ref|XP_006488030.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     101   2e-22   
emb|CAN70560.1|  hypothetical protein VITISV_031619                     101   2e-22   Vitis vinifera
gb|KCW87478.1|  hypothetical protein EUGRSUZ_B03942                     101   2e-22   Eucalyptus grandis [rose gum]
gb|KCW87479.1|  hypothetical protein EUGRSUZ_B03943                     101   2e-22   Eucalyptus grandis [rose gum]
ref|XP_004147290.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like     100   3e-22   Cucumis sativus [cucumbers]
emb|CDY46376.1|  BnaA09g19900D                                          100   3e-22   Brassica napus [oilseed rape]
gb|AGO89329.1|  Ca4CL12                                                 100   3e-22   Salix arbutifolia
ref|XP_006373451.1|  4-coumarate--CoA ligase family protein             100   5e-22   
gb|AGO89327.1|  Ca4CL10                                               99.8    7e-22   Salix arbutifolia
gb|AFD33347.1|  acyl-activating enzyme 3                              98.6    2e-21   Cannabis sativa
gb|AFK46688.1|  unknown                                               91.7    2e-21   Medicago truncatula
ref|XP_006424487.1|  hypothetical protein CICLE_v10029864mg           97.8    3e-21   
gb|KDO60238.1|  hypothetical protein CISIN_1g0137801mg                95.5    5e-21   Citrus sinensis [apfelsine]
gb|KDO60235.1|  hypothetical protein CISIN_1g0137801mg                95.9    6e-21   Citrus sinensis [apfelsine]
gb|KDO60236.1|  hypothetical protein CISIN_1g0137801mg                95.9    6e-21   Citrus sinensis [apfelsine]
gb|KFK32221.1|  hypothetical protein AALP_AA6G213500                  96.7    8e-21   Arabis alpina [alpine rockcress]
ref|XP_006488029.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like   95.9    2e-20   Citrus sinensis [apfelsine]
ref|XP_008463063.1|  PREDICTED: 4-coumarate--CoA ligase-like 7        95.1    3e-20   Cucumis melo [Oriental melon]
gb|KEH29988.1|  4-coumarate:CoA ligase-like protein                   94.0    4e-20   Medicago truncatula
gb|KEH29987.1|  4-coumarate:CoA ligase-like protein                   93.6    6e-20   Medicago truncatula
ref|XP_006424481.1|  hypothetical protein CICLE_v100281392mg          91.3    1e-19   
gb|KEH29989.1|  4-coumarate:CoA ligase-like protein                   93.2    1e-19   Medicago truncatula
ref|XP_011021223.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...  92.0    2e-19   Populus euphratica
gb|KHN38721.1|  4-coumarate--CoA ligase-like 7                        91.3    4e-19   Glycine soja [wild soybean]
ref|XP_011021222.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...  91.3    5e-19   Populus euphratica
ref|XP_011021221.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...  91.3    7e-19   Populus euphratica
ref|XP_011021220.1|  PREDICTED: 4-coumarate--CoA ligase-like 7 is...  91.3    7e-19   Populus euphratica
ref|XP_006591122.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...  91.3    8e-19   Glycine max [soybeans]
gb|ABR17274.1|  unknown                                               90.9    1e-18   Picea sitchensis
ref|XP_006591121.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...  90.9    1e-18   Glycine max [soybeans]
ref|XP_009114499.1|  PREDICTED: 4-coumarate--CoA ligase-like 7        89.7    2e-18   Brassica rapa
ref|XP_006843037.1|  hypothetical protein AMTR_s00076p00189570        89.7    2e-18   Amborella trichopoda
gb|ABR18186.1|  unknown                                               89.4    3e-18   Picea sitchensis
gb|AGW47873.1|  4-coumarate:coenzyme A ligase 8                       89.4    4e-18   Phaseolus vulgaris [French bean]
gb|KEH39398.1|  4-coumarate:CoA ligase-like protein                   88.2    6e-18   Medicago truncatula
gb|KEH39397.1|  4-coumarate:CoA ligase-like protein                   87.4    1e-17   Medicago truncatula
ref|XP_007132315.1|  hypothetical protein PHAVU_011G084300g           86.3    3e-17   Phaseolus vulgaris [French bean]
ref|XP_007132313.1|  hypothetical protein PHAVU_011G084300g           86.3    3e-17   Phaseolus vulgaris [French bean]
ref|XP_008808867.1|  PREDICTED: 4-coumarate--CoA ligase-like 1        85.9    6e-17   Phoenix dactylifera
ref|XP_007132314.1|  hypothetical protein PHAVU_011G084300g           85.9    6e-17   Phaseolus vulgaris [French bean]
gb|KHN21493.1|  4-coumarate--CoA ligase-like 7                        85.5    6e-17   Glycine soja [wild soybean]
gb|AGW47869.1|  4-coumarate:coenzyme A ligase 4                       85.5    7e-17   Phaseolus vulgaris [French bean]
ref|NP_001243292.1|  4-coumarate--CoA ligase-like 7-like              85.5    7e-17   Glycine max [soybeans]
ref|XP_007150153.1|  hypothetical protein PHAVU_005G131400g           84.0    3e-16   Phaseolus vulgaris [French bean]
ref|XP_004487067.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like   80.9    3e-15   Cicer arietinum [garbanzo]
ref|XP_009413145.1|  PREDICTED: 4-coumarate--CoA ligase-like 1        80.5    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401821.1|  PREDICTED: 4-coumarate--CoA ligase-like 1        78.6    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918638.1|  PREDICTED: 4-coumarate--CoA ligase-like 1 is...  78.2    3e-14   
ref|XP_010918637.1|  PREDICTED: 4-coumarate--CoA ligase-like 1 is...  78.2    3e-14   Elaeis guineensis
ref|XP_011087155.1|  PREDICTED: 4-coumarate--CoA ligase-like 7        77.4    5e-14   Sesamum indicum [beniseed]
ref|XP_004153142.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like   74.3    1e-13   
emb|CDP06777.1|  unnamed protein product                              76.3    1e-13   Coffea canephora [robusta coffee]
gb|AGA17927.1|  CCL10                                                 74.7    4e-13   Humulus lupulus [common hop]
ref|XP_008442710.1|  PREDICTED: 4-coumarate--CoA ligase-like 7        73.9    8e-13   Cucumis melo [Oriental melon]
gb|AIY34663.1|  4-coumarate:CoA ligase-like protein                   73.9    8e-13   Ornithogalum longebracteatum [sea-onion]
ref|XP_004161266.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like   73.6    1e-12   
gb|KGN58984.1|  hypothetical protein Csa_3G740270                     73.6    1e-12   Cucumis sativus [cucumbers]
dbj|BAJ88705.1|  predicted protein                                    70.9    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011087272.1|  PREDICTED: 4-coumarate--CoA ligase-like 7        70.1    2e-11   
ref|XP_004304462.1|  PREDICTED: 4-coumarate--CoA ligase-like 7        68.6    6e-11   Fragaria vesca subsp. vesca
ref|XP_010654332.1|  PREDICTED: 4-coumarate--CoA ligase-like 7        65.5    6e-11   Vitis vinifera
ref|XP_004985664.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like   66.2    4e-10   
emb|CBI30139.3|  unnamed protein product                              65.5    8e-10   Vitis vinifera
ref|XP_007203616.1|  hypothetical protein PRUPE_ppa003871mg           63.2    4e-09   Prunus persica
ref|XP_008241410.1|  PREDICTED: 4-coumarate--CoA ligase-like 7        63.2    4e-09   Prunus mume [ume]
ref|XP_004982544.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like   62.8    6e-09   Setaria italica
gb|KDO60237.1|  hypothetical protein CISIN_1g0137801mg                61.6    1e-08   Citrus sinensis [apfelsine]
ref|XP_003558787.1|  PREDICTED: 4-coumarate--CoA ligase-like 1        62.0    1e-08   Brachypodium distachyon [annual false brome]
gb|KEH42182.1|  4-coumarate:CoA ligase-like protein                   60.8    3e-08   Medicago truncatula
ref|XP_007027423.1|  AMP-dependent synthetase and ligase family p...  60.5    4e-08   
ref|XP_004497538.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-like   59.3    1e-07   Cicer arietinum [garbanzo]
gb|KJB20367.1|  hypothetical protein B456_003G144900                  58.9    1e-07   Gossypium raimondii
ref|XP_006424482.1|  hypothetical protein CICLE_v100281392mg          58.2    1e-07   
gb|KJB20368.1|  hypothetical protein B456_003G144900                  58.5    1e-07   Gossypium raimondii
gb|KJB20365.1|  hypothetical protein B456_003G144900                  58.9    1e-07   Gossypium raimondii
gb|KJB20366.1|  hypothetical protein B456_003G144900                  58.5    2e-07   Gossypium raimondii
gb|KJB20364.1|  hypothetical protein B456_003G144900                  58.5    2e-07   Gossypium raimondii
ref|XP_002466906.1|  hypothetical protein SORBIDRAFT_01g016420        58.2    2e-07   
ref|XP_008673103.1|  PREDICTED: uncharacterized protein LOC100280...  57.4    3e-07   Zea mays [maize]
gb|KDP29158.1|  hypothetical protein JCGZ_16547                       57.4    4e-07   Jatropha curcas
ref|XP_004982543.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-like   57.0    5e-07   Setaria italica
tpg|DAA50089.1|  TPA: putative AMP-dependent synthetase and ligas...  56.6    7e-07   
gb|KJB36450.1|  hypothetical protein B456_006G162900                  56.6    7e-07   Gossypium raimondii
tpg|DAA43421.1|  TPA: LOW QUALITY PROTEIN: putative AMP-dependent...  56.2    8e-07   
ref|XP_002519487.1|  AMP dependent CoA ligase, putative               56.6    9e-07   
gb|ACF80143.2|  unknown                                               55.8    1e-06   Zea mays [maize]
gb|KJB36451.1|  hypothetical protein B456_006G162900                  55.8    1e-06   Gossypium raimondii
ref|XP_008672616.1|  PREDICTED: uncharacterized protein LOC100191...  55.8    1e-06   Zea mays [maize]
ref|XP_001752801.1|  predicted protein                                55.1    2e-06   
ref|XP_001759551.1|  predicted protein                                52.8    1e-05   
gb|KEH42183.1|  4-coumarate:CoA ligase-like protein                   52.8    2e-05   Medicago truncatula
ref|XP_004985666.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-li...  52.0    2e-05   Setaria italica
ref|XP_004985665.1|  PREDICTED: 4-coumarate--CoA ligase-like 1-li...  52.0    3e-05   Setaria italica
ref|XP_010037647.1|  PREDICTED: 4-coumarate--CoA ligase-like 7        51.6    3e-05   Eucalyptus grandis [rose gum]
ref|XP_001761993.1|  predicted protein                                50.1    1e-04   
ref|XP_008658826.1|  PREDICTED: 4-coumarate--CoA ligase-like 3        49.3    2e-04   
ref|WP_014066333.1|  AMP-dependent synthetase                         48.9    3e-04   Rhodothermus marinus
ref|XP_002464864.1|  hypothetical protein SORBIDRAFT_01g027820        48.9    3e-04   
ref|XP_004962247.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...  48.9    3e-04   
ref|XP_004962246.1|  PREDICTED: 4-coumarate--CoA ligase-like 7-li...  48.9    3e-04   Setaria italica
gb|ELU00786.1|  hypothetical protein CAPTEDRAFT_169390                47.8    6e-04   Capitella teleta
gb|ACY66928.1|  4-coumarate:CoA ligase                                47.8    7e-04   Eucalyptus camaldulensis
ref|WP_012844691.1|  AMP-dependent synthetase                         47.4    7e-04   Rhodothermus marinus
gb|KCW80925.1|  hypothetical protein EUGRSUZ_C02284                   47.4    9e-04   Eucalyptus grandis [rose gum]
gb|ACI23348.1|  4-coumarate CoA ligase 1                              47.4    9e-04   Leucaena leucocephala [cassie]
gb|ACX68559.1|  4-coumarate:CoA ligase                                47.4    9e-04   Eucalyptus camaldulensis
gb|AAZ79469.1|  4-coumarate:coenzyme A ligase                         47.4    9e-04   Eucalyptus camaldulensis
ref|XP_002512781.1|  AMP dependent CoA ligase, putative               47.4    9e-04   Ricinus communis



>gb|AHL44983.1| 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshurica]
Length=543

 Score =   115 bits (289),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP++LP+DPNLSMVSFLFRNIS +PD+PA+ D +TG+TLTF + 
Sbjct  1    MEKSGYGRDGIYRSLRPPLILPKDPNLSMVSFLFRNISSFPDKPALVDFNTGQTLTFIEF  60

Query  314  KSQVSRV  334
            KS VS+V
Sbjct  61   KSVVSKV  67



>ref|XP_007016850.1| AMP-dependent synthetase and ligase family protein isoform 2, 
partial [Theobroma cacao]
 gb|EOY34469.1| AMP-dependent synthetase and ligase family protein isoform 2, 
partial [Theobroma cacao]
Length=422

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLP+DPNLSMVSFLFRN+S YPD+PA+ DADT  TL+FSQ 
Sbjct  13   MEKSGYGRDGIFRSLRPPLVLPKDPNLSMVSFLFRNVSSYPDKPALIDADTEETLSFSQF  72

Query  314  KSQVSRV  334
            KS V ++
Sbjct  73   KSAVIKL  79



>ref|XP_007016849.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
 gb|EOY34468.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
Length=545

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLP+DPNLSMVSFLFRN+S YPD+PA+ DADT  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPKDPNLSMVSFLFRNVSSYPDKPALIDADTEETLSFSQF  60

Query  314  KSQVSRV  334
            KS V ++
Sbjct  61   KSAVIKL  67



>ref|XP_010111818.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
 gb|EXC31783.1| 4-coumarate--CoA ligase-like 7 [Morus notabilis]
Length=665

 Score =   114 bits (285),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLP+DPNLS VSFLFRN S YP++PA+ DAD+G  L+FSQL
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPKDPNLSAVSFLFRNSSSYPNKPALIDADSGEILSFSQL  60

Query  314  KSQVSRV  334
            KS V++V
Sbjct  61   KSTVAKV  67



>ref|XP_009786809.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nicotiana sylvestris]
Length=538

 Score =   113 bits (282),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+ LP+D NLSMVSFLFRNIS +P++PA+ D D+G+TLTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLFLPKDQNLSMVSFLFRNISSFPEKPALFDGDSGQTLTFSQF  60

Query  314  KSQVSRV  334
            K+ VS++
Sbjct  61   KTIVSKI  67



>ref|XP_009603383.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nicotiana tomentosiformis]
Length=538

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+ LP+D NLSMVSFLFRNIS +P++PA+ DAD+G+TLTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLFLPKDQNLSMVSFLFRNISSFPEKPALFDADSGQTLTFSQF  60

Query  314  KSQVSRV  334
            K+ VS++
Sbjct  61   KTIVSKI  67



>gb|KHG22750.1| 4-coumarate--CoA ligase-like 7 [Gossypium arboreum]
Length=453

 Score =   112 bits (279),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+  P++PNLSMVSFL RN+S YPD+PA+ DAD+G TLTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPPVDFPKEPNLSMVSFLLRNVSCYPDKPALIDADSGETLTFSQL  60

Query  314  KSQVSRV  334
            KS V ++
Sbjct  61   KSTVIKL  67



>gb|KHG26822.1| 4-coumarate--CoA ligase-like 7 [Gossypium arboreum]
Length=443

 Score =   111 bits (278),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+  P++PNLSMVSFL RN+S YPD+PA+ DAD+G TLTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPPVDFPKEPNLSMVSFLLRNVSCYPDKPALIDADSGETLTFSQL  60

Query  314  KSQVSRV  334
            KS V ++
Sbjct  61   KSTVIKL  67



>ref|XP_006340129.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Solanum tuberosum]
Length=541

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+  P+D NLSMVSFLFRN S YP++PA  DAD G TL+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLFYPKDENLSMVSFLFRNSSSYPEKPAFFDADNGETLSFSQF  60

Query  314  KSQVSRV  334
            KS VSR+
Sbjct  61   KSMVSRI  67



>gb|ADG46006.1| 4-coumarate coenzyme A ligase [Isatis tinctoria]
Length=543

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLS+VSFLFRN S YP +PAI D+D+G +L+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNLSLVSFLFRNSSSYPSKPAIVDSDSGDSLSFSQL  60

Query  314  KSQVSRV  334
            KS VSR+
Sbjct  61   KSAVSRL  67



>ref|XP_004251107.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Solanum lycopersicum]
Length=538

 Score =   111 bits (277),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP+  P+D NLSMVSFLFR IS YP++PA  DAD G TL+FSQ 
Sbjct  1    MEKSGYGRDGVYRSLRPPVFYPKDENLSMVSFLFRKISSYPEKPAFFDADNGGTLSFSQF  60

Query  314  KSQVSRV  334
            KS VSR+
Sbjct  61   KSMVSRI  67



>ref|XP_011089239.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
7 [Sesamum indicum]
Length=549

 Score =   111 bits (277),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP+ LP+DPNLSMVSFLFRN S + D+PA+ D+ TG+ LTF+Q 
Sbjct  1    MEKSGYGRDGVYRSLRPPLFLPKDPNLSMVSFLFRNASSFADKPALIDSHTGKILTFAQF  60

Query  314  KSQVSRV  334
            KS VSRV
Sbjct  61   KSMVSRV  67



>ref|XP_010538202.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Tarenaya hassleriana]
Length=546

 Score =   110 bits (276),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLP+DPNLS+VSFLFR+ S YP +PA+ DAD+G +L+FSQL
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPKDPNLSLVSFLFRDSSSYPMKPALIDADSGESLSFSQL  60

Query  314  KSQVSRV  334
            KS V+R+
Sbjct  61   KSTVARL  67



>ref|XP_006396625.1| hypothetical protein EUTSA_v10028563mg [Eutrema salsugineum]
 dbj|BAJ33700.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38078.1| hypothetical protein EUTSA_v10028563mg [Eutrema salsugineum]
Length=543

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP +PA+ D+D+G TL+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNTSSYPSKPALVDSDSGDTLSFSQL  60

Query  314  KSQVSRV  334
            KS VSR+
Sbjct  61   KSAVSRL  67



>ref|XP_006424490.1| hypothetical protein CICLE_v10028138mg [Citrus clementina]
 gb|ESR37730.1| hypothetical protein CICLE_v10028138mg [Citrus clementina]
Length=545

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP +PNLSMV FLFRN + YP +PA+ DAD+G +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSEPNLSMVHFLFRNSASYPSKPALIDADSGESLTFSQL  60

Query  314  KSQV  325
            KS V
Sbjct  61   KSTV  64



>ref|XP_006488032.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=545

 Score =   110 bits (274),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP +PNLSMV FLFRN + YP +PA+ DAD+G +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSEPNLSMVHFLFRNSASYPSKPALIDADSGESLTFSQL  60

Query  314  KSQV  325
            KS V
Sbjct  61   KSTV  64



>ref|XP_006396627.1| hypothetical protein EUTSA_v10028562mg [Eutrema salsugineum]
 gb|ESQ38080.1| hypothetical protein EUTSA_v10028562mg [Eutrema salsugineum]
Length=543

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG+DGIYRSLRP +VLP+DPN S+VSFLFRN S YP +PA+ D+D+G TL+FSQL
Sbjct  1    MEKSGYGKDGIYRSLRPTLVLPKDPNTSLVSFLFRNTSSYPSKPALVDSDSGDTLSFSQL  60

Query  314  KSQVSRV  334
            KS VSR+
Sbjct  61   KSAVSRL  67



>ref|XP_004291645.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Fragaria vesca subsp. 
vesca]
Length=543

 Score =   108 bits (271),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG++RSLRPP+VLPRDPN +MVSFLF N S YP++PA+ DA++  TL+FSQL
Sbjct  1    MEKSGYGRDGVFRSLRPPLVLPRDPNFTMVSFLFNNSSSYPNKPALIDAESSETLSFSQL  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSMVIKV  67



>gb|AIR95612.1| 4-coumarate:CoA ligase-like protein [Betula pendula]
Length=545

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRS+RPP+VLP+DPNLSMV+FLFRN S YP +PA+ DAD+ +TL+FSQ 
Sbjct  1    MEKSGYGRDGIYRSVRPPLVLPKDPNLSMVTFLFRNSSSYPHKPALIDADSSQTLSFSQF  60

Query  314  KSQVSRV  334
            KS V+ +
Sbjct  61   KSTVATI  67



>ref|XP_010455853.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=543

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + A+ D+DTG TLTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLALADSDTGETLTFSQL  60

Query  314  KSQVSRV  334
            KS V+R+
Sbjct  61   KSAVARL  67



>ref|XP_002523698.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF38638.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=542

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMVSFLFRN + YP +PA+ DAD  +TL+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPLLVLPKDPNLSMVSFLFRNCNSYPHKPALIDADLSKTLSFSQL  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>gb|KJB83875.1| hypothetical protein B456_013G269100, partial [Gossypium raimondii]
Length=452

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP++LP++PNLSMVSFLFRNI  YP++PA+ D+D+  TLTFSQ 
Sbjct  39   MEKSGYGRDGIFRSLRPPLLLPKEPNLSMVSFLFRNIGSYPEKPALIDSDSDETLTFSQS  98

Query  314  KSQVSRV  334
            KS V ++
Sbjct  99   KSTVIKL  105



>ref|XP_010431672.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=542

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + A+ D+DTG +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLALADSDTGESLTFSQL  60

Query  314  KSQVSRV  334
            KS V+R+
Sbjct  61   KSAVARL  67



>gb|AID56315.1| 4-coumarate coenzyme A ligase 2, partial [Eriobotrya japonica]
Length=94

 Score =   101 bits (251),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSG+GRDGI+RSLRPP+VLPR+PNLSMVSFLFRN S Y  +PA+ D ++  TL+FSQ 
Sbjct  1    MEKSGFGRDGIFRSLRPPLVLPREPNLSMVSFLFRNSSSYSHKPALIDGESSETLSFSQF  60

Query  314  KSQVSRV  334
            KS+V +V
Sbjct  61   KSKVIQV  67



>gb|KDP43987.1| hypothetical protein JCGZ_05454 [Jatropha curcas]
Length=542

 Score =   107 bits (268),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP IV P+DPNLSMVSFLFRN S YP +PA+ DAD   TL+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTIVFPKDPNLSMVSFLFRNSSSYPHKPALIDADLSLTLSFSQL  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>gb|KJB83876.1| hypothetical protein B456_013G269100, partial [Gossypium raimondii]
Length=520

 Score =   107 bits (267),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP++LP++PNLSMVSFLFRNI  YP++PA+ D+D+  TLTFSQ 
Sbjct  39   MEKSGYGRDGIFRSLRPPLLLPKEPNLSMVSFLFRNIGSYPEKPALIDSDSDETLTFSQS  98

Query  314  KSQVSRV  334
            KS V ++
Sbjct  99   KSTVIKL  105



>ref|XP_010267197.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nelumbo nucifera]
Length=543

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP+V P+DPNLSMVSFLFRN S Y D+ A+ DAD+G  L FSQL
Sbjct  1    MEKSGYGRDGVYRSLRPPVVFPKDPNLSMVSFLFRNSSSYSDKLALVDADSGDALNFSQL  60

Query  314  KSQVSRV  334
            KS +++V
Sbjct  61   KSTIAKV  67



>ref|NP_192425.1| 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana]
 sp|Q9M0X9.1|4CLL7_ARATH RecName: Full=4-coumarate--CoA ligase-like 7; AltName: Full=4-coumarate--CoA 
ligase isoform 6; Short=At4CL6 [Arabidopsis 
thaliana]
 emb|CAB81058.1| 4-coumarate--CoA ligase-like protein [Arabidopsis thaliana]
 gb|AAM13899.1| putative 4-coumarate--CoA ligase [Arabidopsis thaliana]
 gb|AAM67483.1| putative 4-coumarate--CoA ligase [Arabidopsis thaliana]
 gb|AAP03022.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
 gb|AEE82486.1| 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana]
Length=544

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + AI D+DTG +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLAIADSDTGDSLTFSQL  60

Query  314  KSQVSRV  334
            KS V+R+
Sbjct  61   KSAVARL  67



>ref|XP_008226338.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Prunus mume]
Length=532

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRDPNLSMVSFLFRN S Y ++PA+ DA++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDPNLSMVSFLFRNSSSYSNKPALIDAESSETLSFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSLVIKV  67



>ref|XP_010422413.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Camelina sativa]
Length=543

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + A+ D+DTG +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLALADSDTGESLTFSQL  60

Query  314  KSQVSRV  334
            KS V+R+
Sbjct  61   KSAVARL  67



>gb|KJB83874.1| hypothetical protein B456_013G269100, partial [Gossypium raimondii]
Length=583

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP++LP++PNLSMVSFLFRNI  YP++PA+ D+D+  TLTFSQ 
Sbjct  39   MEKSGYGRDGIFRSLRPPLLLPKEPNLSMVSFLFRNIGSYPEKPALIDSDSDETLTFSQS  98

Query  314  KSQVSRV  334
            KS V ++
Sbjct  99   KSTVIKL  105



>ref|XP_008359628.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Malus domestica]
Length=545

 Score =   106 bits (264),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRDPNLSMVSFLFRN S Y  +PA+ + ++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDPNLSMVSFLFRNSSSYSHKPALIEGESSETLSFSQF  60

Query  314  KSQVSRV  334
            KS+V +V
Sbjct  61   KSKVIQV  67



>gb|AGA17924.1| CCL7 [Humulus lupulus]
Length=544

 Score =   105 bits (263),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG++RSLRPP+VLP+D NLSMVSF+FRN S YP +PA+ D+DT  TL+FSQ 
Sbjct  1    MEKSGYGRDGVFRSLRPPLVLPKDHNLSMVSFVFRNSSSYPQKPALIDSDTNETLSFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSMVIKV  67



>ref|XP_009356915.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Pyrus x bretschneideri]
Length=545

 Score =   105 bits (263),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSG+GRDGI+RSLRPP+VLPRDPNLSMVSFLFRN S Y  +PA+ D ++  TL+FSQ 
Sbjct  1    MEKSGFGRDGIFRSLRPPLVLPRDPNLSMVSFLFRNSSSYSHKPALIDGESSETLSFSQF  60

Query  314  KSQVSRV  334
            KS+V +V
Sbjct  61   KSKVIQV  67



>ref|XP_009345749.1| PREDICTED: 4-coumarate--CoA ligase-like 7, partial [Pyrus x bretschneideri]
Length=402

 Score =   103 bits (258),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRDPNLSM SFLFRN S Y  +PA+ + ++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDPNLSMASFLFRNSSSYSHKPALIEGESSETLSFSQF  60

Query  314  KSQVSRV  334
            KS+V +V
Sbjct  61   KSKVIQV  67



>ref|XP_010529378.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
7 [Tarenaya hassleriana]
Length=546

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGI+RSLRPP VLP DPNLS+VSFLFR+ S YP +PA+ D+D+G +LTF+QL
Sbjct  1    MEKSGYGSDGIFRSLRPPFVLPSDPNLSLVSFLFRDSSSYPTKPALIDSDSGESLTFAQL  60

Query  314  KSQVSRV  334
            KS V+R+
Sbjct  61   KSAVARL  67



>emb|CDY39153.1| BnaC09g21910D [Brassica napus]
Length=539

 Score =   105 bits (261),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ME SGYGRDGIYRSLRP +VLP+DPN S+VSFLF N S YP +PA+ D+DTG +L+FSQL
Sbjct  1    MENSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFGNTSSYPTKPALVDSDTGDSLSFSQL  60

Query  314  KSQVSRV  334
            K+ VSR+
Sbjct  61   KAAVSRL  67



>emb|CDY39155.1| BnaC09g21890D [Brassica napus]
Length=542

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRN-ISQYPDQPAIHDADTGRTLTFSQ  310
            MEKSGYGRDGIYRSLRPP+VLP+DPN S+VSFLFRN  S YP +PAI D+D+G +L+FS 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPKDPNTSLVSFLFRNSSSSYPSKPAIIDSDSGDSLSFSD  60

Query  311  LKSQVSRV  334
            LKS V+R+
Sbjct  61   LKSSVARL  68



>ref|XP_002872738.1| hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48997.1| hypothetical protein ARALYDRAFT_490166 [Arabidopsis lyrata subsp. 
lyrata]
Length=544

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S YP + AI D+D+G +L+FSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYPSKLAIADSDSGDSLSFSQL  60

Query  314  KSQVSRV  334
            KS V+R+
Sbjct  61   KSAVARL  67



>ref|XP_009335967.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Pyrus x bretschneideri]
Length=545

 Score =   104 bits (259),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRDPNLSM SFLFRN S Y  +PA+ + ++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDPNLSMASFLFRNSSSYSHKPALIEGESSETLSFSQF  60

Query  314  KSQVSRV  334
            KS+V +V
Sbjct  61   KSKVIQV  67



>ref|XP_007208457.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica]
 gb|EMJ09656.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica]
Length=542

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+VLPRD NLSMVSFLFRN S Y ++PA+ DA++  TL+FSQ 
Sbjct  1    MEKSGYGRDGIFRSLRPPLVLPRDLNLSMVSFLFRNSSSYSNKPALIDAESSETLSFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSLVIKV  67



>ref|XP_010042863.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
Length=357

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LPRDP+LSMVSFLFRN + Y D+PA+ +ADT  TLTF+Q 
Sbjct  1    MEKSGYGRDGIYRSLRPSLALPRDPDLSMVSFLFRNSASYADKPALVEADTDETLTFAQF  60

Query  314  KSQVSRV  334
            +S+V ++
Sbjct  61   ESRVIKL  67



>gb|AGO89328.1| Ca4CL11 [Salix arbutifolia]
Length=543

 Score =   103 bits (257),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMVSFLFRN   YP +PA+ DAD   TL++S+L
Sbjct  1    MEKSGYGRDGIYRSLRPKLVLPKDPNLSMVSFLFRNSDSYPHKPALIDADLSITLSYSEL  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSVVIKV  67



>ref|XP_002305282.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
 gb|EEE85793.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
Length=543

 Score =   103 bits (257),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLS+VSFLFRN + YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPKLVLPKDPNLSLVSFLFRNSNSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>gb|EPS70306.1| hypothetical protein M569_04447, partial [Genlisea aurea]
Length=540

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP+ LP DPNLSMVSFLFRN S Y D+PA+ DA TG  ++FSQ 
Sbjct  1    MEKSGYGRDGVYRSLRPPVSLPEDPNLSMVSFLFRNSSTYSDKPALIDAHTGNVVSFSQF  60

Query  314  KSQVSRV  334
            ++ V+++
Sbjct  61   ETLVAKL  67



>gb|KDO60233.1| hypothetical protein CISIN_1g0436011mg, partial [Citrus sinensis]
Length=340

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMV FLFRN + Y  + A+ DAD+G +LTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPALVLPQDPNLSMVHFLFRNSASYGSKSALIDADSGESLTFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>emb|CDY46375.1| BnaA09g19890D [Brassica napus]
Length=542

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRN-ISQYPDQPAIHDADTGRTLTFSQ  310
            MEKSGYGRDGIYRSLRPP++LP+DPN S+VSFLFRN  S YP +PAI D+D+G +L+FS 
Sbjct  1    MEKSGYGRDGIYRSLRPPLLLPKDPNTSLVSFLFRNSSSSYPSKPAIIDSDSGVSLSFSD  60

Query  311  LKSQVSRV  334
            LKS V+R+
Sbjct  61   LKSSVARL  68



>gb|AIA24410.1| 4-coumarate-CoA ligase [Sinopodophyllum hexandrum]
Length=533

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+ LP +PNLSM+SFLFRN + YP+Q A+ D+D+ +TLTF Q 
Sbjct  1    MEKSGYGRDGIYRSLRPPLTLPTNPNLSMISFLFRNSNSYPNQLALIDSDSNKTLTFHQF  60

Query  314  KSQVSRV  334
            KS V+++
Sbjct  61   KSTVAKI  67



>ref|XP_010689117.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=540

 Score =   102 bits (255),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ME+SGYGRDGIYRSLRP ++ P +PNL+MVSFLFRNIS YP++PA+ D+D+G  L FS+L
Sbjct  1    MERSGYGRDGIYRSLRPSLITPTNPNLNMVSFLFRNISSYPEKPALIDSDSGEILNFSKL  60

Query  314  KSQVSRV  334
             S VS +
Sbjct  61   NSMVSNL  67



>ref|XP_006287440.1| hypothetical protein CARUB_v10000646mg [Capsella rubella]
 gb|EOA20338.1| hypothetical protein CARUB_v10000646mg [Capsella rubella]
Length=544

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPN S+VSFLFRN S Y  + A+ D+D+G +LTFSQL
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDPNTSLVSFLFRNSSSYSSKLALADSDSGESLTFSQL  60

Query  314  KSQVSRV  334
            KS V+R+
Sbjct  61   KSAVARL  67



>ref|XP_011004441.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Populus euphratica]
Length=543

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLS+VSFLFRN + YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPKLVLPKDPNLSLVSFLFRNSNSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>ref|XP_002276353.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Vitis vinifera]
Length=544

 Score =   102 bits (254),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSL PP+VLP+DPNLS+VSFLFR  S YP +PA+ +A +G T+ F+Q 
Sbjct  1    MEKSGYGRDGIYRSLSPPLVLPKDPNLSLVSFLFRKASSYPRRPALIEAHSGETVNFAQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSMVIKV  67



>gb|EYU18792.1| hypothetical protein MIMGU_mgv1a004091mg [Erythranthe guttata]
Length=544

 Score =   102 bits (254),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG+YRSLRPP   P+DPN+SMVSFLFRNIS + D+ A+ D+ TG TL F+Q 
Sbjct  1    MEKSGYGRDGVYRSLRPPFFPPKDPNISMVSFLFRNISSFSDKRALVDSHTGETLNFAQF  60

Query  314  KSQVSRV  334
            KS V++V
Sbjct  61   KSMVNKV  67



>ref|XP_010045319.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
Length=544

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LPRDP+LSMVSFLFRN + Y D+PA+ +ADT  TLTF+Q 
Sbjct  1    MEKSGYGRDGIYRSLRPSLALPRDPDLSMVSFLFRNSASYADKPALVEADTDETLTFAQF  60

Query  314  KSQVSRV  334
            +S+V ++
Sbjct  61   ESRVIKL  67



>ref|XP_008384715.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Malus domestica]
Length=544

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSG+GRDGI+RSLRPP+VLPRDPNLSMVSFLFRN S Y  +PA+ D ++  TL+FSQ 
Sbjct  1    MEKSGFGRDGIFRSLRPPLVLPRDPNLSMVSFLFRN-SSYSHKPALIDGESSETLSFSQF  59

Query  314  KSQVSRV  334
            KS+V +V
Sbjct  60   KSKVIQV  66



>gb|AGW27195.1| 4-coumarate:coenzyme A ligase 5 [Salvia miltiorrhiza]
Length=545

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDG++RSLRPP+ LP +PNLS+VSFLFRN S + ++ A+ DA TG TLTFS  
Sbjct  1    MEKSGYGRDGVFRSLRPPLSLPTNPNLSLVSFLFRNTSSFAEKRALIDAHTGETLTFSHF  60

Query  314  KSQVSRV  334
            KS VSRV
Sbjct  61   KSMVSRV  67



>ref|XP_009114500.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Brassica rapa]
Length=541

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ME SGYGRDGIYRSLRP +VLP DPN S+VSFLF N S  P +PA+ D+DTG +L+FSQL
Sbjct  1    MENSGYGRDGIYRSLRPTLVLPEDPNTSLVSFLFANTSSCPSKPALVDSDTGDSLSFSQL  60

Query  314  KSQVSRV  334
            K+ VSR+
Sbjct  61   KAAVSRL  67



>ref|XP_006488030.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=546

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMV FLFRN + Y  + A+ DAD+G +LTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPALVLPQDPNLSMVHFLFRNSASYGSKSALIDADSGESLTFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>emb|CAN70560.1| hypothetical protein VITISV_031619 [Vitis vinifera]
Length=663

 Score =   101 bits (252),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSL PP+VLP+DPNLS+VSFLFR  S YP +PA+ +A +G T+ F Q 
Sbjct  84   MEKSGYGRDGIYRSLSPPLVLPKDPNLSLVSFLFRKASSYPRRPALIEAHSGETVNFXQF  143

Query  314  KSQVSRV  334
            KS V +V
Sbjct  144  KSMVIKV  150



>gb|KCW87478.1| hypothetical protein EUGRSUZ_B03942 [Eucalyptus grandis]
Length=626

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LPRDP+LSMVSFLFRN + Y D+PA+ +ADT  TLTF+Q 
Sbjct  93   MEKSGYGRDGIYRSLRPSLALPRDPDLSMVSFLFRNSASYADKPALVEADTDETLTFAQF  152

Query  314  KSQVSRV  334
            +S+V ++
Sbjct  153  ESRVIKL  159



>gb|KCW87479.1| hypothetical protein EUGRSUZ_B03943 [Eucalyptus grandis]
Length=670

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LPRDP+LSMVSFLFRN + Y D+PA+ +ADT  TLTF+Q 
Sbjct  127  MEKSGYGRDGIYRSLRPSLALPRDPDLSMVSFLFRNSASYADKPALVEADTDETLTFAQF  186

Query  314  KSQVSRV  334
            +S+V ++
Sbjct  187  ESRVIKL  193



>ref|XP_004147290.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cucumis sativus]
 ref|XP_004171168.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cucumis sativus]
 gb|KGN64806.1| hypothetical protein Csa_1G108800 [Cucumis sativus]
Length=543

 Score =   100 bits (250),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+V P+DPNLSM+SFLFRN+  YP++ AI DA++  ++++SQL
Sbjct  1    MEKSGYGRDGIFRSLRPPLVFPKDPNLSMISFLFRNLLSYPNRLAIVDAESSNSVSYSQL  60

Query  314  KSQVSRV  334
            K+   RV
Sbjct  61   KALAIRV  67



>emb|CDY46376.1| BnaA09g19900D [Brassica napus]
Length=539

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            ME SGYGRDGIYRSLRP +VLP DPN S+VSFLF N S  P +PA+ D+DTG +L+FSQL
Sbjct  1    MENSGYGRDGIYRSLRPTLVLPEDPNTSLVSFLFANTSSCPSKPALVDSDTGDSLSFSQL  60

Query  314  KSQVSRV  334
            K+ VSR+
Sbjct  61   KAAVSRL  67



>gb|AGO89329.1| Ca4CL12 [Salix arbutifolia]
Length=529

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+D NLS+VSFLFRN   YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDSNLSLVSFLFRNSDSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>ref|XP_006373451.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
 gb|ERP51248.1| 4-coumarate--CoA ligase family protein [Populus trichocarpa]
Length=543

 Score =   100 bits (248),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLPRD NLS+VSFLFRN + YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPRDSNLSLVSFLFRNSNSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQV  325
            KS V
Sbjct  61   KSIV  64



>gb|AGO89327.1| Ca4CL10 [Salix arbutifolia]
Length=548

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+D NLS+VSFLFRN   YP +PA+ DAD   TL+FS+L
Sbjct  1    MEKSGYGRDGIYRSLRPTLVLPKDSNLSLVSFLFRNSDSYPHKPALIDADLSITLSFSEL  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>gb|AFD33347.1| acyl-activating enzyme 3 [Cannabis sativa]
Length=543

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+ LP + NLSMVSFLFRN S YP +PA+ D++T + L+FS  
Sbjct  1    MEKSGYGRDGIYRSLRPPLHLPNNNNLSMVSFLFRNSSSYPQKPALIDSETNQILSFSHF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSTVIKV  67



>gb|AFK46688.1| unknown [Medicago truncatula]
Length=92

 Score = 91.7 bits (226),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP +PNLS+VSFLF ++S  P++ A+ DAD+ +TL+FSQL
Sbjct  1    MQRSGYGPDGIYRSLRPSLALPNNPNLSLVSFLFTSVSSSPNKTALIDADSSQTLSFSQL  60

Query  314  KSQVSRV  334
            K+QV+++
Sbjct  61   KTQVAKL  67



>ref|XP_006424487.1| hypothetical protein CICLE_v10029864mg [Citrus clementina]
 gb|ESR37727.1| hypothetical protein CICLE_v10029864mg [Citrus clementina]
Length=509

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP +VLP+DPNLSMV FLFR+ + Y  + A+ D+D+G  LTFSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPALVLPQDPNLSMVHFLFRSSASYGSKSALIDSDSGECLTFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>gb|KDO60238.1| hypothetical protein CISIN_1g0137801mg [Citrus sinensis]
Length=342

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP DP+ SMV FLFRN + Y  + A+ DAD+  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>gb|KDO60235.1| hypothetical protein CISIN_1g0137801mg [Citrus sinensis]
Length=435

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP DP+ SMV FLFRN + Y  + A+ DAD+  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>gb|KDO60236.1| hypothetical protein CISIN_1g0137801mg [Citrus sinensis]
Length=436

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP DP+ SMV FLFRN + Y  + A+ DAD+  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>gb|KFK32221.1| hypothetical protein AALP_AA6G213500 [Arabis alpina]
Length=542

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRP + LP+DPN S+VSFLFRN S Y    A+ D+D+G + TFS L
Sbjct  1    MEKSGYGRDGIYRSLRPMLTLPKDPNTSLVSFLFRNSSSYSSNLALADSDSGHSFTFSDL  60

Query  314  KSQVSRV  334
            KS VSR+
Sbjct  61   KSAVSRL  67



>ref|XP_006488029.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis]
Length=546

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSLRPP+VLP DP+ SMV FLFRN + Y  + A+ DAD+  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDPSFSMVHFLFRNSASYSSKLALIDADSDESLSFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>ref|XP_008463063.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis melo]
Length=543

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/67 (61%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSG GRDGI+RSLRPP+V P+DPNLSM+SFLFRN+  YP++ AI DA++  ++++SQL
Sbjct  1    MEKSGCGRDGIFRSLRPPLVFPKDPNLSMISFLFRNLLSYPNRLAIVDAESSYSVSYSQL  60

Query  314  KSQVSRV  334
            K+   R+
Sbjct  61   KALAIRL  67



>gb|KEH29988.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=453

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP +PNLS+VSFLF ++S  P++ A+ DAD+ +TL+FSQL
Sbjct  1    MQRSGYGPDGIYRSLRPSLALPNNPNLSLVSFLFTSVSSSPNKTALIDADSSQTLSFSQL  60

Query  314  KSQVSRV  334
            K+QV+++
Sbjct  61   KTQVAKL  67



>gb|KEH29987.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=471

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP +PNLS+VSFLF ++S  P++ A+ DAD+ +TL+FSQL
Sbjct  1    MQRSGYGPDGIYRSLRPSLALPNNPNLSLVSFLFTSVSSSPNKTALIDADSSQTLSFSQL  60

Query  314  KSQVSRV  334
            K+QV+++
Sbjct  61   KTQVAKL  67



>ref|XP_006424481.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
 ref|XP_006424483.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
 gb|ESR37721.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
 gb|ESR37723.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
Length=339

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGIYRSL PP+VLP DP+ SMV+FLFRN + Y  + A+ DA++  +L+FSQ 
Sbjct  1    MEKSGYGRDGIYRSLTPPLVLPSDPSFSMVNFLFRNSASYSSKLALIDANSDESLSFSQF  60

Query  314  KSQVSRV  334
            KS V +V
Sbjct  61   KSIVIKV  67



>gb|KEH29989.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=542

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP +PNLS+VSFLF ++S  P++ A+ DAD+ +TL+FSQL
Sbjct  1    MQRSGYGPDGIYRSLRPSLALPNNPNLSLVSFLFTSVSSSPNKTALIDADSSQTLSFSQL  60

Query  314  KSQVSRV  334
            K+QV+++
Sbjct  61   KTQVAKL  67



>ref|XP_011021223.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X4 [Populus 
euphratica]
Length=472

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGIYRSLRP +VLP+D NLS+VSFLFRN + YP + A+ DAD   TL+FS+L
Sbjct  1    MEKSGYGCDGIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSEL  60

Query  314  KSQV  325
            KS V
Sbjct  61   KSIV  64



>gb|KHN38721.1| 4-coumarate--CoA ligase-like 7 [Glycine soja]
Length=435

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+K+GYG DGIYRSLRP +VLP DPNLS+VSFLF+++S +P + A+ D+ + +TLT + L
Sbjct  1    MQKAGYGGDGIYRSLRPCLVLPNDPNLSLVSFLFQSVSSFPSKIALVDSHSSQTLTLAHL  60

Query  314  KSQVSRV  334
            KSQV+++
Sbjct  61   KSQVAKL  67



>ref|XP_011021222.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X3 [Populus 
euphratica]
Length=514

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGIYRSLRP +VLP+D NLS+VSFLFRN + YP + A+ DAD   TL+FS+L
Sbjct  1    MEKSGYGCDGIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSEL  60

Query  314  KSQVSR  331
            KS V +
Sbjct  61   KSIVIK  66



>ref|XP_011021221.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X2 [Populus 
euphratica]
Length=543

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGIYRSLRP +VLP+D NLS+VSFLFRN + YP + A+ DAD   TL+FS+L
Sbjct  1    MEKSGYGCDGIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSEL  60

Query  314  KSQVSR  331
            KS V +
Sbjct  61   KSIVIK  66



>ref|XP_011021220.1| PREDICTED: 4-coumarate--CoA ligase-like 7 isoform X1 [Populus 
euphratica]
Length=543

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG DGIYRSLRP +VLP+D NLS+VSFLFRN + YP + A+ DAD   TL+FS+L
Sbjct  1    MEKSGYGCDGIYRSLRPTLVLPKDSNLSLVSFLFRNSNSYPHKSALIDADLSITLSFSEL  60

Query  314  KSQVSR  331
            KS V +
Sbjct  61   KSIVIK  66



>ref|XP_006591122.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like isoform X2 [Glycine 
max]
Length=558

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+K+GYG DGIYRSLRP +VLP DPNLS+VSFLF+++S +P + A+ D+ + +TLT + L
Sbjct  11   MQKAGYGGDGIYRSLRPCLVLPNDPNLSLVSFLFQSVSSFPSKIALVDSHSSQTLTLAHL  70

Query  314  KSQVSRV  334
            KSQV+++
Sbjct  71   KSQVAKL  77



>gb|ABR17274.1| unknown [Picea sitchensis]
Length=540

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG+DGI+RSLRPP+ LP+D N +MVSF+FR+ S Y D+ A+ DAD+G  L+F   
Sbjct  1    MEKSGYGKDGIFRSLRPPLNLPKDENANMVSFMFRDSSSYADKLALADADSGEKLSFRDF  60

Query  314  KSQVSRV  334
            K +VS V
Sbjct  61   KDKVSMV  67



>ref|XP_006591121.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like isoform X1 [Glycine 
max]
Length=567

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+K+GYG DGIYRSLRP +VLP DPNLS+VSFLF+++S +P + A+ D+ + +TLT + L
Sbjct  11   MQKAGYGGDGIYRSLRPCLVLPNDPNLSLVSFLFQSVSSFPSKIALVDSHSSQTLTLAHL  70

Query  314  KSQVSRV  334
            KSQV+++
Sbjct  71   KSQVAKL  77



>ref|XP_009114499.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Brassica rapa]
Length=542

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRN-ISQYPDQPAIHDADTGRTLTFSQ  310
            MEKSGYGRDGIYRSLRPP+VLP+DPN S+VSFLFRN  S YP +P+I D+D+G +L+FS 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPKDPNTSLVSFLFRNSSSSYPSKPSIIDSDSGVSLSFSD  60

Query  311  LKSQVSRV  334
            LKS V+R+
Sbjct  61   LKSSVARL  68



>ref|XP_006843037.1| hypothetical protein AMTR_s00076p00189570 [Amborella trichopoda]
 gb|ERN04712.1| hypothetical protein AMTR_s00076p00189570 [Amborella trichopoda]
Length=543

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYG+DGIYRSLRPP+V P+DP L+M+SF+FRN S Y ++ A+ DA+T   L F +L
Sbjct  1    MEKSGYGKDGIYRSLRPPVVFPKDPYLNMMSFMFRNSSLYGEKLAVADAETDEGLNFREL  60

Query  314  KSQVSRV  334
            +  V RV
Sbjct  61   EVVVDRV  67



>gb|ABR18186.1| unknown [Picea sitchensis]
Length=540

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/67 (60%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEKSGYGRDGI+RSLRPP+ LP+D N +MVSF+FR+ S Y  + A+ DAD+G  L+F + 
Sbjct  1    MEKSGYGRDGIFRSLRPPLKLPKDENANMVSFMFRDSSSYAHRLALADADSGEKLSFREF  60

Query  314  KSQVSRV  334
            K +VS V
Sbjct  61   KDKVSIV  67



>gb|AGW47873.1| 4-coumarate:coenzyme A ligase 8 [Phaseolus vulgaris]
Length=548

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            AM +SGY  DG YRS RP +VLP++PNLS+VSFLF+++S +P + A+ DAD+ +TLTF+Q
Sbjct  4    AMHRSGYCSDGTYRSQRPSLVLPKNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQ  63

Query  311  LKSQVS  328
            LK++V+
Sbjct  64   LKARVA  69



>gb|KEH39398.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=457

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+KSGYG DGIYRSLRP ++LP++PNLS+V+ LF  ++  P++ A+ DAD+ +TLTF+QL
Sbjct  1    MQKSGYGSDGIYRSLRPSLILPKNPNLSLVTHLFNKVTSSPNKTALIDADSSQTLTFAQL  60

Query  314  KS  319
            KS
Sbjct  61   KS  62



>gb|KEH39397.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=539

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M+KSGYG DGIYRSLRP ++LP++PNLS+V+ LF  ++  P++ A+ DAD+ +TLTF+QL
Sbjct  1    MQKSGYGSDGIYRSLRPSLILPKNPNLSLVTHLFNKVTSSPNKTALIDADSSQTLTFAQL  60

Query  314  KS  319
            KS
Sbjct  61   KS  62



>ref|XP_007132315.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
 gb|ESW04309.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
Length=462

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+ +SGY  DG YRS RP +VLP +PNLS+VSFLF+++S +P + A+ DAD+ +TLTF+Q
Sbjct  4    AIHRSGYCSDGTYRSQRPSLVLPDNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQ  63

Query  311  LKSQVS  328
            LK++V+
Sbjct  64   LKARVA  69



>ref|XP_007132313.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
 gb|ESW04307.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
Length=477

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+ +SGY  DG YRS RP +VLP +PNLS+VSFLF+++S +P + A+ DAD+ +TLTF+Q
Sbjct  4    AIHRSGYCSDGTYRSQRPSLVLPDNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQ  63

Query  311  LKSQVS  328
            LK++V+
Sbjct  64   LKARVA  69



>ref|XP_008808867.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Phoenix dactylifera]
Length=544

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            S YG DG++RSLRPPI  P DP+LSMV FLFR  + +PD+ A+ DAD+GR+LTF QL+S 
Sbjct  5    SSYGPDGVHRSLRPPIAFPSDPDLSMVPFLFRRTAAFPDRLALADADSGRSLTFLQLRSA  64

Query  323  VS  328
            VS
Sbjct  65   VS  66



>ref|XP_007132314.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
 gb|ESW04308.1| hypothetical protein PHAVU_011G084300g [Phaseolus vulgaris]
Length=548

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+ +SGY  DG YRS RP +VLP +PNLS+VSFLF+++S +P + A+ DAD+ +TLTF+Q
Sbjct  4    AIHRSGYCSDGTYRSQRPSLVLPDNPNLSLVSFLFQSVSSFPSKTALVDADSSQTLTFAQ  63

Query  311  LKSQVS  328
            LK++V+
Sbjct  64   LKARVA  69



>gb|KHN21493.1| 4-coumarate--CoA ligase-like 7 [Glycine soja]
Length=533

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP IV P++ NLS+VS LF  ++ +P +PA+ DAD+  TL+F++L
Sbjct  1    MQRSGYGSDGIYRSLRPSIVFPKNSNLSLVSHLFNRVAAFPSKPALIDADSSETLSFAEL  60

Query  314  KSQVSRV  334
            K    RV
Sbjct  61   KLLTVRV  67



>gb|AGW47869.1| 4-coumarate:coenzyme A ligase 4 [Phaseolus vulgaris]
Length=536

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGI+RSLRP IVLP+ PNL++VS LF  ++ +P + A+ DAD+ +TL+F+QL
Sbjct  1    MQRSGYGSDGIFRSLRPSIVLPKQPNLTLVSHLFNRVAPFPSKHALIDADSSQTLSFAQL  60

Query  314  KSQVSRV  334
            KS   +V
Sbjct  61   KSLTVKV  67



>ref|NP_001243292.1| 4-coumarate--CoA ligase-like 7-like [Glycine max]
 gb|AEX25890.1| 4-coumarate:CoA ligase [Glycine max]
Length=540

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP IV P++ NLS+VS LF  ++ +P +PA+ DAD+  TL+F++L
Sbjct  1    MQRSGYGSDGIYRSLRPSIVFPKNSNLSLVSHLFNRVAAFPSKPALIDADSSETLSFAEL  60

Query  314  KSQVSRV  334
            K    RV
Sbjct  61   KLLTVRV  67



>ref|XP_007150153.1| hypothetical protein PHAVU_005G131400g [Phaseolus vulgaris]
 gb|ESW22147.1| hypothetical protein PHAVU_005G131400g [Phaseolus vulgaris]
Length=536

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGI+RSLRP I LP+ PNL++VS LF  ++ +P + A+ DAD+ +TL+F+QL
Sbjct  1    MQRSGYGSDGIFRSLRPSIALPKQPNLTLVSHLFNRVAPFPSKHALIDADSSQTLSFAQL  60

Query  314  KSQVSRV  334
            KS   +V
Sbjct  61   KSLTVKV  67



>ref|XP_004487067.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cicer arietinum]
Length=539

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M++SGYG DGIYRSLRP + LP+ PNLS+V+ LF  ++    +PA+ DAD+ +TLTF+QL
Sbjct  1    MQRSGYGSDGIYRSLRPSLTLPKHPNLSLVTHLFTKVASSLTKPALIDADSLQTLTFAQL  60

Query  314  KS  319
            KS
Sbjct  61   KS  62



>ref|XP_009413145.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Musa acuminata subsp. 
malaccensis]
Length=543

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M KSGYG DGIYRSLRP I  P DP LSMV FLFR+ + +PD+ A+ DADTG  L+F+ L
Sbjct  1    MGKSGYGPDGIYRSLRPRIAFPADPALSMVPFLFRSAAAHPDRLALVDADTGDALSFADL  60

Query  314  K  316
            +
Sbjct  61   R  61



>ref|XP_009401821.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Musa acuminata subsp. 
malaccensis]
Length=544

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  140  KSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKS  319
            KSGYG DG+YRSLR  I  P DP+LSMV F FR    YPD+ A+ DADTG +L+F  L+S
Sbjct  4    KSGYGSDGVYRSLRAHIAFPDDPDLSMVPFFFRRAVAYPDRLALADADTGASLSFQALRS  63

Query  320  QV  325
             V
Sbjct  64   AV  65



>ref|XP_010918638.1| PREDICTED: 4-coumarate--CoA ligase-like 1 isoform X2 [Elaeis 
guineensis]
Length=512

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            S +  DG+YRSL PPI  P DP+LSM+ FLFR  + +PD+ A+ DAD+GR+LTF QL+S 
Sbjct  5    SSFHPDGVYRSLSPPIAFPSDPDLSMLPFLFRRTAAFPDRLALADADSGRSLTFLQLRSA  64

Query  323  VS  328
            +S
Sbjct  65   IS  66



>ref|XP_010918637.1| PREDICTED: 4-coumarate--CoA ligase-like 1 isoform X1 [Elaeis 
guineensis]
Length=544

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            S +  DG+YRSL PPI  P DP+LSM+ FLFR  + +PD+ A+ DAD+GR+LTF QL+S 
Sbjct  5    SSFHPDGVYRSLSPPIAFPSDPDLSMLPFLFRRTAAFPDRLALADADSGRSLTFLQLRSA  64

Query  323  VS  328
            +S
Sbjct  65   IS  66



>ref|XP_011087155.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Sesamum indicum]
Length=545

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  149  YGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQV  325
            YG DGIYRS RPP+ LP+DP  SM+ +LFRN+S     PA+ DA+TG+T TFS L++QV
Sbjct  7    YGNDGIYRSPRPPLSLPQDPKFSMIPYLFRNLSSISHLPALVDAETGQTSTFSVLRTQV  65



>ref|XP_004153142.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like, partial [Cucumis 
sativus]
Length=230

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  128  LAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFS  307
            + M KS   +  +Y S RPPI  P DP +S+VSFLFRN S YP+  A+ DAD+G +LTF 
Sbjct  3    ITMNKSFNPQSQVYTSRRPPIHFPTDPTISIVSFLFRNSSSYPNALALVDADSGESLTFR  62

Query  308  QLKSQVSRV  334
            QL+ QVS++
Sbjct  63   QLQIQVSKL  71



>emb|CDP06777.1| unnamed protein product [Coffea canephora]
Length=521

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  149  YGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVS  328
            YG+DGIYRS +PP+VLP DPNLSMV FLFRN        A+ DA T  + TF  L +QVS
Sbjct  6    YGKDGIYRSQKPPVVLPEDPNLSMVPFLFRNFPSLSQSTALIDAGTAESFTFFDLLTQVS  65

Query  329  RV  334
            ++
Sbjct  66   KL  67



>gb|AGA17927.1| CCL10 [Humulus lupulus]
Length=543

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            MEK       IY S RPP+  P DP LS+ SFLFR+ + YP++ A+ DAD+G+TLTF +L
Sbjct  1    MEKCFNPETQIYSSHRPPVNFPTDPKLSLTSFLFRSSASYPNRTALIDADSGQTLTFLKL  60

Query  314  KSQVSRV  334
            K+QVS++
Sbjct  61   KTQVSKL  67



>ref|XP_008442710.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Cucumis melo]
Length=545

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  128  LAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFS  307
            + M KS   +  IY S RPPI  P DP +S+VSFLFRN S YP+  A+ DAD+G +LTF 
Sbjct  3    ITMNKSFNPQSRIYSSPRPPIHFPTDPKISIVSFLFRNSSSYPNALALADADSGESLTFR  62

Query  308  QLKSQVSRV  334
            QL+ QVS++
Sbjct  63   QLQIQVSKL  71



>gb|AIY34663.1| 4-coumarate:CoA ligase-like protein [Ornithogalum saundersiae]
Length=547

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  161  GIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVS  328
            GIY S RPP+  P DP+LSM+SFLFRN+  YP++ A+ DA++GR+ TF++L+S VS
Sbjct  12   GIYTSPRPPLSFPSDPDLSMISFLFRNVDLYPNRLALVDAESGRSFTFAELRSTVS  67



>ref|XP_004161266.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cucumis sativus]
Length=545

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  128  LAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFS  307
            + M KS   +  +Y S RPPI  P DP +S+VSFLFRN S YP+  A+ DAD+G +LTF 
Sbjct  3    ITMNKSFNPQSQVYTSRRPPIHFPTDPTISIVSFLFRNSSSYPNALALVDADSGESLTFR  62

Query  308  QLKSQVSRV  334
            QL+ QVS++
Sbjct  63   QLQIQVSKL  71



>gb|KGN58984.1| hypothetical protein Csa_3G740270 [Cucumis sativus]
Length=545

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  128  LAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFS  307
            + M KS   +  +Y S RPPI  P DP +S+VSFLFRN S YP+  A+ DAD+G +LTF 
Sbjct  3    ITMNKSFNPQSQVYTSRRPPIHFPTDPTISIVSFLFRNSSSYPNALALVDADSGESLTFR  62

Query  308  QLKSQVSRV  334
            QL+ QVS++
Sbjct  63   QLQIQVSKL  71



>dbj|BAJ88705.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  146  GYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQV  325
            GYG DG+YRSLRPP  +P DP LS+   L R     P  PA+ DA TGR L+F+ L+S V
Sbjct  36   GYGADGVYRSLRPPARIPSDPGLSVADLLLRRADACPSAPALIDAATGRALSFAGLRSAV  95



>ref|XP_011087272.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Sesamum indicum]
Length=546

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 3/59 (5%)
 Frame = +2

Query  149  YGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQV  325
            Y  DGI+RS RPPI LP   NLSM+SFLFR +      PA+  A+TG+TLTFS LK+QV
Sbjct  12   YSEDGIHRSPRPPIFLP---NLSMISFLFRKLPSNAHSPALIQAETGQTLTFSDLKTQV  67



>ref|XP_004304462.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Fragaria vesca subsp. 
vesca]
Length=527

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQL  313
            M KS     G Y S RPP+  P +PNLS+ SFLF++ S  P   A+ DAD+G TLTF QL
Sbjct  1    MAKSFDSETGTYTSPRPPVHFPENPNLSLTSFLFQSSSSTPHSLALADADSGETLTFLQL  60

Query  314  KSQVSRV  334
            K+ VSR+
Sbjct  61   KTLVSRL  67



>ref|XP_010654332.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Vitis vinifera]
Length=134

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            +YRS RP + +P DP++SM+SFLFR  S +  + A+ D+D+G TLTF QLKS VSR+
Sbjct  6    VYRSPRPHVDIPNDPSISMLSFLFRKTSSFSTRLALVDSDSGETLTFFQLKSTVSRL  62



>ref|XP_004985664.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Setaria italica]
Length=575

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+  +GYG DG+YRSLRP + +P DP LS+   +FR     P   A+ DA TGR LTF+ 
Sbjct  6    AVPTAGYGEDGVYRSLRPAVPIPSDPGLSLNDLIFRRADACPAALALVDAATGRALTFAG  65

Query  311  LK  316
            L+
Sbjct  66   LR  67



>emb|CBI30139.3| unnamed protein product [Vitis vinifera]
Length=649

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            +YRS RP + +P DP++SM+SFLFR  S +  + A+ D+D+G TLTF QLKS VSR+
Sbjct  6    VYRSPRPHVDIPNDPSISMLSFLFRKTSSFSTRLALVDSDSGETLTFFQLKSTVSRL  62



>ref|XP_007203616.1| hypothetical protein PRUPE_ppa003871mg [Prunus persica]
 gb|EMJ04815.1| hypothetical protein PRUPE_ppa003871mg [Prunus persica]
Length=543

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            Y S RPP+  P DPNLS+ SFLF++ + +P+  A+ ++DT  TLTF QLKS VS++
Sbjct  13   YTSPRPPVPFPTDPNLSLTSFLFQSSTSFPNNLALAESDTAETLTFLQLKSLVSKL  68



>ref|XP_008241410.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Prunus mume]
Length=576

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  140  KSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKS  319
            KS   +   Y S RPP   P DPNLS+ SFLF++ + +P+  A+ D+DT  TLTF QLKS
Sbjct  37   KSFNPKTQTYSSPRPPAPFPTDPNLSLTSFLFQSSTSFPNNLALADSDTAETLTFLQLKS  96

Query  320  QVSRV  334
             VS++
Sbjct  97   LVSKL  101



>ref|XP_004982544.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Setaria italica]
Length=550

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            +GYG DG+YRS RP   +P DP LS+   + R  +  P  PA+ DA TG  LTF  L+S 
Sbjct  10   AGYGSDGVYRSPRPAAPIPSDPALSLSDLVLRRAAACPSAPALVDAATGAALTFGALRSA  69

Query  323  V  325
            V
Sbjct  70   V  70



>gb|KDO60237.1| hypothetical protein CISIN_1g0137801mg, partial [Citrus sinensis]
Length=373

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQ  250
            MEKSGYGRDGIYRSLRPP+VLP DP+ SM   +   +S 
Sbjct  1    MEKSGYGRDGIYRSLRPPLVLPSDPSFSMFKSIVIKVSH  39



>ref|XP_003558787.1| PREDICTED: 4-coumarate--CoA ligase-like 1 [Brachypodium distachyon]
Length=545

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A+  +GYG DG+YRSLRP   +  +P LS V  L R  +  P   A+ DA TG  LTFS 
Sbjct  5    AVPSAGYGADGVYRSLRPAARIESNPGLSAVDLLLRRAAACPSALALVDAATGHALTFSG  64

Query  311  LKSQV  325
            L+S +
Sbjct  65   LRSAI  69



>gb|KEH42182.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=551

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVS  328
            Y S R PI LP DPNLS+ SFLF++ S   D  A+ DA+TG +LTF QLK  VS
Sbjct  13   YSSPRQPINLPTDPNLSLTSFLFQSTSSVADTIALADAETGNSLTFRQLKIHVS  66



>ref|XP_007027423.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
 gb|EOY07925.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
Length=617

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  122  RILAMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHD-ADTGRTL  298
            + LAM KS   +   Y S RPPI LP +P LS+ SF+F + S  P + A+ D +++  TL
Sbjct  66   QTLAMAKSFNPKTQTYTSPRPPIKLPTNPELSLTSFIFESTSSIPHETALIDSSNSNETL  125

Query  299  TFSQLKSQVS  328
            TF QLK+QVS
Sbjct  126  TFLQLKAQVS  135



>ref|XP_004497538.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Cicer arietinum]
Length=558

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQV  325
            Y S RPPI LP DPNLS+ +FLF++ S   D  A+ DA +  +LTF QLK+QV
Sbjct  15   YSSPRPPIHLPTDPNLSLTTFLFQSTSSAADSIALADAHSNDSLTFHQLKTQV  67



>gb|KJB20367.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=446

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V ++
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKL  39



>ref|XP_006424482.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
 gb|ESR37722.1| hypothetical protein CICLE_v100281392mg, partial [Citrus clementina]
Length=309

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  134  MEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQ  250
            MEKSGYGRDGIYRSL PP+VLP DP+ SM   +   +S 
Sbjct  1    MEKSGYGRDGIYRSLTPPLVLPSDPSFSMFKSIVIKVSH  39



>gb|KJB20368.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=434

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V ++
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKL  39



>gb|KJB20365.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=464

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V ++
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKL  39



>gb|KJB20366.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=518

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V ++
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKL  39



>gb|KJB20364.1| hypothetical protein B456_003G144900 [Gossypium raimondii]
Length=517

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  218  MVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            MVSFLFRN+S YP +PA+ DAD+G TLTFSQLKS V ++
Sbjct  1    MVSFLFRNVSCYPYKPALIDADSGETLTFSQLKSTVIKL  39



>ref|XP_002466906.1| hypothetical protein SORBIDRAFT_01g016420 [Sorghum bicolor]
 gb|EER93904.1| hypothetical protein SORBIDRAFT_01g016420 [Sorghum bicolor]
Length=564

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS R    +  DP LS+   + R  +  P  PA+ DA TGR LTF  
Sbjct  5    ASPAAGYGSDGVYRSPRAAAQIASDPGLSLADLVLRRAAACPSAPALVDAATGRALTFGS  64

Query  311  LK  316
            L+
Sbjct  65   LR  66



>ref|XP_008673103.1| PREDICTED: uncharacterized protein LOC100280100 isoform X1 [Zea 
mays]
Length=493

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +GYG DG+YRS R    +  DP LS+   + R  +  P  PA+ DA TGR LTF  L+
Sbjct  9    AGYGSDGVYRSPRLVAAIASDPGLSVTDLVLRRAAACPSAPALVDAATGRALTFGALR  66



>gb|KDP29158.1| hypothetical protein JCGZ_16547 [Jatropha curcas]
Length=479

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            Y S RP + LP DPNLS+ SFLF +         I DAD+  TLTF QL+ QVS++
Sbjct  12   YVSPRPQVYLPSDPNLSLTSFLFHSTRSTSYSTGIIDADSDETLTFQQLRVQVSKL  67



>ref|XP_004982543.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like [Setaria italica]
Length=550

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS R    +P DP LS+  F+    +  P   A+ DA TGR LTF  
Sbjct  5    ASPAAGYGSDGVYRSPRSAAPIPSDPALSLSDFVLSRAAVCPSALALVDAATGRALTFEA  64

Query  311  LKSQV  325
            L+S V
Sbjct  65   LRSAV  69



>tpg|DAA50089.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=550

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +GYG DG+YRS R    +  DP LS+   + R  +  P  PA+ DA TGR LTF  L+
Sbjct  9    AGYGSDGVYRSPRLVAAIASDPGLSVTDLVLRRAAACPSAPALVDAATGRALTFGALR  66



>gb|KJB36450.1| hypothetical protein B456_006G162900 [Gossypium raimondii]
Length=415

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            +   Y S RPP+ LP  P+LS+ SF+F++ S  P   A+ DA +  TLTF QLK+ VS +
Sbjct  9    KSQTYTSPRPPLKLPTSPDLSLTSFIFQSTSSIPHHTALIDATSNETLTFLQLKAHVSSL  68



>tpg|DAA43421.1| TPA: LOW QUALITY PROTEIN: putative AMP-dependent synthetase and 
ligase superfamily protein [Zea mays]
Length=420

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  D  LS+   LFR     P   A+ D+ TG++LTF+ 
Sbjct  5    AAPAAGYGEDGVYRSPRPAVRIESDTGLSLNDLLFRRADVCPSALALVDSATGQSLTFAA  64

Query  311  LKSQV  325
             +S V
Sbjct  65   FRSAV  69



>ref|XP_002519487.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF42901.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=543

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            Y S RPPI LP DPNLS+ SFLF +    P   A+ D+D+  TLTF  L+ +VS++
Sbjct  12   YISPRPPIHLPTDPNLSLTSFLFNSTLSVPHSTALIDSDSNETLTFHDLRIRVSKL  67



>gb|ACF80143.2| unknown [Zea mays]
 tpg|DAA43422.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
 tpg|DAA43423.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=408

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  D  LS+   LFR     P   A+ D+ TG++LTF+ 
Sbjct  5    AAPAAGYGEDGVYRSPRPAVRIESDTGLSLNDLLFRRADVCPSALALVDSATGQSLTFAA  64

Query  311  LKSQV  325
             +S V
Sbjct  65   FRSAV  69



>gb|KJB36451.1| hypothetical protein B456_006G162900 [Gossypium raimondii]
Length=546

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            Y S RPP+ LP  P+LS+ SF+F++ S  P   A+ DA +  TLTF QLK+ VS +
Sbjct  13   YTSPRPPLKLPTSPDLSLTSFIFQSTSSIPHHTALIDATSNETLTFLQLKAHVSSL  68



>ref|XP_008672616.1| PREDICTED: uncharacterized protein LOC100191850 isoform X1 [Zea 
mays]
 tpg|DAA43419.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein isoform 1 [Zea mays]
 tpg|DAA43420.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein isoform 2 [Zea mays]
Length=555

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  D  LS+   LFR     P   A+ D+ TG++LTF+ 
Sbjct  5    AAPAAGYGEDGVYRSPRPAVRIESDTGLSLNDLLFRRADVCPSALALVDSATGQSLTFAA  64

Query  311  LKSQV  325
             +S V
Sbjct  65   FRSAV  69



>ref|XP_001752801.1| predicted protein [Physcomitrella patens]
 gb|EDQ82305.1| predicted protein [Physcomitrella patens]
Length=552

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 3/66 (5%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SGY   DGIY S RPP+ +P   N  +VSF+F    Q+ D+ A+ DA TGR+LT++QL+
Sbjct  11   RSGYCSSDGIYYSKRPPVWIPPTRNFDLVSFVFA--PQFGDRVAMVDAPTGRSLTYAQLE  68

Query  317  SQVSRV  334
              V  V
Sbjct  69   RNVRVV  74



>ref|XP_001759551.1| predicted protein [Physcomitrella patens]
 gb|EDQ75463.1| predicted protein [Physcomitrella patens]
Length=535

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +2

Query  125  ILAMEKSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLT  301
            ++   +SGY   +G+Y S  PP+V+P D +L +VSF+F    Q+ D+ A+ D  TGR+ T
Sbjct  6    VIVDRRSGYCSSNGVYYSKLPPVVIPEDDSLDLVSFVF--AGQFGDKVALIDPLTGRSFT  63

Query  302  FSQLKSQV  325
            + +L+  V
Sbjct  64   YKELERNV  71



>gb|KEH42183.1| 4-coumarate:CoA ligase-like protein [Medicago truncatula]
Length=555

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQV  325
            Y S R  I LP D NLS+ SFLF++ S   D  A+ DA TG  LTF QL+ +V
Sbjct  13   YSSPRQSINLPTDQNLSLTSFLFQSTSSAADTIALTDAQTGEFLTFRQLEKEV  65



>ref|XP_004985666.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like isoform X2 [Setaria 
italica]
Length=546

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  +P LS+   LFR     P   A+ DA +G+TLTF+ 
Sbjct  5    AAPAAGYGADGVYRSPRPAVRIDSNPGLSLTDLLFRRADACPSALALADAASGQTLTFAA  64

Query  311  LKSQV  325
             +S V
Sbjct  65   FRSAV  69



>ref|XP_004985665.1| PREDICTED: 4-coumarate--CoA ligase-like 1-like isoform X1 [Setaria 
italica]
Length=546

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +2

Query  131  AMEKSGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQ  310
            A   +GYG DG+YRS RP + +  +P LS+   LFR     P   A+ DA +G+TLTF+ 
Sbjct  5    AAPAAGYGADGVYRSPRPAVRIDSNPGLSLTDLLFRRADACPSALALADAASGQTLTFAA  64

Query  311  LKSQV  325
             +S V
Sbjct  65   FRSAV  69



>ref|XP_010037647.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis]
 gb|KCW49389.1| hypothetical protein EUGRSUZ_K02927 [Eucalyptus grandis]
Length=548

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = +2

Query  167  YRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQ-----PAIHDADTGRTLTFSQLKSQVS  328
            Y S RPP+  P +P+L++ S LFR+ S          PA+ DAD+G +LTF QLK++VS
Sbjct  14   YTSPRPPLRFPSEPDLTLTSHLFRSYSSCSSSASLQSPALIDADSGESLTFRQLKTRVS  72



>ref|XP_001761993.1| predicted protein [Physcomitrella patens]
 gb|EDQ73097.1| predicted protein [Physcomitrella patens]
Length=552

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = +2

Query  140  KSGY-GRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLK  316
            +SGY   DGIY S R P+ +P+  +L + S++F    Q+ D+ A+ DA +GR LT+ QL+
Sbjct  11   RSGYRSSDGIYFSKRKPVWIPQACDLDLGSYVF--APQFGDKKALMDAPSGRHLTYDQLE  68

Query  317  SQV  325
             QV
Sbjct  69   RQV  71



>ref|XP_008658826.1| PREDICTED: 4-coumarate--CoA ligase-like 3 [Zea mays]
 tpg|DAA46521.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=575

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  161  GIYRSLRPPIVLPRDPNLSMVSFLFRNI-SQYPDQPAIHDADTGRTLTFSQLKSQVS  328
            G+Y S  PP+ LP DP+LS+V  +F  + +  PD PA+ DA T   L+ + L+  VS
Sbjct  25   GVYASTHPPVALPSDPSLSLVPHIFARLPAARPDAPALVDAATAEALSRADLRRLVS  81



>ref|WP_014066333.1| AMP-dependent synthetase [Rhodothermus marinus]
 gb|AEN72609.1| 4-coumarate--CoA ligase [Rhodothermus marinus SG0.5JP17-172]
Length=525

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            IYRS  P + +P  P L MV   F+ + ++PD+PA+ +  TG TLT++QL++Q
Sbjct  3    IYRSPFPDVEIPEIPLLEMV---FQRVDEHPDKPALIEGLTGHTLTYAQLRAQ  52



>ref|XP_002464864.1| hypothetical protein SORBIDRAFT_01g027820 [Sorghum bicolor]
 gb|EER91862.1| hypothetical protein SORBIDRAFT_01g027820 [Sorghum bicolor]
Length=579

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +2

Query  161  GIYRSLRPPIVLPRDPNLSMVSFLFRNI-SQYPDQPAIHDADTGRTLTFSQLKSQVS  328
            G+Y S  PP+ LP DP+LS+V  +F  + +  PD PA+ DA T   L+ + L+  VS
Sbjct  23   GVYASTHPPVALPSDPSLSLVPHIFARLPAARPDAPALLDAATAEALSRADLRRLVS  79



>ref|XP_004962247.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like isoform X2 [Setaria 
italica]
Length=505

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  140  KSGYGRD-GIYRSLRPPIVLP-RDPNLSMVSFLFRNI-SQYPDQPAIHDADTGRTLTFSQ  310
            +SGY ++   +RSLRPP+ LP  D  LS   F F  + S  P  PA+ DA TG T++F  
Sbjct  23   RSGYCKETKTFRSLRPPVPLPPTDSPLSFTVFAFSLLPSPLPAHPALLDAATGETVSFPA  82

Query  311  LKSQV  325
             +SQV
Sbjct  83   FRSQV  87



>ref|XP_004962246.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like isoform X1 [Setaria 
italica]
Length=557

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  140  KSGYGRD-GIYRSLRPPIVLP-RDPNLSMVSFLFRNI-SQYPDQPAIHDADTGRTLTFSQ  310
            +SGY ++   +RSLRPP+ LP  D  LS   F F  + S  P  PA+ DA TG T++F  
Sbjct  23   RSGYCKETKTFRSLRPPVPLPPTDSPLSFTVFAFSLLPSPLPAHPALLDAATGETVSFPA  82

Query  311  LKSQV  325
             +SQV
Sbjct  83   FRSQV  87



>gb|ELU00786.1| hypothetical protein CAPTEDRAFT_169390 [Capitella teleta]
Length=566

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 7/64 (11%)
 Frame = +2

Query  143  SGYGRDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            S  G   IY  +RPP+       L +  F F+N  +Y D+PA+ + +TG+  TF++LK  
Sbjct  39   SNAGLKSIYPDVRPPL-------LPVTEFCFQNSEKYLDRPAVINGETGQKYTFAELKEA  91

Query  323  VSRV  334
            VS+V
Sbjct  92   VSKV  95



>gb|ACY66928.1| 4-coumarate:CoA ligase [Eucalyptus camaldulensis]
Length=544

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            R+ I+RS  P I +P   NLS+ ++ F NIS++ D+P + +  TGRT T+++++    RV
Sbjct  10   REFIFRSKLPDIYIP--DNLSLHAYCFENISEFADRPCVINGATGRTYTYAEVELISRRV  67



>ref|WP_012844691.1| AMP-dependent synthetase [Rhodothermus marinus]
 gb|ACY49081.1| AMP-dependent synthetase and ligase [Rhodothermus marinus DSM 
4252]
Length=525

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQ  322
            IYRS  P + +P  P   MV   FR + ++PD+PA+ +  TG TLT++QL+ Q
Sbjct  3    IYRSPFPDVEIPEIPLPEMV---FRRVDEHPDKPALIEGLTGHTLTYAQLREQ  52



>gb|KCW80925.1| hypothetical protein EUGRSUZ_C02284 [Eucalyptus grandis]
Length=424

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 22/60 (37%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            R+ I+RS  P I +P   NLS+ ++ F NIS++ D+P + +  TGRT T+++++    R+
Sbjct  10   REFIFRSKLPDIYIP--DNLSLHAYCFENISEFADRPCVINGATGRTYTYAEVELISRRI  67



>gb|ACI23348.1| 4-coumarate CoA ligase 1 [Leucaena leucocephala]
Length=542

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +2

Query  164  IYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            I+RS  P I +P   +L + S++F N+SQ  D+P + D DTG TLT++ ++    RV
Sbjct  9    IFRSKLPDIYIP--DHLPLHSYVFENLSQVKDRPCLIDGDTGETLTYADVELTARRV  63



>gb|ACX68559.1| 4-coumarate:CoA ligase [Eucalyptus camaldulensis]
Length=544

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            R+ I+RS  P I +P   NLS+ ++ F NIS++ D+P + +  TGRT T+++++    RV
Sbjct  10   REFIFRSKLPDIYIP--DNLSLHAYCFENISEFADRPCVINGATGRTYTYAEVELISRRV  67



>gb|AAZ79469.1| 4-coumarate:coenzyme A ligase [Eucalyptus camaldulensis]
Length=544

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +2

Query  155  RDGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            R+ I+RS  P I +P   NLS+ ++ F NIS++ D+P + +  TGRT T+++++    RV
Sbjct  10   REFIFRSKLPDIYIP--DNLSLHAYCFENISEFADRPCVINGATGRTYTYAEVELISRRV  67



>ref|XP_002512781.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF49284.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=544

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = +2

Query  158  DGIYRSLRPPIVLPRDPNLSMVSFLFRNISQYPDQPAIHDADTGRTLTFSQLKSQVSRV  334
            D ++RS  P I +P+  NLS+ S++F+NIS Y  +P + +  TGR  T+++++    RV
Sbjct  11   DIVFRSKLPDIYIPK--NLSLHSYIFQNISDYSSKPCLINGATGRVYTYAEVEITSRRV  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562698116640