BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004E04

Length=473
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           178   2e-50   Prunus mume [ume]
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           177   9e-50   Solanum lycopersicum
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           177   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             177   1e-49   Prunus persica
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           177   1e-49   Malus domestica [apple tree]
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      176   2e-49   Solanum tuberosum [potatoes]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           175   4e-49   Sesamum indicum [beniseed]
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      174   1e-48   Nicotiana tomentosiformis
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      172   6e-48   Nicotiana sylvestris
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      170   2e-47   Morus notabilis
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           169   5e-47   Fragaria vesca subsp. vesca
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      169   8e-47   Cicer arietinum [garbanzo]
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      166   9e-46   Cucumis sativus [cucumbers]
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           166   1e-45   Eucalyptus grandis [rose gum]
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  166   1e-45   Medicago truncatula
gb|AFK49564.1|  unknown                                                 166   1e-45   Medicago truncatula
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      166   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           164   3e-45   Cucumis melo [Oriental melon]
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           164   5e-45   Vitis vinifera
emb|CAN83418.1|  hypothetical protein VITISV_041351                     163   9e-45   Vitis vinifera
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      162   2e-44   Populus euphratica
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     161   5e-44   Populus trichocarpa [western balsam poplar]
dbj|BAE71216.1|  putative NAD dependent epimerase                       160   9e-44   Trifolium pratense [peavine clover]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      159   3e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      157   2e-42   Solanum tuberosum [potatoes]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                         156   4e-42   Jatropha curcas
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      155   1e-41   Nicotiana sylvestris
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      155   1e-41   Nicotiana tomentosiformis
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             154   4e-41   
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   154   4e-41   Citrus sinensis [apfelsine]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             154   5e-41   Citrus clementina [clementine]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      154   5e-41   Citrus sinensis [apfelsine]
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             153   6e-41   Phaseolus vulgaris [French bean]
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    153   7e-41   Theobroma cacao [chocolate]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       152   8e-41   Phaseolus vulgaris [French bean]
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      152   9e-41   Populus euphratica
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           152   1e-40   Phaseolus vulgaris [French bean]
gb|KJB28115.1|  hypothetical protein B456_005G028000                    150   3e-40   Gossypium raimondii
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       150   6e-40   Gossypium hirsutum [American cotton]
emb|CDP21869.1|  unnamed protein product                                149   1e-39   Coffea canephora [robusta coffee]
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      147   1e-38   Glycine max [soybeans]
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    141   1e-36   Phoenix dactylifera
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      141   2e-36   Elaeis guineensis
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       140   2e-36   Gossypium hirsutum [American cotton]
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      140   4e-36   Elaeis guineensis
gb|KJB72008.1|  hypothetical protein B456_011G153500                    139   1e-35   Gossypium raimondii
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      137   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      136   9e-35   Phoenix dactylifera
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           127   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      126   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       124   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60250.1|  unknown                                                 124   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             124   3e-30   Capsella rubella
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           124   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             123   3e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170          122   1e-29   Amborella trichopoda
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    122   1e-29   Arabis alpina [alpine rockcress]
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    122   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           121   2e-29   Brassica rapa
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             121   3e-29   Eutrema salsugineum [saltwater cress]
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           121   3e-29   Brassica rapa
emb|CDY18087.1|  BnaA01g23480D                                          120   3e-29   Brassica napus [oilseed rape]
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      120   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           120   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      120   4e-29   Camelina sativa [gold-of-pleasure]
emb|CDY64583.1|  BnaCnng44170D                                          120   4e-29   Brassica napus [oilseed rape]
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      118   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX77481.1|  BnaA07g06190D                                          114   6e-27   
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      113   1e-26   Solanum tuberosum [potatoes]
emb|CDX92990.1|  BnaA03g37120D                                          112   4e-26   
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      111   6e-26   Brassica rapa
emb|CDX85133.1|  BnaC07g07730D                                          110   1e-25   
emb|CDY53207.1|  BnaC03g74010D                                          108   7e-25   Brassica napus [oilseed rape]
gb|EEC83914.1|  hypothetical protein OsI_29969                          109   1e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001062295.1|  Os08g0526100                                       108   1e-24   
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           108   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147328.1|  protein capI                                       105   1e-23   Zea mays [maize]
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          105   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      103   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      103   5e-23   Glycine max [soybeans]
dbj|BAJ86203.1|  predicted protein                                      101   4e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001063595.1|  Os09g0504000                                       100   1e-21   
gb|EEC84839.1|  hypothetical protein OsI_31939                          100   1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    98.6    5e-21   Setaria italica
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    97.1    1e-20   Solanum lycopersicum
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                         98.2    2e-20   
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520        96.7    2e-20   Sorghum bicolor [broomcorn]
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...  93.6    1e-19   
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...  93.6    2e-19   Glycine max [soybeans]
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130        94.4    2e-19   Sorghum bicolor [broomcorn]
dbj|BAJ99315.1|  predicted protein                                    94.0    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836           91.7    1e-18   
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    91.3    2e-18   Brachypodium distachyon [annual false brome]
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268            90.9    2e-18   Selaginella moellendorffii
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative            89.4    4e-18   
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    90.1    6e-18   Oryza brachyantha
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    89.0    1e-17   Setaria italica
gb|ABK25339.1|  unknown                                               86.7    5e-17   Picea sitchensis
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    85.9    1e-16   Zea mays [maize]
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         85.1    2e-16   Nicotiana tomentosiformis
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein   84.7    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    84.0    8e-16   Brachypodium distachyon [annual false brome]
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         83.6    9e-16   Nicotiana sylvestris
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                  82.8    2e-15   
gb|KJB41101.1|  hypothetical protein B456_007G090500                  82.4    2e-15   Gossypium raimondii
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg           82.4    2e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         82.0    3e-15   Nicotiana tomentosiformis
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         82.0    3e-15   Nicotiana sylvestris
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg              82.0    3e-15   Erythranthe guttata [common monkey flower]
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    81.6    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg           80.5    9e-15   Prunus persica
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                     80.5    9e-15   Arabidopsis thaliana [mouse-ear cress]
gb|EPS60141.1|  hypothetical protein M569_14661                       80.1    1e-14   Genlisea aurea
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...  80.5    1e-14   Zea mays [maize]
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein    80.5    1e-14   
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         79.7    2e-14   
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         79.7    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg           79.7    2e-14   Citrus clementina [clementine]
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         79.7    2e-14   Cucumis melo [Oriental melon]
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g           79.7    2e-14   Populus trichocarpa [western balsam poplar]
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg              79.7    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         79.7    2e-14   Sesamum indicum [beniseed]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.3    2e-14   Solanum tuberosum [potatoes]
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    79.3    2e-14   
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                  79.3    3e-14   Arabis alpina [alpine rockcress]
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         79.3    3e-14   
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.3    3e-14   Cicer arietinum [garbanzo]
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g           79.0    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  79.3    3e-14   Elaeis guineensis
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         79.0    3e-14   
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         79.0    4e-14   Sesamum indicum [beniseed]
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    79.0    4e-14   Cicer arietinum [garbanzo]
emb|CDO97699.1|  unnamed protein product                              79.0    4e-14   Coffea canephora [robusta coffee]
ref|XP_001769370.1|  predicted protein                                79.0    4e-14   
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    78.6    5e-14   
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    78.6    5e-14   Solanum lycopersicum
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                         78.6    5e-14   Medicago truncatula
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    78.6    5e-14   
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g           78.6    5e-14   Phaseolus vulgaris [French bean]
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg           78.6    5e-14   Capsella rubella
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    78.6    5e-14   Glycine max [soybeans]
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         78.6    5e-14   Nicotiana tomentosiformis
emb|CDX86716.1|  BnaA09g21060D                                        78.2    6e-14   
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    78.2    6e-14   Cucumis sativus [cucumbers]
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         78.2    6e-14   Solanum lycopersicum
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         78.2    6e-14   Eucalyptus grandis [rose gum]
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    78.2    7e-14   Glycine max [soybeans]
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                      78.2    7e-14   Medicago truncatula
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...  78.2    7e-14   Tarenaya hassleriana [spider flower]
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    77.8    8e-14   Populus euphratica
emb|CDX94504.1|  BnaC09g23320D                                        77.8    8e-14   
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                         77.8    8e-14   Medicago truncatula
gb|ACN26174.1|  unknown                                               75.9    8e-14   Zea mays [maize]
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    77.8    9e-14   Camelina sativa [gold-of-pleasure]
gb|ABR16292.1|  unknown                                               77.8    9e-14   Picea sitchensis
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         77.8    1e-13   Elaeis guineensis
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                  77.4    1e-13   Arabidopsis lyrata subsp. lyrata
gb|AAM61323.1|  nucleotide sugar epimerase, putative                  77.4    1e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDP21367.1|  unnamed protein product                              77.4    1e-13   Coffea canephora [robusta coffee]
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         77.4    1e-13   Cucumis melo [Oriental melon]
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                     77.4    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         77.4    1e-13   
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         77.4    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_001761984.1|  predicted protein                                77.4    1e-13   
ref|XP_001767292.1|  predicted protein                                77.4    1e-13   
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         77.4    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         77.0    2e-13   Nicotiana tomentosiformis
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg              77.0    2e-13   Erythranthe guttata [common monkey flower]
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         76.6    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    76.6    2e-13   Citrus sinensis [apfelsine]
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg           76.6    2e-13   Capsella rubella
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g           76.6    3e-13   Phaseolus vulgaris [French bean]
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         76.3    3e-13   Eucalyptus grandis [rose gum]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                       76.3    3e-13   Jatropha curcas
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         76.3    3e-13   Populus euphratica
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein   76.3    3e-13   Populus trichocarpa [western balsam poplar]
ref|NP_001142515.1|  hypothetical protein                             76.3    3e-13   Zea mays [maize]
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg           76.3    3e-13   Eutrema salsugineum [saltwater cress]
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    75.9    4e-13   Populus euphratica
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    75.9    4e-13   Solanum lycopersicum
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    75.9    4e-13   Nicotiana sylvestris
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.9    4e-13   Nicotiana sylvestris
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.9    4e-13   Nicotiana tomentosiformis
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         75.9    4e-13   Malus domestica [apple tree]
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.9    4e-13   Solanum tuberosum [potatoes]
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.9    5e-13   Solanum lycopersicum
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.9    5e-13   Nelumbo nucifera [Indian lotus]
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg           75.5    5e-13   Citrus clementina [clementine]
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                  75.5    5e-13   
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                  75.5    5e-13   
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                  75.5    5e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         75.5    6e-13   Populus euphratica
gb|KJB27036.1|  hypothetical protein B456_004G273500                  75.1    6e-13   Gossypium raimondii
gb|KJB27035.1|  hypothetical protein B456_004G273500                  75.5    6e-13   Gossypium raimondii
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                     75.5    6e-13   Gossypium hirsutum [American cotton]
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         75.5    6e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                    75.1    7e-13   Morus notabilis
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.1    7e-13   
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  75.1    7e-13   
gb|KJB76605.1|  hypothetical protein B456_012G096800                  75.1    7e-13   Gossypium raimondii
gb|KDP38751.1|  hypothetical protein JCGZ_04104                       75.1    8e-13   Jatropha curcas
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.1    8e-13   Zea mays [maize]
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    75.1    8e-13   Solanum tuberosum [potatoes]
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                  75.1    8e-13   
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         75.1    8e-13   Pyrus x bretschneideri [bai li]
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         75.1    8e-13   Prunus mume [ume]
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg           75.1    8e-13   Prunus persica
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                     75.1    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    75.1    9e-13   Glycine max [soybeans]
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.1    9e-13   Phoenix dactylifera
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    75.1    9e-13   Solanum tuberosum [potatoes]
gb|AAK93670.1|  putative nucleotide sugar epimerase                   75.1    9e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    74.7    9e-13   Oryza brachyantha
ref|NP_001048359.1|  Os02g0791500                                     74.7    9e-13   
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                     74.7    9e-13   Gossypium hirsutum [American cotton]
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684           75.1    1e-12   
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    74.7    1e-12   Setaria italica
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174            75.1    1e-12   
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  74.7    1e-12   
gb|KJB24820.1|  hypothetical protein B456_004G162700                  74.7    1e-12   Gossypium raimondii
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630        74.7    1e-12   Sorghum bicolor [broomcorn]
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160        74.7    1e-12   Amborella trichopoda
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    74.7    1e-12   Vitis vinifera
emb|CDY04398.1|  BnaC02g28500D                                        74.7    1e-12   
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         74.7    1e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         74.7    1e-12   Nelumbo nucifera [Indian lotus]
emb|CDX97356.1|  BnaA02g21470D                                        74.3    1e-12   
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    74.3    1e-12   Brassica rapa
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    74.3    1e-12   Cicer arietinum [garbanzo]
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                 74.3    1e-12   Citrus sinensis [apfelsine]
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg           74.3    1e-12   Citrus clementina [clementine]
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         74.3    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                    74.3    2e-12   Morus notabilis
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  73.9    2e-12   Camelina sativa [gold-of-pleasure]
dbj|BAK06545.1|  predicted protein                                    73.9    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    73.9    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920        73.9    2e-12   Sorghum bicolor [broomcorn]
ref|NP_001105911.1|  LOC732831                                        73.9    2e-12   Zea mays [maize]
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    73.9    2e-12   Vitis vinifera
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...  73.9    2e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99954.1|  hypothetical protein OsI_21957                        73.9    2e-12   Oryza sativa Indica Group [Indian rice]
emb|CDP09891.1|  unnamed protein product                              73.9    2e-12   Coffea canephora [robusta coffee]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                  73.9    2e-12   Zea mays [maize]
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         73.6    2e-12   
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    73.6    3e-12   Glycine max [soybeans]
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    73.6    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         73.6    3e-12   Malus domestica [apple tree]
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    73.9    3e-12   Zea mays [maize]
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         73.6    3e-12   Fragaria vesca subsp. vesca
gb|KGN65261.1|  hypothetical protein Csa_1G277970                     73.2    3e-12   Cucumis sativus [cucumbers]
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    73.2    3e-12   Cucumis melo [Oriental melon]
dbj|BAJ85817.1|  predicted protein                                    73.2    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS72617.1|  hypothetical protein M569_02133                       73.2    4e-12   Genlisea aurea
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         73.2    4e-12   Elaeis guineensis
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    73.2    4e-12   Brachypodium distachyon [annual false brome]
ref|XP_001781238.1|  predicted protein                                72.8    4e-12   
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         72.8    5e-12   Phoenix dactylifera
ref|XP_008780407.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    71.2    5e-12   Phoenix dactylifera
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    72.8    5e-12   Camelina sativa [gold-of-pleasure]
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                  72.8    5e-12   Arabis alpina [alpine rockcress]
emb|CDY39205.1|  BnaA03g50170D                                        72.8    5e-12   Brassica napus [oilseed rape]
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    72.8    5e-12   Setaria italica
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         72.8    5e-12   Camelina sativa [gold-of-pleasure]
emb|CDY70926.1|  BnaCnng70410D                                        72.8    5e-12   Brassica napus [oilseed rape]
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg           72.8    5e-12   
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    72.8    5e-12   Nicotiana tomentosiformis
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         72.8    5e-12   Camelina sativa [gold-of-pleasure]
emb|CDX72242.1|  BnaC07g42640D                                        72.8    5e-12   
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg           72.8    5e-12   Capsella rubella
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                     72.8    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                  72.8    6e-12   Arabis alpina [alpine rockcress]
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    72.8    6e-12   Brassica rapa
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    72.8    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         72.4    6e-12   Brassica rapa
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    72.8    6e-12   Nicotiana sylvestris
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         72.4    7e-12   Eucalyptus grandis [rose gum]
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    72.4    7e-12   Populus euphratica
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    72.4    7e-12   Populus euphratica
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    72.0    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    72.0    8e-12   
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030        72.4    8e-12   
gb|KJB09908.1|  hypothetical protein B456_001G174300                  72.0    9e-12   
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    72.0    9e-12   
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         72.0    9e-12   
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110        72.0    1e-11   
ref|XP_010424029.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    69.7    1e-11   
emb|CDY63064.1|  BnaAnng18570D                                        71.6    1e-11   
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         71.6    1e-11   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative            71.2    1e-11   
emb|CAN73016.1|  hypothetical protein VITISV_004388                   71.2    2e-11   
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    71.2    2e-11   
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         71.2    2e-11   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                  70.9    2e-11   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    70.9    2e-11   
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg           70.5    3e-11   
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         70.5    3e-11   
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    70.5    3e-11   
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    70.5    3e-11   
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         69.7    6e-11   
gb|KDP25603.1|  hypothetical protein JCGZ_20759                       69.7    6e-11   
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg           69.7    6e-11   
ref|XP_010413058.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    67.8    6e-11   
emb|CDY67756.1|  BnaA03g56770D                                        69.7    6e-11   
emb|CDX95646.1|  BnaC03g25270D                                        69.7    6e-11   
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g           69.3    7e-11   
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         69.3    7e-11   
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         69.3    7e-11   
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    69.3    8e-11   
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630        68.9    9e-11   
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    68.9    1e-10   
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative            68.6    1e-10   
ref|XP_001759693.1|  predicted protein                                68.6    1e-10   
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         68.2    2e-10   
ref|XP_001754001.1|  predicted protein                                68.2    2e-10   
ref|XP_001751991.1|  predicted protein                                67.8    3e-10   
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         67.4    3e-10   
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    67.4    4e-10   
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    67.4    4e-10   
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    67.4    4e-10   
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         67.4    4e-10   
ref|XP_001761086.1|  predicted protein                                67.0    4e-10   
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    66.6    5e-10   
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         67.0    5e-10   
emb|CAN60968.1|  hypothetical protein VITISV_008097                   66.6    5e-10   
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    66.6    5e-10   
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                     66.6    6e-10   
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                  66.6    7e-10   
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg           66.2    7e-10   
emb|CBI24539.3|  unnamed protein product                              65.5    8e-10   
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                  65.9    1e-09   
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    65.9    1e-09   
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g           65.9    1e-09   
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    65.9    1e-09   
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         65.5    1e-09   
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         64.7    3e-09   
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    64.7    3e-09   
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    63.9    4e-09   
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg              63.9    5e-09   
ref|XP_001777338.1|  predicted protein                                63.2    1e-08   
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                         61.6    3e-08   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    61.6    3e-08   
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg           61.2    4e-08   
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    61.2    4e-08   
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    60.8    4e-08   
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         61.2    4e-08   
gb|KJB43946.1|  hypothetical protein B456_007G225300                  60.8    5e-08   
gb|KJB25649.1|  hypothetical protein B456_004G202200                  60.8    6e-08   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                 60.8    6e-08   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    60.8    6e-08   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg           60.5    6e-08   
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    60.5    7e-08   
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  60.1    1e-07   
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    59.7    1e-07   
ref|NP_001049561.1|  Os03g0249500                                     59.7    1e-07   
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                  58.9    2e-07   
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                    58.9    3e-07   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                      58.9    3e-07   
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    58.2    3e-07   
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    57.8    4e-07   
gb|EPS73152.1|  hypothetical protein M569_01604                       57.8    5e-07   
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    57.4    7e-07   
gb|EPS64795.1|  hypothetical protein M569_09984                       57.0    7e-07   
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    57.4    8e-07   
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    57.0    9e-07   
dbj|BAJ88176.1|  predicted protein                                    56.6    1e-06   
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  56.2    2e-06   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  56.2    2e-06   
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  56.2    2e-06   
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  56.2    2e-06   
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  56.2    2e-06   
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  55.8    2e-06   
ref|XP_002965132.1|  hypothetical protein SELMODRAFT_82699            51.6    5e-06   
gb|KDP22397.1|  hypothetical protein JCGZ_26228                       53.9    1e-05   
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    53.5    1e-05   
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    53.5    1e-05   
emb|CBI18845.3|  unnamed protein product                              52.8    1e-05   
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    53.1    2e-05   
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    52.8    2e-05   
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    52.8    3e-05   
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938            52.0    4e-05   
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    52.0    4e-05   
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g           52.0    4e-05   
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183            52.0    5e-05   
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         51.2    8e-05   
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                       50.4    2e-04   
gb|AFW82019.1|  hypothetical protein ZEAMMB73_069067                  49.7    2e-04   



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 114/135 (84%), Gaps = 6/135 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSE  60

Query  261  SSGGGRRRALHTTGHSLLAATFS----GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
              GGG    +HTT H+ L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGFVG
Sbjct  61   HMGGGAHH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVG  118

Query  429  SHCSLALKKRGDGVL  473
            +HCSLALKKRGDGVL
Sbjct  119  THCSLALKKRGDGVL  133



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 3/132 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIRRVNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  
Sbjct  5    MASPPDTSKTTKLERYNSYIRRVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--  62

Query  261  SSGGGRRRALHTTGHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +S       +HTT H+LL+ A + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHC
Sbjct  63   TSEKSFNNNIHTTTHNLLSSAIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHC  122

Query  438  SLALKKRGDGVL  473
            SLALKKRGDGVL
Sbjct  123  SLALKKRGDGVL  134



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 113/135 (84%), Gaps = 6/135 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  261  SSGGGRRRALHTTGHSLLAATFSGG----AAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
              GGG    +HTT H+ L++ F GG     AWEKQV+ SATPRR NGMSVLVTGAAGFVG
Sbjct  65   HVGGGANH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVG  122

Query  429  SHCSLALKKRGDGVL  473
            SHCSLALKKRGDGVL
Sbjct  123  SHCSLALKKRGDGVL  137



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 114/135 (84%), Gaps = 6/135 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFS----GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
              GGG    +HTT H+ L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGFVG
Sbjct  61   HMGGGAHH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVG  118

Query  429  SHCSLALKKRGDGVL  473
            +HCSLALKKRGDGVL
Sbjct  119  THCSLALKKRGDGVL  133



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 113/135 (84%), Gaps = 6/135 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  261  SSGGGRRRALHTTGHSLLAATFSGG----AAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
              GGG    +HTT H+ L++ F GG     AWEKQV+ SATPRR NGMSVLVTGAAGFVG
Sbjct  65   HVGGGANH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVG  122

Query  429  SHCSLALKKRGDGVL  473
            SHCSLALKKRGDGVL
Sbjct  123  SHCSLALKKRGDGVL  137



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 3/132 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--  58

Query  261  SSGGGRRRALHTTGHSLLAAT-FSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +S       +HTT H+LL++T + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHC
Sbjct  59   TSEKTFNNNIHTTTHNLLSSTIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHC  118

Query  438  SLALKKRGDGVL  473
            SLALKKRGDGVL
Sbjct  119  SLALKKRGDGVL  130



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 108/130 (83%), Gaps = 4/130 (3%)
 Frame = +3

Query  84   AFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  263
            A PPDTSK +KLERYNSYIRRVNS+KL+ ASSKLLFR TL+VALILIFFFT+NYPPL+ +
Sbjct  10   ASPPDTSKTTKLERYNSYIRRVNSTKLLQASSKLLFRVTLLVALILIFFFTLNYPPLSSA  69

Query  264  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                    +H+T H L +A +  GAAWEKQV+ SATPRR NG SVLVTGAAGFVGSHCSL
Sbjct  70   DN----HHIHSTNHFLASAFYGSGAAWEKQVRHSATPRRPNGFSVLVTGAAGFVGSHCSL  125

Query  444  ALKKRGDGVL  473
            ALKKRGDGVL
Sbjct  126  ALKKRGDGVL  135



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 111/132 (84%), Gaps = 2/132 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRITLLVALLLIFFFTINYPPLA-  59

Query  261  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            S        +HTT H+LL++ F  GGA+WEKQV+ SATP R NG SVLVTGAAGFVGSH 
Sbjct  60   SDNTNSHNNIHTTTHNLLSSAFYGGGASWEKQVRRSATPSRPNGFSVLVTGAAGFVGSHS  119

Query  438  SLALKKRGDGVL  473
            SLALKKRGDGVL
Sbjct  120  SLALKKRGDGVL  131



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 2/132 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPLA-  59

Query  261  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            S        +HTT H+L+++ F  GGA+WEKQV+ S+TP R NG SVLVTGAAGFVGSH 
Sbjct  60   SDNPNSHNNIHTTTHNLISSAFYGGGASWEKQVRRSSTPSRPNGFSVLVTGAAGFVGSHS  119

Query  438  SLALKKRGDGVL  473
            SLALKKRGDGVL
Sbjct  120  SLALKKRGDGVL  131



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 109/134 (81%), Gaps = 5/134 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL+LI FFT+NYPPL+ 
Sbjct  1    MASPPDTSKTMKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALVLILFFTLNYPPLSS  60

Query  261  SSGG-GRRRALHTTGHSLLAATF--SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
            SS       + H   H+ L++ F   GGA WEKQV+ SATPRRQNG SVLVTGAAGFVGS
Sbjct  61   SSDTPNTHHSFH--HHNFLSSAFYGGGGATWEKQVRHSATPRRQNGFSVLVTGAAGFVGS  118

Query  432  HCSLALKKRGDGVL  473
            HCSLALKKRGDGVL
Sbjct  119  HCSLALKKRGDGVL  132



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 109/135 (81%), Gaps = 6/135 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KLI ASSKLLFR TL+VAL+LIFFFT+NYPPL+ 
Sbjct  3    MASPPDTSKTIKLERYNSYLRRVNSTKLINASSKLLFRVTLLVALVLIFFFTLNYPPLSS  62

Query  261  SSGGGRRRALHTTGHSLLAATFSGG----AAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
            SS       LH T  + L++ F GG     AWEKQV+ S+TP+R NGMSVLVTGAAGF+G
Sbjct  63   SSDQNGSHRLHNT--NFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFIG  120

Query  429  SHCSLALKKRGDGVL  473
            SHCSLALKKRGDGVL
Sbjct  121  SHCSLALKKRGDGVL  135



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   169 bits (427),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 109/132 (83%), Gaps = 7/132 (5%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++ALIL+F FT NYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALILVFLFTFNYPPLSE  60

Query  261  SSGGGRRRALHTTGHS-LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            ++       LHT  HS  LA+ F GG AWE+QV+ SATPRR NG SVLVTGAAGFVGSHC
Sbjct  61   TAN----HHLHT--HSNFLASAFGGGGAWERQVRHSATPRRPNGFSVLVTGAAGFVGSHC  114

Query  438  SLALKKRGDGVL  473
            SLALKKRGDGV+
Sbjct  115  SLALKKRGDGVV  126



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 110/135 (81%), Gaps = 5/135 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+R+VNS+KLI ASSKLLFRATL+VAL+L+F FT+NYPPL+ 
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLINASSKLLFRATLLVALVLVFIFTLNYPPLS-  62

Query  261  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
            S  G     LHT  + L +A +     GGAAWEKQV+ S+TPRR NGMSVLVTGAAGFVG
Sbjct  63   SENGSSGNHLHTHRNFLSSAFYGGSDQGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFVG  122

Query  429  SHCSLALKKRGDGVL  473
            SHCS+ALKKRGDGVL
Sbjct  123  SHCSMALKKRGDGVL  137



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 110/133 (83%), Gaps = 6/133 (5%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPD+SK +KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL L+ FFT+NYPPL+ 
Sbjct  1    MAPPPDSSKTAKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALALVLFFTLNYPPLSS  60

Query  261  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            SS      A H    S L++TFS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSH
Sbjct  61   SSTSDH--APHR--RSFLSSTFSSAGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSH  116

Query  435  CSLALKKRGDGVL  473
            CSLALKKRGDGVL
Sbjct  117  CSLALKKRGDGVL  129



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 106/131 (81%), Gaps = 5/131 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
            S+        HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCS
Sbjct  61   STN----HHFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCS  115

Query  441  LALKKRGDGVL  473
            LALKKRGDGV+
Sbjct  116  LALKKRGDGVI  126



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 106/131 (81%), Gaps = 5/131 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
            S+        HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCS
Sbjct  61   STN----HHFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCS  115

Query  441  LALKKRGDGVL  473
            LALKKRGDGV+
Sbjct  116  LALKKRGDGVI  126



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 107/131 (82%), Gaps = 2/131 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSY+RRVNS+KL+AASSKLLFR TL+VALILIFFFT+N+PPL  
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKLLAASSKLLFRVTLLVALILIFFFTLNHPPL--  58

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
            SS       LH   + L +A +  GA WEKQV+ S+TPRR NG SVLVTGAAGFVG+HCS
Sbjct  59   SSDSPNHVPLHHHQNFLASAFYGNGATWEKQVRHSSTPRRSNGFSVLVTGAAGFVGTHCS  118

Query  441  LALKKRGDGVL  473
            LALKKRGDGVL
Sbjct  119  LALKKRGDGVL  129



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 112/136 (82%), Gaps = 7/136 (5%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL-A  257
            MA PPDTSK  KLERYNSY+R+VNS+KL+ ASSKLLFRATL+VAL+L+F FT+NYPPL A
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLLNASSKLLFRATLLVALVLVFIFTLNYPPLSA  63

Query  258  ESSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
            E++  G    LHT  + L +A +     GGAAWEKQV+ S+TPRR NGMSVLVTGAAGFV
Sbjct  64   ENASPGNH--LHTHRNFLSSAFYGGSDHGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFV  121

Query  426  GSHCSLALKKRGDGVL  473
            GSHCS+ALKKRGDGVL
Sbjct  122  GSHCSMALKKRGDGVL  137



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 9/133 (7%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGH-SLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            +         H   H + L++ F G GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+H
Sbjct  61   NPH-------HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTH  113

Query  435  CSLALKKRGDGVL  473
            CSLALKKRGDGVL
Sbjct  114  CSLALKKRGDGVL  126



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   163 bits (413),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 9/133 (7%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGH-SLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            +         H   H + L++ F G GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+H
Sbjct  61   NPH-------HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTH  113

Query  435  CSLALKKRGDGVL  473
            CSLALKKRGDGVL
Sbjct  114  CSLALKKRGDGVL  126



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 110/135 (81%), Gaps = 8/135 (6%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
            +         H   H+ L+  F    +GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFVG
Sbjct  61   NIPNHA----HPPHHNFLSTAFFTSSAGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFVG  116

Query  429  SHCSLALKKRGDGVL  473
            SHCSLALKKRGDGVL
Sbjct  117  SHCSLALKKRGDGVL  131



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 109/136 (80%), Gaps = 9/136 (7%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATF-----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
            +         H   H+ L+  F      GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFV
Sbjct  61   NIPNHA----HLHHHNFLSTAFFTSSAGGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFV  116

Query  426  GSHCSLALKKRGDGVL  473
            GSHCSLALKKRGDGVL
Sbjct  117  GSHCSLALKKRGDGVL  132



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
            ++          T    L + F GG AWE+QV+ SATPRR NG +VLVTGAAGFVGSHCS
Sbjct  61   TT-----SHHFHTHSHFLTSAFGGGGAWERQVRHSATPRRPNGFTVLVTGAAGFVGSHCS  115

Query  441  LALKKRGDGVL  473
            LALKKRGDGV+
Sbjct  116  LALKKRGDGVI  126



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 106/132 (80%), Gaps = 5/132 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSY+RRVNS+K +AASSKLLFR TL+VALILIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKFLAASSKLLFRVTLLVALILIFFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +              + +A+ F G GA WEK+V+ S+TPRR NG SVLVTGAAGFVG+HC
Sbjct  61   NP----HHVHLHHHQNFIASAFYGNGATWEKKVRHSSTPRRPNGFSVLVTGAAGFVGTHC  116

Query  438  SLALKKRGDGVL  473
            +LALKKRGDGVL
Sbjct  117  ALALKKRGDGVL  128



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  90   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  269
            P DTSK  KLERYNSYIRR+NS+KLI ASSKLLFR TL+VALILIFFF INYPP   S  
Sbjct  5    PIDTSKEMKLERYNSYIRRLNSTKLIVASSKLLFRVTLLVALILIFFFIINYPPFTSSEN  64

Query  270  GG-RRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                   +HTT H+LL+++F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHCS+
Sbjct  65   SNPHHHNIHTTTHNLLSSSFYGGGAAWEKQVRHSSTPRRVNGLSVLVTGAAGFVGSHCSM  124

Query  444  ALKKRGDGVL  473
            ALKKRGDGVL
Sbjct  125  ALKKRGDGVL  134



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 9/137 (7%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRIHSTKVLNASSKLLFRATLLIALVLILFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGF  422
            +      +  H   H+ L+  F       GG+AWEKQV+ SATPRR NG SVLVTGAAGF
Sbjct  61   NP---HHQNHHIHHHNFLSTAFFARSSSVGGSAWEKQVRHSATPRRPNGFSVLVTGAAGF  117

Query  423  VGSHCSLALKKRGDGVL  473
            VGSHCSLALKKRGDGVL
Sbjct  118  VGSHCSLALKKRGDGVL  134



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 110/132 (83%), Gaps = 3/132 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--  58

Query  261  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            SS       +HTT H+LL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHC
Sbjct  59   SSENTSHHHIHTTTHNLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHC  118

Query  438  SLALKKRGDGVL  473
            S+ALKKRGDGVL
Sbjct  119  SMALKKRGDGVL  130



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 110/132 (83%), Gaps = 3/132 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--  58

Query  261  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +S       +HTT HSLL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHC
Sbjct  59   NSENTPHHHIHTTTHSLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHC  118

Query  438  SLALKKRGDGVL  473
            S+ALKKRGDGVL
Sbjct  119  SMALKKRGDGVL  130



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PP TSK  KLERYNSY+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNSYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
             +        H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS
Sbjct  61   KNPNHAHLHHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCS  120

Query  441  LALKKRGDGVL  473
            +ALKKRGDGVL
Sbjct  121  IALKKRGDGVL  131



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 15/146 (10%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  261  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  395
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  396  VLVTGAAGFVGSHCSLALKKRGDGVL  473
            VLVTGAAGFVGSHCSLALKKRGDGVL
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVL  146



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 15/146 (10%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  261  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  395
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  396  VLVTGAAGFVGSHCSLALKKRGDGVL  473
            VLVTGAAGFVGSHCSLALKKRGDGVL
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVL  146



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 15/146 (10%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  261  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  395
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  396  VLVTGAAGFVGSHCSLALKKRGDGVL  473
            VLVTGAAGFVGSHCSLALKKRGDGVL
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVL  146



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 8/126 (6%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  456  RGDGVL  473
            RGDGVL
Sbjct  114  RGDGVL  119



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M  PPDTSK  KLERYNSY+R+++S+KL+ ASSKLLFR TL++AL+LI FFTINYPPL++
Sbjct  1    MPTPPDTSKTVKLERYNSYLRKLHSTKLLNASSKLLFRVTLLIALVLILFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSL-LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +         H +  S  L +   GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHC
Sbjct  61   NPHHVPPHQHHHSFLSTSLFSISPGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFIGSHC  120

Query  438  SLALKKRGDGVL  473
            SLALKKRGDGVL
Sbjct  121  SLALKKRGDGVL  132



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 8/126 (6%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  456  RGDGVL  473
            RGDGVL
Sbjct  114  RGDGVL  119



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PP TSK  KLERYN+Y+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNNYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
             +        H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS
Sbjct  61   KNPNHAHLHHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCS  120

Query  441  LALKKRGDGVL  473
            +ALKKRGDGVL
Sbjct  121  IALKKRGDGVL  131



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 8/126 (6%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  456  RGDGVL  473
            RGDGVL
Sbjct  114  RGDGVL  119



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = +3

Query  87   FPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  266
             P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++
Sbjct  1    MPTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNT  60

Query  267  GGGRRRALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
                      +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHC
Sbjct  61   HSAPHHHHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHC  120

Query  438  SLALKKRGDGVL  473
            SLALKKRGDGVL
Sbjct  121  SLALKKRGDGVL  132



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +3

Query  90   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  269
            P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++ 
Sbjct  2    PTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNTH  61

Query  270  GGRRRALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                     +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHCS
Sbjct  62   SAPHHHHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHCS  121

Query  441  LALKKRGDGVL  473
            LALKKRGDGVL
Sbjct  122  LALKKRGDGVL  132



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 6/129 (5%)
 Frame = +3

Query  90   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  269
            PPD SK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LI FFT+NYPPL+E+  
Sbjct  6    PPDFSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLILFFTLNYPPLSENP-  64

Query  270  GGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLA  446
                  +H T H+L ++ F G GA WEK+V+ SATPRR NG+SVLVTGAAGFVGSHCSLA
Sbjct  65   ----HHIHHTTHNLFSSAFYGSGAGWEKKVRHSATPRRPNGLSVLVTGAAGFVGSHCSLA  120

Query  447  LKKRGDGVL  473
            LKKRGDGVL
Sbjct  121  LKKRGDGVL  129



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 102/128 (80%), Gaps = 4/128 (3%)
 Frame = +3

Query  90   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  269
            PPDTSK+ KLERYNSYIRR+NS+KL+ ASSKLLFRAT++VALIL+F FT NYPPLA    
Sbjct  20   PPDTSKSIKLERYNSYIRRLNSTKLLNASSKLLFRATILVALILVFLFTFNYPPLAPDFT  79

Query  270  GGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  449
              R    H+   S  ++     A+WEKQV+ S+TPRR NG++VLVTGAAGFVGSHCSLAL
Sbjct  80   SHRHLHSHSHFLSSSSSF----ASWEKQVRHSSTPRRPNGLTVLVTGAAGFVGSHCSLAL  135

Query  450  KKRGDGVL  473
            KKRGDGVL
Sbjct  136  KKRGDGVL  143



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIRRVNS+KL+AAS+ LLFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPPPDTSKTTKLERYNSYIRRVNSTKLLAASTNLLFRATLLTAVVLILLFTLHYPPLLA  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                    A H+    L + +  GGA WE++V+ SATPRR+ G+SVLVTGAAGFVG+HCS
Sbjct  61   GHHPSAASA-HSHRSLLSSYSSYGGATWEREVRRSATPRRRGGLSVLVTGAAGFVGTHCS  119

Query  441  LALKKRGDGVL  473
            LALK RGDGVL
Sbjct  120  LALKXRGDGVL  130



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 100/136 (74%), Gaps = 13/136 (10%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPD SK +KLERYNSY+RRVNS+KL+AASS +LFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPPPDNSKTTKLERYNSYLRRVNSTKLLAASSNILFRATLLTAVVLILLFTLHYPPLLA  60

Query  261  SSGGGRRRALHTTGHS-----LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
                      H   HS       +++  GGAAWE++V+ SATP R  G+ VLVTGAAGFV
Sbjct  61   GH--------HPPAHSHRSLLSPSSSSYGGAAWEREVRRSATPHRPGGLFVLVTGAAGFV  112

Query  426  GSHCSLALKKRGDGVL  473
            G+HCSLALKKRGDGVL
Sbjct  113  GTHCSLALKKRGDGVL  128



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            +               L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSH
Sbjct  61   TPHHVPPHHRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAAGFVGSH  120

Query  435  CSLALKKRGDGVL  473
            CSLALKKRGDGVL
Sbjct  121  CSLALKKRGDGVL  133



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA  PDTSK +KLERYNSY+RRVN++KL+A +S LLFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPLPDTSKTTKLERYNSYLRRVNTTKLLATTSNLLFRATLLTAVVLILLFTLHYPPLLA  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                    A          ++  GGAAWE+ V+ SATPR   G+SVLVTGAAGFVG+HCS
Sbjct  61   GHHLSPTSAHSHRSLLSSPSSSYGGAAWERNVRRSATPRHPGGLSVLVTGAAGFVGTHCS  120

Query  441  LALKKRGDGVL  473
            LALKKRGDGVL
Sbjct  121  LALKKRGDGVL  131



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 103/133 (77%), Gaps = 2/133 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            +               L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGA GFVGSH
Sbjct  61   TPHHVPPHHRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAGGFVGSH  120

Query  435  CSLALKKRGDGVL  473
            CSLALKKRGDGVL
Sbjct  121  CSLALKKRGDGVL  133



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLER N+Y+RRVNS+K+I+ASS+LLFRA+++  + LI  FT++YPPL  
Sbjct  1    MASPPDTSKTAKLERCNNYLRRVNSAKIISASSRLLFRASILATVALILLFTLHYPPLLL  60

Query  261  SSGGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
             S      A  ++  SLL++  + GGAAWE++V+SSATPRR +G++VLVTGAAGFVG+HC
Sbjct  61   LSHYSANAAARSSHRSLLSSDVTYGGAAWEREVRSSATPRRPSGLTVLVTGAAGFVGTHC  120

Query  438  SLALKKRGDGVL  473
            SLALKKRGDGV+
Sbjct  121  SLALKKRGDGVV  132



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 98/141 (70%), Gaps = 23/141 (16%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA   DTSK +KLERYNSY+RRVNS+KL+AAS   LFRATL+ A++LI  FT++YPPL  
Sbjct  1    MALLTDTSKTTKLERYNSYLRRVNSTKLLAASWNFLFRATLLTAIVLILLFTLHYPPL--  58

Query  261  SSGGGRRRALHTTGHSLLAAT----------FSGGAAWEKQVQSSATPRRQNGMSVLVTG  410
                         GH L AA+            GG+AWE+ V+ SATPRR  GM+VLVTG
Sbjct  59   -----------LAGHHLSAASAHSHRSLLSSSYGGSAWERDVRRSATPRRHGGMTVLVTG  107

Query  411  AAGFVGSHCSLALKKRGDGVL  473
            AAGFVG+HCSLALKKRGDGVL
Sbjct  108  AAGFVGTHCSLALKKRGDGVL  128



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA   D SK++KLERYNSY+RRVN++KL+AASSKLLFRATL+VAL+L+FFFT+NYP    
Sbjct  1    MALSSDLSKSTKLERYNSYLRRVNNTKLLAASSKLLFRATLLVALLLVFFFTLNYP--IT  58

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
             +      ++HTT     +  +  GA WEKQV+ S+TPRR NG S+LVTGAAGFVG+HCS
Sbjct  59   GNDAQNNASIHTTSRFFSSGFYGSGATWEKQVRQSSTPRRPNGFSILVTGAAGFVGTHCS  118

Query  441  LALKKRGDGVL  473
            +ALKKRGDGVL
Sbjct  119  IALKKRGDGVL  129



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  257
            MA  PDTSK+ KLER+  Y+ RR+NS+K+IAASS LLFRA+++  ++LI  FT++YPPL 
Sbjct  1    MASAPDTSKSFKLERHGGYLLRRINSTKVIAASSHLLFRASILATVVLILLFTLHYPPLL  60

Query  258  ESSGGGRRRALHTTGH-SLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
                G    +   + H SLL++  + GGAAWE++V+ SATPR  +G++VLVTGAAGFVG+
Sbjct  61   LYHSGAAASSAAHSNHRSLLSSAVTYGGAAWEREVRRSATPRSPSGLTVLVTGAAGFVGT  120

Query  432  HCSLALKKRGDGVL  473
            HCSLALKKRGDGV+
Sbjct  121  HCSLALKKRGDGVV  134



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 105/132 (80%), Gaps = 6/132 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLIFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
                 RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHC
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHC  127

Query  438  SLALKKRGDGVL  473
            SLAL+KRGDGVL
Sbjct  128  SLALRKRGDGVL  139



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 104/132 (79%), Gaps = 6/132 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKXLFRATLLVALVLVLIFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
                 RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHC
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHC  127

Query  438  SLALKKRGDGVL  473
            SLAL+KRGDGVL
Sbjct  128  SLALRKRGDGVL  139



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 105/134 (78%), Gaps = 8/134 (6%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
                 RR+  +TG     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGS
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGS  127

Query  432  HCSLALKKRGDGVL  473
            HCSL L+KRGDGVL
Sbjct  128  HCSLYLRKRGDGVL  141



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 103/130 (79%), Gaps = 5/130 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++SSK+I ASSKLLFRATL+VAL+L+  F +NYPPL+ SS   
Sbjct  8    DTSKTVKLERYNSYLRKIHSSKIINASSKLLFRATLLVALLLVLVFAVNYPPLSFSSSSD  67

Query  276  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                 RR+  +TG    +++  GGAAWEK+V+ S+ PRR NG SVLVTGAAGFVGSHCS+
Sbjct  68   NHRLHRRSFLSTG-IFSSSSLGGGAAWEKRVRLSSAPRRPNGFSVLVTGAAGFVGSHCSI  126

Query  444  ALKKRGDGVL  473
            ALKKRGDGVL
Sbjct  127  ALKKRGDGVL  136



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 105/133 (79%), Gaps = 7/133 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
                 RR+  +TG    S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSH  127

Query  435  CSLALKKRGDGVL  473
            CSLAL+KRGDGVL
Sbjct  128  CSLALRKRGDGVL  140



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 91/121 (75%), Gaps = 8/121 (7%)
 Frame = +3

Query  114  KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTI-NYPPLAESSGGGRRRAL  290
            KLERYNSYIR++NSSK +AASSKLLFRA++++AL L+FF T+ +YP          RR L
Sbjct  9    KLERYNSYIRKMNSSKALAASSKLLFRASILIALFLVFFLTLTSYPTEV-------RRRL  61

Query  291  HTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGV  470
             +T     A+   GG  WEKQV+ S+TPRR NG SVLVTGAAGFVGSH SLALKKRGDGV
Sbjct  62   SSTSSFGAASARWGGPLWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSHSSLALKKRGDGV  121

Query  471  L  473
            L
Sbjct  122  L  122



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 102/130 (78%), Gaps = 4/130 (3%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                 RR+  +TG    +++   GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH SL
Sbjct  68   AHHLHRRSFLSTGIFSSSSSLGEGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHASL  127

Query  444  ALKKRGDGVL  473
            AL+KRGDGVL
Sbjct  128  ALRKRGDGVL  137



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 6/132 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K+I ASSKLLFRATL++AL+L+  FT+NYPPL+ S+  G
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVINASSKLLFRATLLIALVLVLIFTLNYPPLSSSTDAG  67

Query  276  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
                 RR+  +TG   S  AA+  GG AWEK+       +  NG SVLVTGAAGFVGSHC
Sbjct  68   GHRVHRRSFLSTGIFSSSDAASLGGGPAWEKRXXXXXNXQYPNGFSVLVTGAAGFVGSHC  127

Query  438  SLALKKRGDGVL  473
            S+ALKKRGDGVL
Sbjct  128  SIALKKRGDGVL  139



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAA  68

Query  276  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  441  LALKKRGDGVL  473
            +AL+KRGDGVL
Sbjct  129  IALRKRGDGVL  139



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 105/133 (79%), Gaps = 7/133 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALLLVLLFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
                 RR+  +TG    S  +++ S GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSASLGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSH  127

Query  435  CSLALKKRGDGVL  473
            CS+ALKKRGDGVL
Sbjct  128  CSIALKKRGDGVL  140



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLH  67

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
            RR  L T   S  +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+K
Sbjct  68   RRSFLSTGLFSSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRK  127

Query  456  RGDGVL  473
            RGDGVL
Sbjct  128  RGDGVL  133



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSPA  68

Query  276  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  441  LALKKRGDGVL  473
            +AL+KRGDGVL
Sbjct  129  IALRKRGDGVL  139



>ref|XP_010421811.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=372

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 10/141 (7%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  261  SSGGG----RRRALHTTG------HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTG  410
            S         RR+  +TG       S  +++  GGAAWEK+V+ S+T +R  G+SVLVTG
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTG  122

Query  411  AAGFVGSHCSLALKKRGDGVL  473
            AAGFVGSHCSL L+KRGDGVL
Sbjct  123  AAGFVGSHCSLYLRKRGDGVL  143



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  261  SSGGG----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAA  416
            S         RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAA
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAA  122

Query  417  GFVGSHCSLALKKRGDGVL  473
            GFVGSHCSL L+KRGDGVL
Sbjct  123  GFVGSHCSLYLRKRGDGVL  141



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  261  SSGGG----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAA  416
            S         RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAA
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAA  122

Query  417  GFVGSHCSLALKKRGDGVL  473
            GFVGSHCSL L+KRGDGVL
Sbjct  123  GFVGSHCSLYLRKRGDGVL  141



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYN+Y+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNNYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAA  68

Query  276  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  441  LALKKRGDGVL  473
            +AL+KRGDGVL
Sbjct  129  IALRKRGDGVL  139



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  257
            MA PPDTSK+SKLERYNSY+ RRV+S+KLIAASS LLFRAT++ ALILIF F ++YPPL 
Sbjct  2    MASPPDTSKSSKLERYNSYLLRRVSSAKLIAASSHLLFRATILAALILIFLFLLHYPPLL  61

Query  258  ESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
             SS      + H+   SLL++   GG  WE+ V+ SA PRR +G+SVLVTGAAGFVG+HC
Sbjct  62   LSSSHYSSSSPHSNHRSLLSSGSYGGGYWERDVRRSAAPRRPDGLSVLVTGAAGFVGTHC  121

Query  438  SLALKKRGDGVL  473
            SLALK+RGDGV+
Sbjct  122  SLALKRRGDGVV  133



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHL-  66

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
             RR+  +TG    +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+K
Sbjct  67   HRRSFLSTGLFSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRK  126

Query  456  RGDGVL  473
            RGDGVL
Sbjct  127  RGDGVL  132



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 91/130 (70%), Gaps = 10/130 (8%)
 Frame = +3

Query  87   FPPDTSKNSKLERYNSYIRRVNsskl-iaasskllFRATLMVALILIFFFTINYPPLAES  263
            F  DT+K++KL+RYN+YIR+VNSS   IAASSKLL+R T+++  +LI  F INY     +
Sbjct  5    FSVDTNKSTKLDRYNTYIRKVNSSTKFIAASSKLLYRITILIFALLICSFIINYFLFVSN  64

Query  264  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
            +     R L +         F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC+L
Sbjct  65   NSNQHGRRLFS---------FGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHCAL  115

Query  444  ALKKRGDGVL  473
            ALKKRGDGV+
Sbjct  116  ALKKRGDGVI  125



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 102/130 (78%), Gaps = 7/130 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAA  68

Query  276  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                 RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+
Sbjct  69   SHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSI  125

Query  444  ALKKRGDGVL  473
            AL+KRGDGVL
Sbjct  126  ALRKRGDGVL  135



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 102/130 (78%), Gaps = 7/130 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAA  68

Query  276  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                 RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+
Sbjct  69   SHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSI  125

Query  444  ALKKRGDGVL  473
            AL+KRGDGVL
Sbjct  126  ALRKRGDGVL  135



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 102/128 (80%), Gaps = 2/128 (2%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLH  67

Query  276  RRRALHTT--GHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  449
            RR  L T     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL
Sbjct  68   RRSFLSTGLFSSSSASSSLGGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIAL  127

Query  450  KKRGDGVL  473
            +KRGDGVL
Sbjct  128  RKRGDGVL  135



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 11/137 (8%)
 Frame = +3

Query  87   FPP----DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  254
             PP    DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL L+  F  NY PL
Sbjct  1    MPPSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALFLLLLFAFNYHPL  60

Query  255  AESSGGG----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGF  422
            ++S         RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGF
Sbjct  61   SDSRAAASHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGF  117

Query  423  VGSHCSLALKKRGDGVL  473
            VGSHCS+AL+KRGDGVL
Sbjct  118  VGSHCSIALRKRGDGVL  134



>gb|EEC83914.1| hypothetical protein OsI_29969 [Oryza sativa Indica Group]
Length=565

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 85/126 (67%), Gaps = 13/126 (10%)
 Frame = +3

Query  135  YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRA  287
            YI R+    L++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA
Sbjct  113  YIDRIGEKTLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRA  172

Query  288  LHTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
               + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ 
Sbjct  173  ASRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRA  232

Query  456  RGDGVL  473
            RGDGV+
Sbjct  233  RGDGVV  238



>ref|NP_001062295.1| Os08g0526100 [Oryza sativa Japonica Group]
 gb|ABC59070.1| UDP-glucuronic acid 4-epimerase isoform 3 [Oryza sativa Japonica 
Group]
 dbj|BAF24209.1| Os08g0526100 [Oryza sativa Japonica Group]
Length=478

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 87/125 (70%), Gaps = 13/125 (10%)
 Frame = +3

Query  138  IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  290
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  27   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  86

Query  291  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  87   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  146

Query  459  GDGVL  473
            GDGV+
Sbjct  147  GDGVV  151



>dbj|BAC75426.1| putative type 1 capsule synthesis gene(CapI) [Oryza sativa Japonica 
Group]
Length=477

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 87/125 (70%), Gaps = 13/125 (10%)
 Frame = +3

Query  138  IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  290
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  26   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  85

Query  291  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  86   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  145

Query  459  GDGVL  473
            GDGV+
Sbjct  146  GDGVV  150



>ref|NP_001147328.1| protein capI [Zea mays]
 gb|ACG26819.1| protein capI [Zea mays]
 tpg|DAA62203.1| TPA: protein capI [Zea mays]
Length=487

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 92/141 (65%), Gaps = 20/141 (14%)
 Frame = +3

Query  102  SKNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS-  266
            +K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S 
Sbjct  13   AKGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSF  72

Query  267  -----------GGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTG  410
                        G R  A H    SLL ++ S GGAAWEK+V+ SA P R  G+SVLVTG
Sbjct  73   HLSAGGGGGADDGARSSASH---RSLLMSSASYGGAAWEKEVRRSARPSRDGGISVLVTG  129

Query  411  AAGFVGSHCSLALKKRGDGVL  473
            AAGFVG+HCSLAL+ RGDGVL
Sbjct  130  AAGFVGTHCSLALRARGDGVL  150



>gb|EAZ43405.1| hypothetical protein OsJ_28010 [Oryza sativa Japonica Group]
Length=623

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 13/108 (12%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPL---------AESSGGGRRRALHTTGH-SLL---AATFS  329
            FRAT++  L L+  FT++YP L         A ++  G+ RA   + H SLL   AA   
Sbjct  189  FRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAASRSSHRSLLGSSAAVAY  248

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ RGDGV+
Sbjct  249  GGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRARGDGVV  296



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 105/134 (78%), Gaps = 4/134 (3%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRR-VNsskliaasskllFRATLMVALILIFFFTINYPPL-  254
            MA PPDTSK SKLERYNSY+RR V+S+KLIAASS +LFRATL+ AL+LIF F ++ PPL 
Sbjct  1    MASPPDTSKASKLERYNSYLRRRVSSAKLIAASSYILFRATLLAALLLIFLFLLHSPPLL  60

Query  255  -AESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
             + S       + H +  S  +A + GGAAWE+ V+ SATPRR +G+SVLVTGAAGFVG+
Sbjct  61   FSGSHYYSSSHSNHRSLLSSSSAAY-GGAAWEQDVRRSATPRRADGLSVLVTGAAGFVGT  119

Query  432  HCSLALKKRGDGVL  473
            HCSLALK+RGDGV+
Sbjct  120  HCSLALKRRGDGVV  133



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 79/131 (60%), Gaps = 30/131 (23%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA  PDTSK  KL RYNSY+RR+NS           F+      ++L+  +T+       
Sbjct  73   MASSPDTSKTIKLMRYNSYLRRLNS-----------FKLLKTSFILLLLLYTL-------  114

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                       +T H LL++ F G  AWE QV+ SA PRR +GMSVLVTGAAGFVGSHCS
Sbjct  115  -----------STHHLLLSSAFHG-PAWENQVRHSALPRRPHGMSVLVTGAAGFVGSHCS  162

Query  441  LALKKRGDGVL  473
            L+LKKRGDGVL
Sbjct  163  LSLKKRGDGVL  173



>dbj|BAJ86203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 87/134 (65%), Gaps = 10/134 (7%)
 Frame = +3

Query  102  SKNSKLERYNS-----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  266
            +K  KLERY S      +RR  SSK++AASS LLFRAT++  L L+  F ++YP L   S
Sbjct  18   AKGVKLERYASGGGALLMRRAGSSKIVAASSHLLFRATVLATLALVCLFAVHYPTLLSRS  77

Query  267  ---GGGRRRALHTTGHSLLAATFSG--GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
                        T+ H  L  + S   GAAWE++V+ SATPRR  GMSVLVTGAAGFVG+
Sbjct  78   FRLSAASSPPRPTSRHRNLLGSSSAYAGAAWEREVRRSATPRRDGGMSVLVTGAAGFVGA  137

Query  432  HCSLALKKRGDGVL  473
            HC+LAL+ RGDGVL
Sbjct  138  HCALALRARGDGVL  151



>ref|NP_001063595.1| Os09g0504000 [Oryza sativa Japonica Group]
 dbj|BAF25509.1| Os09g0504000 [Oryza sativa Japonica Group]
 gb|EEE70003.1| hypothetical protein OsJ_29922 [Oryza sativa Japonica Group]
Length=498

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 93/153 (61%), Gaps = 24/153 (16%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  245
             P D + K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASGAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHY  60

Query  246  PPLAESS--------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATP  374
            P L   S         G    A H +  SLL         AA+  GGAAWEK+V+ SA P
Sbjct  61   PSLLSRSFTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKP  120

Query  375  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            R+  G++VLVTGAAGFVG+HCSLAL+ RGDGVL
Sbjct  121  RKDGGIAVLVTGAAGFVGTHCSLALRARGDGVL  153



>gb|EEC84839.1| hypothetical protein OsI_31939 [Oryza sativa Indica Group]
Length=498

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 93/153 (61%), Gaps = 24/153 (16%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  245
             P D + K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASSAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHY  60

Query  246  PPLAESS--------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATP  374
            P L   S         G    A H +  SLL         AA+  GGAAWEK+V+ SA P
Sbjct  61   PSLLSRSFTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKP  120

Query  375  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            R+  G++VLVTGAAGFVG+HCSLAL+ RGDGVL
Sbjct  121  RKDGGIAVLVTGAAGFVGTHCSLALRARGDGVL  153



>ref|XP_004957272.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=488

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 88/146 (60%), Gaps = 29/146 (20%)
 Frame = +3

Query  102  SKNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  269
            +K  KLERY S     +RR  S+K+++ASS LLFRAT++  L L+F FT++YP L     
Sbjct  13   AKGMKLERYASGGALMLRRATSAKIVSASSHLLFRATVLATLALVFLFTLHYPSLL----  68

Query  270  GGRRRALHTTG--------HSLLAATFS----------GGAAWEKQVQSSATPRRQNGMS  395
                R+ H +         HS    +            GGAAWEK+++ SA P R  G+S
Sbjct  69   ---FRSFHLSAGGGGPGGAHSASHRSLLMSSSSTSASYGGAAWEKEMRQSARPSRDGGIS  125

Query  396  VLVTGAAGFVGSHCSLALKKRGDGVL  473
            VLVTGAAGFVG+HCSLALK RGDGV+
Sbjct  126  VLVTGAAGFVGTHCSLALKARGDGVV  151



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 82/132 (62%), Gaps = 15/132 (11%)
 Frame = +3

Query  87   FPPDTSKNSKLERYNSYIRRVNsskliaasskllFRAT-LMVALILIFFFTINYPPL--A  257
            F  DT K+ KL+R N+YI +VNSS  +  +   LF    ++++ +LI  F +N+      
Sbjct  5    FSIDTKKSIKLDR-NTYIHKVNSSTKLIVAFIKLFYCIAILISALLIGLFILNHILFIST  63

Query  258  ESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +S+  GRR             +F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC
Sbjct  64   DSNQHGRR-----------LFSFGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHC  112

Query  438  SLALKKRGDGVL  473
             LALKKRGDGV+
Sbjct  113  GLALKKRGDGVI  124



>gb|EMT02349.1| UDP-glucuronate 4-epimerase 6 [Aegilops tauschii]
Length=705

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 89/151 (59%), Gaps = 25/151 (17%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPP  251
             P D + K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP 
Sbjct  1    MPSDAAAKGVKLERYASGGALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPS  60

Query  252  LAESS-------------GGGRRRALHTTGHSLLAATFS----GGAAWEKQVQSSATPRR  380
            L   S             G  R  A H    SLLA+T +    G   W+K+++ SA P R
Sbjct  61   LLSRSFSLASDGSSSSVPGASRSHASH---RSLLASTSAAATYGSERWQKEIRRSAKPGR  117

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              G+SVLVTGA GFVG+HCSLALK RGDGV+
Sbjct  118  DGGLSVLVTGAGGFVGAHCSLALKARGDGVV  148



>ref|XP_002444715.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
 gb|EES14210.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
Length=479

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 86/137 (63%), Gaps = 13/137 (9%)
 Frame = +3

Query  102  SKNSKLERYNSYIRRV-NsskliaasskllFRATLMVALILIFFFTINYPPL--------  254
            +K  KLER+   +RR   +  L++ASS LLFRAT++  L L+  F ++YP L        
Sbjct  10   AKGVKLERHAVLLRRAAGAKHLVSASSHLLFRATVLATLALVVLFAVHYPSLLSHSFTLS  69

Query  255  ---AESSGGGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGF  422
               A  S   R R  H +     A++  G GAAWE++V+ SATPRR   +SVLVTGAAGF
Sbjct  70   AAPASPSSTPRSRHSHRSLLGSGASSSYGRGAAWEREVRRSATPRRDGALSVLVTGAAGF  129

Query  423  VGSHCSLALKKRGDGVL  473
            VG+HCSLAL+ RGDGV+
Sbjct  130  VGAHCSLALRARGDGVV  146



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 69/131 (53%), Gaps = 33/131 (25%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA  PDTSK  KL R NSY+RR+N                            I++  L  
Sbjct  1    MASSPDTSKTIKLVRNNSYLRRLN----------------------------ISFKILFL  32

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                     L T  H L  ++     AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCS
Sbjct  33   LLALLLLYTLSTHHHHLPLSS-----AWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCS  87

Query  441  LALKKRGDGVL  473
            LALKKRGDGVL
Sbjct  88   LALKKRGDGVL  98



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 69/131 (53%), Gaps = 33/131 (25%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA  PDTSK  KL R NSY+RR+N                            I++  L  
Sbjct  1    MASSPDTSKTIKLVRNNSYLRRLN----------------------------ISFKILFL  32

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                     L T  H L  ++     AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCS
Sbjct  33   LLALLLLYTLSTHHHHLPLSS-----AWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCS  87

Query  441  LALKKRGDGVL  473
            LALKKRGDGVL
Sbjct  88   LALKKRGDGVL  98



>ref|XP_002462620.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
 gb|EER99141.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
Length=494

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 89/142 (63%), Gaps = 19/142 (13%)
 Frame = +3

Query  105  KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS--  266
            K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S  
Sbjct  14   KGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSFH  73

Query  267  ------GGGRRRALHTTG---HSLL----AATFSGGAAWEKQVQSSATPRRQNGMSVLVT  407
                          H+T     SLL    A+   GGAAWEK+V+ SA P R  G+SVLVT
Sbjct  74   LSAGAGDDSAGGGAHSTSASHRSLLMSSSASASYGGAAWEKEVRRSARPSRDGGISVLVT  133

Query  408  GAAGFVGSHCSLALKKRGDGVL  473
            GAAGFVG+HCSLALK RGDGVL
Sbjct  134  GAAGFVGTHCSLALKARGDGVL  155



>dbj|BAJ99315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 86/140 (61%), Gaps = 11/140 (8%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPP  251
             P D + K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP 
Sbjct  1    MPSDAAAKGVKLERYASGSALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPS  60

Query  252  LAESSGGGRR------RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGA  413
            L   S           R+  +   S  AA   GG  W+K+++ SA PRR  G+SVLVTGA
Sbjct  61   LLSRSFSLASSSSVPPRSHRSLLASSSAAATYGGERWQKEIRRSAKPRRDGGLSVLVTGA  120

Query  414  AGFVGSHCSLALKKRGDGVL  473
             GFVG+HCSLALK RGDGV+
Sbjct  121  GGFVGAHCSLALKARGDGVV  140



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 77/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++   
Sbjct  6    PSTPGKVKMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLE  64

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
             R       G+  LA    GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALK
Sbjct  65   SRH-----FGNRALAW---GGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALK  116

Query  453  KRGDGVL  473
            KRGDGV+
Sbjct  117  KRGDGVV  123



>ref|XP_003578376.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=485

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 27/154 (18%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYP-  248
             P D + K  KLERY S     +RRV S KL++ASS LLFRAT++  + L+F FT++YP 
Sbjct  1    MPADAAAKGVKLERYASGGALLLRRVASGKLVSASSHLLFRATVLATIALVFLFTLHYPS  60

Query  249  ------------------PLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  374
                              PL  +S   R   + ++  +  AA+  G   W+K+++ SA P
Sbjct  61   LLSRSFSLSSSSSSSSPTPLQHASH--RSLLMSSSTPAASAASVYGSEKWQKEIKKSAKP  118

Query  375  RRQNG-MSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            R+ +G MSVLVTGAAGFVG+HC+LAL+ RGDGVL
Sbjct  119  RKADGGMSVLVTGAAGFVGTHCALALRARGDGVL  152



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++   
Sbjct  11   PSTPGKVKMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLE  69

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
             R        H    A   GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALK
Sbjct  70   SR--------HFGNRALTWGGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALK  121

Query  453  KRGDGVL  473
            KRGDGV+
Sbjct  122  KRGDGVV  128



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GGA+WEKQV+ S+TPRR +G+SVLVTGAAGFVGSHCSLALKKRGDGVL
Sbjct  31   GGASWEKQVRHSSTPRRPSGLSVLVTGAAGFVGSHCSLALKKRGDGVL  78



>ref|XP_006660806.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Oryza brachyantha]
Length=492

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 90/149 (60%), Gaps = 20/149 (13%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  245
             P D + K  KLERY S       +RR +  K+++ASS LLFRAT++  L L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASGGAMLLLLRRASGGKIVSASSHLLFRATVLATLGLVFLFTFHY  60

Query  246  PPLAESSGGGRRRAL-----HTTGHSLL--------AATFSGGAAWEKQVQSSATPRRQN  386
            P L   S             H +  SLL        A+   GGAAWEK+V+ SA PR+  
Sbjct  61   PSLLSRSFSLSGGGGDGGPAHASHRSLLMSSSSSYSASAAYGGAAWEKEVRKSAKPRKDG  120

Query  387  GMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            G++VLVTGAAGFVG+HCSLAL+ RGDGVL
Sbjct  121  GIAVLVTGAAGFVGTHCSLALRARGDGVL  149



>ref|XP_004973970.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=485

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 68/110 (62%), Gaps = 15/110 (14%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESS--------------GGGRRRALHTTGHSLLAATF  326
            FRAT++  L L+  F ++YP L   S              G        ++  SLL +  
Sbjct  44   FRATVLATLALVVLFAVHYPSLLSRSFTLSSASPSSSSSSGSSSSPRSRSSHRSLLGSGA  103

Query  327  S-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            S GGAAWE++V+ SATPRR  G+SVLVTGAAGFVG+HCSLAL+ RGDGV+
Sbjct  104  SYGGAAWEREVRRSATPRRDGGLSVLVTGAAGFVGAHCSLALRGRGDGVV  153



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 76/130 (58%), Gaps = 16/130 (12%)
 Frame = +3

Query  90   PP--DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  263
            PP  D +   K+ER   Y  R  +S+  + S++L F A  ++AL+ IFF  +  P     
Sbjct  2    PPSMDGALKGKMERNGGYFGRPANSRCCSPSARLFFWAATLIALLFIFFMGMTSP-----  56

Query  264  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                RRR        +L +   GG  WEKQV+ S   +R+NG+ VLVTGAAGFVGSH SL
Sbjct  57   -SEPRRR--------VLGSYSWGGPDWEKQVRHSCKLKRENGIVVLVTGAAGFVGSHVSL  107

Query  444  ALKKRGDGVL  473
            ALKKRGDGVL
Sbjct  108  ALKKRGDGVL  117



>ref|XP_008664162.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Zea mays]
 tpg|DAA48160.1| TPA: hypothetical protein ZEAMMB73_095571 [Zea mays]
Length=450

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 59/96 (61%), Gaps = 13/96 (14%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAA-WEKQVQSS  365
            FRAT++  + L+  F  +YP L   S            + L AA +  GAA WE++V+ S
Sbjct  35   FRATVLATIALVVLFAAHYPSLLSRS------------YILSAAAYGRGAASWEREVRRS  82

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            A PRR   +SVLVTGAAGFVG HCSLAL  RGDGV+
Sbjct  83   AAPRRDGALSVLVTGAAGFVGLHCSLALSARGDGVV  118



>ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana tomentosiformis]
Length=445

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 7/91 (8%)
 Frame = +3

Query  201  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  380
            L +  I++FFF   + P   S+ G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTNSAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            + G +VLVTGAAGFVGSH SLALK+RGDGVL
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRRGDGVL  133



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 63/91 (69%), Gaps = 11/91 (12%)
 Frame = +3

Query  201  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  380
            L +A+I +FF+    PP + +S   RR         L +AT+ GGAAWEK+V++SA  R 
Sbjct  40   LFIAVIFVFFY--RSPPSSSNSDLSRRY--------LTSATW-GGAAWEKRVRTSARIRS  88

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +NG SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  89   RNGFSVLVTGAAGFVGTHVSSALKRRGDGVL  119



>ref|XP_003572425.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=477

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 66/106 (62%), Gaps = 13/106 (12%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGH-SLL----------AATFSGG  335
            FRAT++  + L+  F  +YP L   S   R  +  ++ H SLL          +A   G 
Sbjct  44   FRATVLATIALVCLFAAHYPSLLSHSF--RLSSPTSSPHRSLLGSSSSSSSSSSAPAFGT  101

Query  336  AAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            AAW++ V+ SATPRR NGMSVLVTGAAGFVG HC++AL  RGDGV+
Sbjct  102  AAWDRAVRRSATPRRANGMSVLVTGAAGFVGFHCAMALAARGDGVV  147



>ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana sylvestris]
Length=445

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = +3

Query  201  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  380
            L +  I++FFF   + P    + G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTSPAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            + G +VLVTGAAGFVGSH SLALK+RGDGVL
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRRGDGVL  133



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 12/96 (13%)
 Frame = +3

Query  189  FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  365
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            A  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  90   ARVRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVL  125



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 62/96 (65%), Gaps = 12/96 (13%)
 Frame = +3

Query  189  FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  365
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            A  R  NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  90   ARVRSHNGISVLVTGAAGFVGTHVSAALKRRGDGVL  125



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF+    P     S    RR+L T  ++       GG AWEK+V+SSA
Sbjct  39   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYAYTW------GGPAWEKRVRSSA  90

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  91   RVRTRHGISVLVTGAAGFVGTHVSAALKRRGDGVL  125



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKRG
Sbjct  51   QSFMDTGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRG  109

Query  462  DGVL  473
            DGV+
Sbjct  110  DGVV  113



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKRG
Sbjct  51   QSFMDTGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRG  109

Query  462  DGVL  473
            DGV+
Sbjct  110  DGVV  113



>gb|EYU30447.1| hypothetical protein MIMGU_mgv1a006641mg [Erythranthe guttata]
Length=437

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 8/79 (10%)
 Frame = +3

Query  237  INYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAA  416
            I  PP A  S GG+RR+L TTGHS L A       WE + ++SA P  ++G++VLVTGAA
Sbjct  55   ICSPPAA--SPGGKRRSLQTTGHSRLPAN------WEAKARNSARPVSKSGLTVLVTGAA  106

Query  417  GFVGSHCSLALKKRGDGVL  473
            GFVGSH +LALK RGDGV+
Sbjct  107  GFVGSHAALALKNRGDGVV  125



>ref|XP_009397005.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 58/91 (64%), Gaps = 9/91 (10%)
 Frame = +3

Query  201  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  380
            L +AL++ FFF     P + S+ G R         SL  A   GG AWEK V+SSA  RR
Sbjct  49   LAIALLVAFFFLSPTTPNSSSTSGRR---------SLRNAAPWGGPAWEKCVRSSARVRR  99

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              G+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  100  SGGISVLVTGAAGFVGTHVSTALKRRGDGVL  130



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 59/95 (62%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  39   FWSFIFLGLILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKRVRSSA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R ++GMSVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  89   RVRSRHGMSVLVTGAAGFVGTHVSAALKRRGDGVL  123



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 59/95 (62%), Gaps = 11/95 (12%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF+     P++ +     RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFFYR---SPVSSNPADPSRRSLRTYSW--------GGPAWEKRVRSSA  83

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R + G SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  84   RLRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVL  118



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            +A   +G    + T+ GG  WE+QV++SA  RRQNG SVLVTGAAGFVGSH SLALKKRG
Sbjct  55   KACVDSGSRYFSTTW-GGGHWERQVRASAQIRRQNGFSVLVTGAAGFVGSHVSLALKKRG  113

Query  462  DGVL  473
            DGV+
Sbjct  114  DGVV  117



>ref|NP_001150944.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
 gb|ACG41039.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
Length=476

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 14/107 (13%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESS------------GGGRRRALHTTGHSLLAATFSG  332
            FRAT++  L L+  F ++YP +   S                R +  +   S  A+ +S 
Sbjct  40   FRATVLATLALVVLFAVHYPSMLSRSFSLSAAPASGASSSRSRHSHRSLLGSRPASRWS-  98

Query  333  GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
             AAWE++V+ SA PRR   +SVLVTGAAGFVG+HCSLAL+ RGDGV+
Sbjct  99   -AAWEREVRRSAAPRRDGALSVLVTGAAGFVGAHCSLALRARGDGVV  144



>gb|AFW61553.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
Length=476

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 14/107 (13%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESS------------GGGRRRALHTTGHSLLAATFSG  332
            FRAT++  L L+  F ++YP +   S                R +  +   S  A+ +S 
Sbjct  40   FRATVLATLALVVLFAVHYPSMLSRSFSLSAAPASGASSSRSRHSHRSLLGSRPASRWS-  98

Query  333  GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
             AAWE++V+ SA PRR   +SVLVTGAAGFVG+HCSLAL+ RGDGV+
Sbjct  99   -AAWEREVRRSAAPRRDGALSVLVTGAAGFVGAHCSLALRARGDGVV  144



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 60/95 (63%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGXAWEKRVRSSA  91

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVL  126



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 60/95 (63%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGPAWEKRVRSSA  91

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVL  126



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 15/98 (15%)
 Frame = +3

Query  189  FRATLMVALILIFFF---TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQ  359
            F + + +A+ILIFFF   + N  P A+ S    RR+L T           GG A+EK+V+
Sbjct  42   FWSFIFLAVILIFFFRSPSSNPLPSADPS----RRSLRTYDW--------GGPAFEKRVR  89

Query  360  SSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  90   SSARVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVL  127



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV+ SA P R NG SVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  71   GGIQWEKQVRVSAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGDGVV  118



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            TG   L A++ GG  WEKQ++ SA   R NGMSVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  61   TGSRYLTASW-GGIQWEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVV  118



>gb|EYU37123.1| hypothetical protein MIMGU_mgv1a006776mg [Erythranthe guttata]
Length=432

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV+SSA  RRQ G SVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  72   GGIQWEKQVRSSAQIRRQGGFSVLVTGAAGFVGSHVSLALKKRGDGVV  119



>ref|XP_011079342.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV+SSA   RQNG SVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  72   GGIQWEKQVRSSAQIHRQNGFSVLVTGAAGFVGTHVSLALKKRGDGVV  119



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 9/95 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
             PR  NGM VLVTGAAGFVG+H S ALK+RG+GVL
Sbjct  89   KPRSSNGMCVLVTGAAGFVGTHVSAALKRRGNGVL  123



>ref|XP_004162690.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
Length=431

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV+ SA P R NG SVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  71   GGIQWEKQVRISAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGDGVV  118



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 59/95 (62%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF+    P     S    RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYSW--------GGPAWEKRVRSSA  85

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  86   RVRTRHGVSVLVTGAAGFVGTHVSAALKRRGDGVL  120



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQ+++SATPRR  G+SVLVTGAAGFVG+H SLAL+KRGDGV+
Sbjct  71   GGMHWEKQIRASATPRRPGGVSVLVTGAAGFVGTHVSLALRKRGDGVV  118



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 69/127 (54%), Gaps = 13/127 (10%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+E+  SY  RV      A      F   +  A ILIFFF    P  +     
Sbjct  15   PSTPGKFKMEK-ASYFNRVRWHASPAKLILWSF---VFSAAILIFFF--RSPATSPLPAD  68

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L +  +        GG  WEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK
Sbjct  69   PSRRSLRSPSNW-------GGPIWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALK  121

Query  453  KRGDGVL  473
            +RGDGVL
Sbjct  122  RRGDGVL  128



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 57/93 (61%), Gaps = 7/93 (8%)
 Frame = +3

Query  195  ATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  374
            ++L VALI +FF+                R         LA+   GGAAWEK+V++SA  
Sbjct  38   SSLFVALIFLFFYRSPSSSSNNPPSSDPSR-------RYLASANWGGAAWEKRVRTSARI  90

Query  375  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            R +NG SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  91   RSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVL  123



>ref|XP_010909513.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 3-like 
[Elaeis guineensis]
Length=469

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 61/110 (55%), Gaps = 23/110 (21%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAES--------------SGGGRRRALHTTGHSLLAATF  326
            F A L +A+    F     PP AE+              +GG  RR+L T          
Sbjct  47   FWAFLAIAVFAALFLLSPXPPSAEADPPPSSSLGGAASGNGGQHRRSLRTASW-------  99

Query  327  SGGAAWEKQVQSSATPRRQ-NGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
             GG AWEK+V+SSA  RRQ  G SVLVTGAAGFVG+H S ALKKRGDGVL
Sbjct  100  -GGPAWEKRVRSSARIRRQLGGFSVLVTGAAGFVGTHVSAALKKRGDGVL  148



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 59/95 (62%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFF--RSPSSNSLPSDPXRRSLRTYNW--------GGPAWEKRVRSSA  91

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVL  126



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  318  ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +T  GG  WEKQV+ SA   RQNG SVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  68   STAWGGIHWEKQVRDSAQIHRQNGFSVLVTGAAGFVGSHVSLALKKRGDGVV  119



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 12/95 (13%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + L V +I   FF     P + SS   RR +L T  +        GG+AWEK+V+SSA
Sbjct  33   FWSILFVGIIFFLFFRT---PSSFSSDTSRR-SLRTYNY--------GGSAWEKKVRSSA  80

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
                +NG++VLVTGAAGFVG+H S+ALK+RGDGVL
Sbjct  81   RVTSKNGVTVLVTGAAGFVGTHTSIALKQRGDGVL  115



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 61/96 (64%), Gaps = 9/96 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAES-SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  365
            F + + + LI +FFF        ES +    RR+L T+ +        GG  WEK++++S
Sbjct  38   FWSFVFLGLIFVFFFRSPSSSSPESLTADPSRRSLRTSSY--------GGPDWEKRIKAS  89

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            A  R +NGMSVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  90   AKVRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVL  125



>ref|XP_001769370.1| predicted protein [Physcomitrella patens]
 gb|EDQ65739.1| predicted protein [Physcomitrella patens]
Length=450

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 75/127 (59%), Gaps = 3/127 (2%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+ER +SY  RV S     AS++LL  +  ++A+ +   F I      +   G
Sbjct  11   PSTPGKVKVER-SSYFGRVASRWHSTASARLLVFSAFLLAVTIFICFRIAANGFVDVYIG  69

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
            G   A  +T    + + +     W+K+V+ S TP+R+NG+ VLVTGAAGFVGSH SLALK
Sbjct  70   GT--AYSSTNGGTIRSAYRSDHLWDKKVRQSCTPKRENGLVVLVTGAAGFVGSHVSLALK  127

Query  453  KRGDGVL  473
            KRGDG++
Sbjct  128  KRGDGLV  134



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 60/95 (63%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +++  ILIFFF         S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSLVILGSILIFFFRSPSSSPLPSDHS--RRSLSTYDW--------GGPAWEKRVRSSA  91

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVL
Sbjct  92   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVL  126



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 59/95 (62%), Gaps = 9/95 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++S 
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKAST  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
             PR  NG+ VLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  89   KPRSSNGLCVLVTGAAGFVGTHVSAALKRRGDGVL  123



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 60/95 (63%), Gaps = 12/95 (13%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + L   +I   FF     P + SS   RR +L T  +        GGAAWEK+V+SSA
Sbjct  27   FWSILFFGVIYFLFFRT---PSSFSSDTSRR-SLRTYNY--------GGAAWEKKVRSSA  74

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
                +NG+SVLVTGAAGFVGSH S+ALK+RGDGV+
Sbjct  75   KVTSKNGVSVLVTGAAGFVGSHVSIALKRRGDGVV  109



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +++  ILIFFF       +       RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPS--SSPLPSDHSRRSLSTYDW--------GGPAWEKRVRSSA  85

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVL
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVL  120



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVV  118



>ref|XP_006286788.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
 gb|EOA19686.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
Length=438

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 6/76 (8%)
 Frame = +3

Query  246  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
            PP + S     RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRTHGGLTVLVTGASGFV  108

Query  426  GSHCSLALKKRGDGVL  473
            G+H S+AL++RGDGVL
Sbjct  109  GTHVSIALRRRGDGVL  124



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVV  118



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 9/95 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVL
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVL  123



>emb|CDX86716.1| BnaA09g21060D [Brassica napus]
Length=434

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 2/65 (3%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR+L+ +  SL +A   GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSSAAKYGGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  118

Query  459  GDGVL  473
            GDGVL
Sbjct  119  GDGVL  123



>ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
 gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus]
Length=431

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV+ SA P R NG SV+VTGAAGFVGSH SLALKKRGDGV+
Sbjct  71   GGIQWEKQVRISAQPHRTNGFSVVVTGAAGFVGSHVSLALKKRGDGVV  118



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 9/95 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVL
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVL  123



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GGAAWEK+V+SSA  R +NGMSVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  77   GGAAWEKRVRSSARIRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVL  124



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G   L A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+
Sbjct  61   SGSRYLTASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVV  118



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 68/127 (54%), Gaps = 13/127 (10%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+E+  SY  RV      A      F   +  A ILIFFF    P  +     
Sbjct  15   PSTPGKFKMEK-ASYFNRVRWHASPAKLCLWSF---VFSAAILIFFF--RSPASSPLPAD  68

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L +  +        GG  WEK+V+SSA  R +NG SVLVTGAAGFVG+H S ALK
Sbjct  69   PSRRSLRSPSNW-------GGPVWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSAALK  121

Query  453  KRGDGVL  473
            +RGDGVL
Sbjct  122  RRGDGVL  128



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 57/95 (60%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +   LI IFF+    P     S    RR+L T           GG  WEK+V+SSA
Sbjct  39   FWSLVFTGLIFIFFY--RSPSSNPISSAPSRRSLRTYSW--------GGPDWEKRVRSSA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  89   RVRTRNGISVLVTGAAGFVGTHVSAALKRRGDGVL  123



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            TG     A++ GG  WEKQ++ SA   R NGMSVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  61   TGSRYFTASW-GGILWEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVV  118



>emb|CDX94504.1| BnaC09g23320D [Brassica napus]
Length=435

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 3/65 (5%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR+L+ +  SL AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSAAKY-GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  459  GDGVL  473
            GDGVL
Sbjct  118  GDGVL  122



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGF+GSH SLALK+RGDGV+
Sbjct  65   SGSRYLSASW-GGIQWEKQVRASAQIHRQGGMSVLVTGAAGFIGSHVSLALKRRGDGVV  122



>gb|ACN26174.1| unknown [Zea mays]
Length=249

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 7/60 (12%)
 Frame = +3

Query  312  LAATFSGGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            LAA++ GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL+KRGDGV+
Sbjct  19   LAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRGDGVV  77



>ref|XP_010433651.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Camelina sativa]
Length=436

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  62   RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRSPGGLTVLVTGASGFVGTHVSIALRRR  120

Query  459  GDGVL  473
            GDGVL
Sbjct  121  GDGVL  125



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 73/127 (57%), Gaps = 16/127 (13%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+ER N Y  R  S++  ++ +KL F   ++V LI+IFF       +  SS  
Sbjct  14   PSTPGKVKMERSNIYFGR-GSTRWQSSVAKLFFWTVVVVGLIVIFF-------MRSSSPV  65

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR        LL+    GG  WEK+V+ S   + + G+ VLVTGAAGFVGSH SLALK
Sbjct  66   ETRR--------LLSTPHWGGHDWEKRVRYSCRVKTEKGIVVLVTGAAGFVGSHVSLALK  117

Query  453  KRGDGVL  473
            +RGDGVL
Sbjct  118  RRGDGVL  124



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQ+++SA PRR  G SVLVTGAAGFVG+H SLAL+KRGDGV+
Sbjct  71   GGLHWEKQIRASAEPRRSQGFSVLVTGAAGFVGTHVSLALRKRGDGVV  118



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 57/95 (60%), Gaps = 12/95 (13%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  82

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R + G SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  83   RVRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVL  117



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 13/95 (14%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  23   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  69

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  70   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVL  104



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV+SSA   R NG SVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  72   GGHHWEKQVKSSAQIHRANGFSVLVTGAAGFVGSHVSLALKKRGDGVV  119



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +++  ILIFFF       +       RR+L T           GG +WEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPS--SSPLPSDHSRRSLSTYDW--------GGPSWEKRVRSSA  85

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVL
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVL  120



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 13/95 (14%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  38   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  84

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  85   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVL  119



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 58/95 (61%), Gaps = 10/95 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + +ILIFFF    P          RR+L T           GG AWEK V+SSA
Sbjct  36   FWSFVFLGMILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKXVRSSA  85

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  86   RVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVL  120



>ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Tarenaya hassleriana]
Length=437

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            R L+ +  S+  AT+ GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL +RG
Sbjct  62   RNLNKSSSSVSPATY-GGSQWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALHRRG  120

Query  462  DGVL  473
            DGVL
Sbjct  121  DGVL  124



>ref|XP_001761984.1| predicted protein [Physcomitrella patens]
 gb|EDQ73088.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 68/133 (51%), Gaps = 16/133 (12%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFF------FTINYPPL  254
            P T    K+ER N + R  +     A++        L+V  I I F          Y   
Sbjct  10   PSTPGKGKMERNNFFGRAASRWHTSASAKLFALSVFLLVITIFICFRITGNGMIDGYITS  69

Query  255  AESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            A SS         T G +LL A F    AW+ +V  S TP R+NG+ VLVTGAAGFVGSH
Sbjct  70   AYSS---------TNGGTLLPA-FKSDHAWDLKVAQSCTPERENGLVVLVTGAAGFVGSH  119

Query  435  CSLALKKRGDGVL  473
             SLALKKRGDG++
Sbjct  120  VSLALKKRGDGLV  132



>ref|XP_001767292.1| predicted protein [Physcomitrella patens]
 gb|EDQ67973.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 67/127 (53%), Gaps = 4/127 (3%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+ER N + R  N     A++   LF   L+   I I F  I    + E   G
Sbjct  10   PSTPGKVKMERSNYFGRVTNRWHTSASAKLFLFSVFLLAVTIFICF-RITANGMVE---G  65

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
                A  +T    + + F     W++++  S TP R +G+ VLVTGAAGFVGSH SLALK
Sbjct  66   YMSTAYTSTNGGTIRSAFKSDKVWDQKLLQSCTPERDDGLVVLVTGAAGFVGSHVSLALK  125

Query  453  KRGDGVL  473
            KRGDG++
Sbjct  126  KRGDGLV  132



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQ+++SAT RR  GMSVLVTGAAGFVG+H SLAL+KRGDGV+
Sbjct  72   GGMHWEKQIRASATVRRPGGMSVLVTGAAGFVGTHVSLALRKRGDGVV  119



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 9/95 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F A + V LI +FF+         SS   RR +L T+ +        GG  WEK+++SSA
Sbjct  38   FWALVFVGLIFVFFYRSPNSVSNVSSDLSRR-SLRTSSY--------GGPVWEKKIKSSA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+ VLVTGAAGFVG+H S ALK+RGDGV+
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVV  123



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R NG SVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  72   GGIHWEKQVRASAQIHRHNGFSVLVTGAAGFVGSHVSLALKKRGDGVV  119



>ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  74   GGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGSHVSLALKKRGDGVV  121



>ref|XP_006477270.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Citrus sinensis]
 gb|KDO63776.1| hypothetical protein CISIN_1g042406mg [Citrus sinensis]
Length=424

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 43/57 (75%), Gaps = 4/57 (7%)
 Frame = +3

Query  315  AATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +ATF    SGG  WEKQ+  S  PR   G++VLVTGAAGFVGSH SLALKKRGDGVL
Sbjct  51   SATFRRHSSGGPQWEKQIVKSTRPRSTRGLTVLVTGAAGFVGSHVSLALKKRGDGVL  107



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 57/95 (60%), Gaps = 12/95 (13%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  79

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R + G SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  80   RLRFRRGFSVLVTGAAGFVGTHVSSALKRRGDGVL  114



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 69/127 (54%), Gaps = 14/127 (11%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+E+  SY  RV     +A  +   F   + +  ILIFFF    P  +     
Sbjct  8    PSTPGKFKMEK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFFF--RSPASSPVPAD  61

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  62   LSRRSLRTYNW--------GGPVWEKRVRASARVRSRNGFAVLVTGAAGFVGTHVSAALK  113

Query  453  KRGDGVL  473
            +RGDGVL
Sbjct  114  RRGDGVL  120



>ref|XP_010047039.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Eucalyptus grandis]
 gb|KCW78789.1| hypothetical protein EUGRSUZ_C00223 [Eucalyptus grandis]
Length=442

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 15/97 (15%)
 Frame = +3

Query  195  ATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  374
            AT M AL L+   T +Y  L         + L ++G+ LLAA++ GG  WEKQV+ SA P
Sbjct  43   ATFMWALFLLAL-TASYLSL---------QGLLSSGNRLLAASW-GGIQWEKQVRVSARP  91

Query  375  RRQNGM----SVLVTGAAGFVGSHCSLALKKRGDGVL  473
            RR  G     SVLVTGAAGFVG+H SLAL+KRGDGV+
Sbjct  92   RRPAGAGAGHSVLVTGAAGFVGAHVSLALRKRGDGVV  128



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V +I +FF+               RR+L T+          GG+ WEK+V+SSA
Sbjct  37   FWSLVFVGVIFLFFYRSPSSSTNPLPSDPSRRSLRTSW---------GGSDWEKRVRSSA  87

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  88   RIRSRNGFSVLVTGAAGFVGTHVSAALKRRGDGVL  122



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVV  118



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVV  118



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 7/65 (11%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T    LAA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYLAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVL  473
            GDGV+
Sbjct  120  GDGVV  124



>ref|XP_006396783.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
 gb|ESQ38236.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
Length=435

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 8/76 (11%)
 Frame = +3

Query  246  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
            PP + S     RR L+ +  S+ AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFV
Sbjct  55   PPPSPS-----RRNLYDS--SVSAAKY-GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFV  106

Query  426  GSHCSLALKKRGDGVL  473
            G+H S+AL++RGDGVL
Sbjct  107  GTHVSIALRRRGDGVL  122



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  312  LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            LA+   GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  70   LASATWGGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVL  123



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LI I FF       +  S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFICFFKSTSSSSSPVSSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R  NG+SVLVTGAAGFVG+H S ALK+RGDGV+
Sbjct  89   KIRSTNGISVLVTGAAGFVGTHVSSALKRRGDGVV  123



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 59/95 (62%), Gaps = 9/95 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI +FF+         SS   RR +L T+ +        GG  WEK+++SSA
Sbjct  38   FWSLVFVGLIFVFFYRSPNSVSNVSSDLSRR-SLRTSSY--------GGPVWEKKIKSSA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+ VLVTGAAGFVG+H S ALK+RGDGV+
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVV  123



>ref|XP_009786918.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana sylvestris]
Length=431

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKRG
Sbjct  56   QSFMDSGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRG  114

Query  462  DGVL  473
            DGV+
Sbjct  115  DGVV  118



>ref|XP_009600710.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana tomentosiformis]
Length=431

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKRG
Sbjct  56   QSFMDSGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRG  114

Query  462  DGVL  473
            DGV+
Sbjct  115  DGVV  118



>ref|XP_008372097.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Malus domestica]
Length=432

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMSVL+TGAAGFVGSH SLALKKRGDGV+
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLITGAAGFVGSHVSLALKKRGDGVV  119



>ref|XP_006350062.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=431

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVGSH S+ALKKRG
Sbjct  56   QSFMDSGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKRG  114

Query  462  DGVL  473
            DGV+
Sbjct  115  DGVV  118



>ref|XP_004251783.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum lycopersicum]
Length=432

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVGSH S+ALKKRGDGV+
Sbjct  61   SGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKRGDGVV  118



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA  RR  GMSVLVTG AGFVG+H SLALKKRGDGV+
Sbjct  69   GGIQWEKQVRTSAQIRRSGGMSVLVTGGAGFVGTHVSLALKKRGDGVV  116



>ref|XP_006440401.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
 gb|ESR53641.1| hypothetical protein CICLE_v10020257mg [Citrus clementina]
Length=427

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQ+  S  PR  +G++VLVTGAAGFVGSH SLALKKRGDGVL
Sbjct  63   GGPQWEKQIVKSTRPRSTSGLTVLVTGAAGFVGSHVSLALKKRGDGVL  110



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G   L A++ GG  WEKQV+SS+   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  63   SGSRYLTASW-GGIQWEKQVRSSSQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVV  120



>gb|AFW85530.1| hypothetical protein ZEAMMB73_797483 [Zea mays]
Length=413

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 6/54 (11%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQN------GMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WE+Q+++SA+PRR++      G+SVLVTGAAGFVG+HCSLAL+KRGDGV+
Sbjct  49   GGLHWERQIRASASPRRRSAPGAPAGLSVLVTGAAGFVGAHCSLALRKRGDGVV  102



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 59/95 (62%), Gaps = 13/95 (14%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +   L+ IFF+     P+  S+    RR+L T           GG  WEK+V+SSA
Sbjct  38   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPHWEKRVRSSA  84

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  85   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVL  119



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +3

Query  309  LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            L +AT+ GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  66   LTSATW-GGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVL  119



>gb|KJB27036.1| hypothetical protein B456_004G273500 [Gossypium raimondii]
Length=403

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQ+++SA   R  GMSVLVTGAAGF+GSH SLALKKRGDGV+
Sbjct  71   GGIQWEKQIRNSAKTNRPGGMSVLVTGAAGFIGSHVSLALKKRGDGVV  118



>gb|KJB27035.1| hypothetical protein B456_004G273500 [Gossypium raimondii]
Length=430

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G+    A++ GG  WEKQ+++SA   R  GMSVLVTGAAGF+GSH SLALKKRGDGV+
Sbjct  61   SGNRYFTASW-GGIQWEKQIRNSAKTNRPGGMSVLVTGAAGFIGSHVSLALKKRGDGVV  118



>gb|ACJ11754.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=431

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
            R ++   +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKK
Sbjct  54   RFQSFVDSGSRYFSASW-GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKK  112

Query  456  RGDGVL  473
            RGDGV+
Sbjct  113  RGDGVV  118



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            TG   L A++ GG  WEKQV++SA  RR  G SVLVTG AGFVG+H SLALKKRGDGV+
Sbjct  61   TGSRYLTASW-GGIQWEKQVRTSAEIRRSGGFSVLVTGGAGFVGTHVSLALKKRGDGVV  118



>ref|XP_010103125.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
 gb|EXB94890.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
Length=432

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  71   GGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVV  118



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQ+++SAT RR  G SVLVTGAAGFVG+H SLAL+KRGDGV+
Sbjct  71   GGMQWEKQIRASATVRRPGGFSVLVTGAAGFVGTHVSLALRKRGDGVV  118



>ref|XP_009114629.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Brassica 
rapa]
Length=435

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 53/65 (82%), Gaps = 3/65 (5%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR+L+ +  SL +A + GG+ WEK+V+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSSAKY-GGSQWEKKVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  459  GDGVL  473
            GDGVL
Sbjct  118  GDGVL  122



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  71   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVV  118



>gb|KDP38751.1| hypothetical protein JCGZ_04104 [Jatropha curcas]
Length=431

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  71   GGIQWEKQVRTSAQIHRTGGMSVLVTGAAGFVGTHVSLALKKRGDGVV  118



>ref|XP_008649176.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Zea mays]
Length=440

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 6/54 (11%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGVL
Sbjct  71   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVL  124



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG AWEK++++SA  R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVL
Sbjct  76   GGPAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVL  123



>ref|XP_002874760.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51019.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 7/76 (9%)
 Frame = +3

Query  246  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR + G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSRGGLTVLVTGASGFV  107

Query  426  GSHCSLALKKRGDGVL  473
            G+H S+AL++RGDGVL
Sbjct  108  GTHVSIALRRRGDGVL  123



>ref|XP_009348282.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Pyrus x bretschneideri]
Length=432

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVV  119



>ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume]
Length=432

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVV  119



>ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
 gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
Length=432

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVV  119



>ref|NP_192962.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
 sp|Q9STI6.1|GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5; AltName: Full=UDP-glucuronic 
acid epimerase 5 [Arabidopsis thaliana]
 emb|CAB45972.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 emb|CAB78268.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN12948.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE83108.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
Length=436

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = +3

Query  246  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFV  107

Query  426  GSHCSLALKKRGDGVL  473
            G+H S+AL++RGDGVL
Sbjct  108  GTHVSIALRRRGDGVL  123



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 69/127 (54%), Gaps = 14/127 (11%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+E+  SY  RV     +A  +   F   + +  ILIFF  +  P  +     
Sbjct  14   PSTPGKFKMEK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFF--LRSPASSPVPAD  67

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  68   LSRRSLRTYNW--------GGPVWEKRVRASAQIRSRNGFAVLVTGAAGFVGTHVSAALK  119

Query  453  KRGDGVL  473
            +RGDGVL
Sbjct  120  RRGDGVL  126



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQ+++SA  RR  G+SVLVTGAAGFVGSH SLAL+KRGDGV+
Sbjct  71   GGLHWEKQIRASAEVRRPQGISVLVTGAAGFVGSHVSLALRKRGDGVV  118



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 8/95 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LI + FF       + +S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFVCFFRSPSSSSSPASSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+
Sbjct  89   KIRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVV  123



>gb|AAK93670.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=436

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = +3

Query  246  PPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
            PP + S     RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFV
Sbjct  55   PPPSPS-----RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFV  107

Query  426  GSHCSLALKKRGDGVL  473
            G+H S+AL++RGDGVL
Sbjct  108  GTHVSIALQRRGDGVL  123



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 7/65 (11%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVL  473
            GDGV+
Sbjct  120  GDGVV  124



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 7/65 (11%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVL  473
            GDGV+
Sbjct  120  GDGVV  124



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG AWEK+V+SSA  R +NG SVLVTGAAGFVG+H S ALKKRGDGVL
Sbjct  76   GGPAWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSSALKKRGDGVL  123



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG+ WEK V+ SA  +R+NG+ VLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  86   GGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKRGDGVI  133



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 7/65 (11%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVL  473
            GDGV+
Sbjct  120  GDGVV  124



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG+ WEK V+ SA  +R+NG+ VLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  86   GGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKRGDGVI  133



>ref|XP_009114630.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Brassica 
rapa]
Length=436

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVL
Sbjct  76   GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVL  123



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  74   GGPAWEKRVRSSARIRSRNGISVLVTGAAGFVGTHVSTALKRRGDGVL  121



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 7/65 (11%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVL  473
            GDGV+
Sbjct  120  GDGVV  124



>ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +3

Query  291  HTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGV  470
            H  G +  AA++ GG AWEKQ++ S   RR N   VLVTGAAGF+G+H SLALKKRGDGV
Sbjct  66   HARGATTAAASW-GGPAWEKQLRRSCETRRANAQVVLVTGAAGFIGTHVSLALKKRGDGV  124

Query  471  L  473
            L
Sbjct  125  L  125



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 8/65 (12%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR+L T  HS       GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  59   RRSLRT--HSW------GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRR  110

Query  459  GDGVL  473
            GDGV+
Sbjct  111  GDGVI  115



>emb|CDY04398.1| BnaC02g28500D [Brassica napus]
Length=429

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG+ WEKQV+ SA PR   G++VLVTGAAGFVG+H S+AL++RGDGVL
Sbjct  69   GGSHWEKQVRKSACPRSSGGLTVLVTGAAGFVGTHVSIALRRRGDGVL  116



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSS  365
            F   + V LIL+F    +      +S    + ++ +T HS    TFS GG +WEK+V++S
Sbjct  43   FWCCIFVGLILVFMLRSSSSSSYSASDYRDKDSI-STRHSRSLRTFSWGGPSWEKRVRNS  101

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
               R  NG SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  102  GRVRAPNGFSVLVTGAAGFVGTHVSAALKRRGDGVL  137



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  78   GGPAWEKRVRSSARVRARNGLSVLVTGAAGFVGTHVSAALKRRGDGVL  125



>emb|CDX97356.1| BnaA02g21470D [Brassica napus]
Length=429

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVL
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVL  116



>ref|XP_009128629.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=429

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVL
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVL  116



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTG+A FVGSH SLALK+RGDGV+
Sbjct  64   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGSACFVGSHVSLALKRRGDGVV  121



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  71   GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVV  118



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+
Sbjct  71   GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVV  118



>ref|XP_010525760.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Tarenaya hassleriana]
Length=431

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G   L+A++ GG  WEKQV++SA   R  G+SVLVTGAAGFVGSH SLALKKRGDG +
Sbjct  58   SGSKYLSASW-GGIQWEKQVRTSAEIHRSGGISVLVTGAAGFVGSHVSLALKKRGDGAV  115



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  86   GGPAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVL  133



>ref|XP_010422190.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010422191.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Camelina 
sativa]
 ref|XP_010422192.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X3 [Camelina 
sativa]
 ref|XP_010422193.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X4 [Camelina 
sativa]
 ref|XP_010455665.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Camelina sativa]
Length=435

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  62   RRNLNDS--SSVSAAKYGGSHWEKQVRKSARPRSPGGLTVLVTGASGFVGTHVSIALRRR  119

Query  459  GDGVL  473
            GDGVL
Sbjct  120  GDGVL  124



>dbj|BAK06545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 6/54 (11%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+
Sbjct  74   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVV  127



>ref|XP_003564175.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Brachypodium distachyon]
Length=441

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 6/54 (11%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+
Sbjct  72   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVV  125



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 6/54 (11%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+
Sbjct  71   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVV  124



>ref|NP_001105911.1| LOC732831 [Zea mays]
 gb|ABB51650.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 7/65 (11%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL++R
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119

Query  459  GDGVL  473
            GDGV+
Sbjct  120  GDGVV  124



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVV  121



>dbj|BAD36515.1| putative uridine diphosphate galacturonate 4-epimerase [Oryza 
sativa Japonica Group]
 dbj|BAD72456.1| putative uridine diphosphate galacturonate 4-epimerase [Oryza 
sativa Japonica Group]
Length=453

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 6/54 (11%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+
Sbjct  83   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGAHCSLALRKRGDGVV  136



>gb|EAY99954.1| hypothetical protein OsI_21957 [Oryza sativa Indica Group]
Length=453

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 6/54 (11%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+
Sbjct  83   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGAHCSLALRKRGDGVV  136



>emb|CDP09891.1| unnamed protein product [Coffea canephora]
Length=454

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 54/85 (64%), Gaps = 16/85 (19%)
 Frame = +3

Query  246  PPLAESSG------GGRRRALHT---TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSV  398
            PP A S+       GG+RR+LHT    G SL       G  WE +  +SA P  ++G+SV
Sbjct  65   PPSATSTASNASVNGGKRRSLHTAAVVGPSL-------GPNWENRAWASARPASKSGLSV  117

Query  399  LVTGAAGFVGSHCSLALKKRGDGVL  473
            LVTGA GFVG+H SLALKKRGDGV+
Sbjct  118  LVTGAVGFVGAHVSLALKKRGDGVV  142



>ref|XP_008677814.1| PREDICTED: LOC732831 isoform X1 [Zea mays]
 gb|ACF78800.1| unknown [Zea mays]
 gb|ACN28799.1| unknown [Zea mays]
 gb|ACR36221.1| unknown [Zea mays]
 gb|AFW64179.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 7/65 (11%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL++R
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119

Query  459  GDGVL  473
            GDGV+
Sbjct  120  GDGVV  124



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVV  121



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 69/127 (54%), Gaps = 14/127 (11%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+++  SY  RV     +A  +   F   + +  ILIFF  +  P  +     
Sbjct  14   PPTPGKFKMDK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFF--LRSPASSPVPAD  67

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  68   LSRRSLRTYNW--------GGPVWEKRVRASAQVRSRNGFAVLVTGAAGFVGTHVSAALK  119

Query  453  KRGDGVL  473
            +RGDGVL
Sbjct  120  RRGDGVL  126



>ref|XP_010276827.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nelumbo nucifera]
Length=438

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG +WEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVL
Sbjct  78   GGPSWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALKRRGDGVL  125



>ref|XP_008361335.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Malus domestica]
Length=432

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SL LKKRGDGV+
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLGLKKRGDGVV  119



>ref|XP_008660337.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Zea mays]
 gb|AFW88969.1| hypothetical protein ZEAMMB73_845050 [Zea mays]
Length=479

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR+LH +  S    T  GGAAWEK+V++SA  RR  G SVLVTGAAGFVG H + AL++R
Sbjct  80   RRSLHASPSS---TTSWGGAAWEKKVRASARIRRSGGHSVLVTGAAGFVGCHAAAALRRR  136

Query  459  GDGVL  473
            GDGVL
Sbjct  137  GDGVL  141



>ref|XP_004296420.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Fragaria vesca subsp. 
vesca]
Length=434

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            GG  WEKQV++SA   R  GMS+LVTGAAGFVG+H S+ALKKRGDGV+
Sbjct  74   GGIQWEKQVRNSAQIHRSGGMSILVTGAAGFVGTHVSVALKKRGDGVV  121



>gb|KGN65261.1| hypothetical protein Csa_1G277970 [Cucumis sativus]
Length=432

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +G   L+A++ GG  WEKQV++SA   R  GMSVLVTGA+GFVG+H SLALK+RGDGV+
Sbjct  62   SGTRYLSASW-GGLQWEKQVRTSAEITRSGGMSVLVTGASGFVGTHVSLALKRRGDGVV  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180