BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004D24

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008393001.1|  PREDICTED: putative uncharacterized protein ...    102   5e-22   
ref|XP_002318061.2|  hypothetical protein POPTR_0012s08510g           97.1    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011047827.1|  PREDICTED: arginine-glutamic acid dipeptide ...  96.7    3e-20   Populus euphratica
ref|XP_008374404.1|  PREDICTED: TSC22 domain family protein 1-like    96.7    3e-20   
ref|XP_011047825.1|  PREDICTED: altered inheritance of mitochondr...  96.7    3e-20   Populus euphratica
ref|XP_008245310.1|  PREDICTED: uncharacterized protein LOC103343434  94.7    9e-20   Prunus mume [ume]
ref|XP_006833453.1|  hypothetical protein AMTR_s00082p00053170        95.9    1e-19   
ref|XP_007210457.1|  hypothetical protein PRUPE_ppa005168m1g          90.9    5e-19   
ref|XP_007150938.1|  hypothetical protein PHAVU_004G007500g           92.4    1e-18   Phaseolus vulgaris [French bean]
gb|ACZ74657.1|  hypothetical protein                                  92.0    2e-18   Phaseolus vulgaris [French bean]
ref|XP_010248593.1|  PREDICTED: pollen-specific leucine-rich repe...  91.7    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010663115.1|  PREDICTED: proline-rich receptor-like protei...  91.3    3e-18   Vitis vinifera
ref|XP_004298978.1|  PREDICTED: uncharacterized protein LOC101312152  91.3    3e-18   Fragaria vesca subsp. vesca
ref|XP_011097415.1|  PREDICTED: protein enabled-like                  90.9    4e-18   Sesamum indicum [beniseed]
emb|CAN60421.1|  hypothetical protein VITISV_021069                   90.5    6e-18   Vitis vinifera
ref|XP_003525675.1|  PREDICTED: arginine-glutamic acid dipeptide ...  90.1    9e-18   Glycine max [soybeans]
ref|XP_010033310.1|  PREDICTED: pollen-specific leucine-rich repe...  89.7    1e-17   Eucalyptus grandis [rose gum]
gb|KHN27460.1|  hypothetical protein glysoja_022169                   89.7    1e-17   Glycine soja [wild soybean]
ref|XP_002275607.1|  PREDICTED: protein enabled                       89.0    2e-17   Vitis vinifera
emb|CBI34879.3|  unnamed protein product                              87.8    4e-17   Vitis vinifera
ref|XP_008795992.1|  PREDICTED: protein transport protein SEC31-like  88.2    4e-17   
emb|CDP02078.1|  unnamed protein product                              88.2    4e-17   Coffea canephora [robusta coffee]
ref|XP_008801947.1|  PREDICTED: arginine-glutamic acid dipeptide ...  87.0    8e-17   Phoenix dactylifera
ref|XP_010108811.1|  hypothetical protein L484_020546                 87.4    9e-17   Morus notabilis
ref|XP_011464066.1|  PREDICTED: formin-like protein 3 isoform X2      87.0    1e-16   Fragaria vesca subsp. vesca
ref|XP_004299014.1|  PREDICTED: formin-like protein 3 isoform X1      86.7    1e-16   Fragaria vesca subsp. vesca
ref|NP_001042136.2|  Os01g0169900                                     86.3    2e-16   
ref|XP_007222918.1|  hypothetical protein PRUPE_ppa003684mg           85.9    2e-16   Prunus persica
ref|XP_008230557.1|  PREDICTED: protein transport protein SEC31       85.9    3e-16   Prunus mume [ume]
ref|XP_006603779.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    4e-16   
ref|XP_009334114.1|  PREDICTED: arginine-glutamic acid dipeptide ...  85.1    5e-16   Pyrus x bretschneideri [bai li]
ref|XP_010906083.1|  PREDICTED: protein transport protein SEC31       84.7    5e-16   Elaeis guineensis
gb|KCW54142.1|  hypothetical protein EUGRSUZ_I00119                   84.3    5e-16   Eucalyptus grandis [rose gum]
ref|XP_003554822.1|  PREDICTED: vacuolar protein sorting-associat...  84.7    6e-16   Glycine max [soybeans]
ref|XP_010551915.1|  PREDICTED: actin cytoskeleton-regulatory com...  84.7    6e-16   Tarenaya hassleriana [spider flower]
ref|XP_010694912.1|  PREDICTED: putative uncharacterized protein ...  84.7    7e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF01541.1|AC009325_11  unknown protein                            84.0    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784980.1|  PREDICTED: uncharacterized protein LOC103703781  84.7    1e-15   Phoenix dactylifera
ref|XP_009595507.1|  PREDICTED: uncharacterized protein LOC104091...  79.0    1e-15   
ref|XP_010037529.1|  PREDICTED: vegetative cell wall protein gp1-...  84.0    1e-15   Eucalyptus grandis [rose gum]
ref|XP_010102503.1|  hypothetical protein L484_014559                 84.0    1e-15   
ref|XP_004232320.1|  PREDICTED: pollen-specific leucine-rich repe...  84.0    1e-15   Solanum lycopersicum
ref|XP_008365379.1|  PREDICTED: protein enabled-like                  83.6    1e-15   
ref|XP_008379205.1|  PREDICTED: protein enabled                       83.6    1e-15   
ref|XP_006643803.1|  PREDICTED: vegetative cell wall protein gp1-...  83.6    2e-15   Oryza brachyantha
ref|XP_009595505.1|  PREDICTED: uncharacterized protein LOC104091...  78.6    2e-15   Nicotiana tomentosiformis
ref|XP_007031556.1|  Uncharacterized protein TCM_016944               83.2    2e-15   
ref|XP_006341319.1|  PREDICTED: trithorax group protein osa-like      83.2    2e-15   Solanum tuberosum [potatoes]
gb|KDO69523.1|  hypothetical protein CISIN_1g009789mg                 83.2    2e-15   Citrus sinensis [apfelsine]
ref|XP_006439889.1|  hypothetical protein CICLE_v10019708mg           83.2    2e-15   Citrus clementina [clementine]
gb|KDO69524.1|  hypothetical protein CISIN_1g009789mg                 83.2    2e-15   Citrus sinensis [apfelsine]
ref|XP_006476848.1|  PREDICTED: AT-rich interactive domain-contai...  83.2    2e-15   Citrus sinensis [apfelsine]
gb|KDP45326.1|  hypothetical protein JCGZ_09575                       83.2    2e-15   Jatropha curcas
ref|XP_009388841.1|  PREDICTED: bromodomain-containing protein 4      82.8    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006408524.1|  hypothetical protein EUTSA_v10020517mg           82.8    3e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010940140.1|  PREDICTED: protein diaphanous homolog 1-like     82.8    3e-15   Elaeis guineensis
gb|EMS67668.1|  hypothetical protein TRIUR3_30524                     82.8    3e-15   Triticum urartu
ref|XP_007217219.1|  hypothetical protein PRUPE_ppa003425mg           82.4    3e-15   Prunus persica
gb|EYU44780.1|  hypothetical protein MIMGU_mgv1a004985mg              82.0    4e-15   Erythranthe guttata [common monkey flower]
ref|NP_186805.2|  uncharacterized protein                             82.0    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002440684.1|  hypothetical protein SORBIDRAFT_09g005090        81.6    7e-15   
ref|XP_006338590.1|  PREDICTED: AT-rich interactive domain-contai...  81.3    1e-14   Solanum tuberosum [potatoes]
ref|XP_008219121.1|  PREDICTED: uncharacterized protein LOC103319367  82.0    1e-14   
ref|XP_003568842.1|  PREDICTED: zyxin-like                            80.9    1e-14   Brachypodium distachyon [annual false brome]
emb|CDM81418.1|  unnamed protein product                              80.9    1e-14   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK07367.1|  predicted protein                                    80.9    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH24794.1|  DNA-binding protein, putative                         80.5    2e-14   Medicago truncatula
ref|XP_006297454.1|  hypothetical protein CARUB_v10013474mg           80.5    2e-14   
ref|XP_004489226.1|  PREDICTED: vacuolar protein sorting-associat...  80.5    2e-14   Cicer arietinum [garbanzo]
ref|XP_009362961.1|  PREDICTED: histone acetyltransferase KAT6A-l...  79.0    2e-14   
ref|XP_002884275.1|  hypothetical protein ARALYDRAFT_477359           80.1    2e-14   
gb|KDP31054.1|  hypothetical protein JCGZ_11430                       80.1    2e-14   Jatropha curcas
ref|XP_009611187.1|  PREDICTED: transcriptional regulator DEF1 is...  80.1    2e-14   Nicotiana tomentosiformis
gb|KFK37621.1|  hypothetical protein AALP_AA3G007100                  80.1    2e-14   Arabis alpina [alpine rockcress]
ref|XP_004960805.1|  PREDICTED: protein diaphanous homolog 1-like     80.1    2e-14   
ref|XP_006655038.1|  PREDICTED: vegetative cell wall protein gp1-...  79.7    2e-14   Oryza brachyantha
ref|XP_002455112.1|  hypothetical protein SORBIDRAFT_03g004550        80.1    3e-14   
ref|XP_011098435.1|  PREDICTED: protein diaphanous homolog 1-like     80.1    3e-14   Sesamum indicum [beniseed]
ref|NP_001140648.1|  uncharacterized protein LOC100272723             80.1    3e-14   Zea mays [maize]
gb|EMS54596.1|  Tryptophan aminotransferase 1                         80.5    3e-14   Triticum urartu
gb|KJB40752.1|  hypothetical protein B456_007G076000                  79.7    3e-14   Gossypium raimondii
ref|XP_011046206.1|  PREDICTED: uncharacterized protein LOC105140870  79.3    4e-14   Populus euphratica
gb|KHG02060.1|  Myosin-2                                              79.3    5e-14   Gossypium arboreum [tree cotton]
ref|XP_002511348.1|  conserved hypothetical protein                   79.0    5e-14   
gb|EMT01630.1|  hypothetical protein F775_09697                       79.0    6e-14   
gb|AFW80147.1|  putative DUF1421 domain family protein                79.0    6e-14   
ref|NP_001054762.2|  Os05g0169400                                     79.0    6e-14   
gb|EAY96697.1|  hypothetical protein OsI_18619                        79.0    6e-14   Oryza sativa Indica Group [Indian rice]
emb|CAB87621.1|  putative protein                                     78.6    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968338.1|  PREDICTED: class E vacuolar protein-sorting ...  79.0    7e-14   Setaria italica
ref|XP_009362960.1|  PREDICTED: uncharacterized protein LOC103952...  78.2    7e-14   Pyrus x bretschneideri [bai li]
ref|NP_196958.2|  uncharacterized protein                             78.6    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403230.1|  PREDICTED: pollen-specific leucine-rich repe...  78.6    8e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO55180.1|  hypothetical protein CISIN_1g0084162mg                78.2    9e-14   Citrus sinensis [apfelsine]
ref|XP_006369924.1|  hypothetical protein POPTR_0001s35000g           76.3    9e-14   
gb|KJB40754.1|  hypothetical protein B456_007G076000                  78.2    1e-13   Gossypium raimondii
ref|XP_010908580.1|  PREDICTED: pollen-specific leucine-rich repe...  77.8    1e-13   Elaeis guineensis
ref|XP_006446566.1|  hypothetical protein CICLE_v10014743mg           78.2    1e-13   Citrus clementina [clementine]
ref|NP_001147786.1|  LOC100281396                                     77.8    1e-13   
ref|XP_002873675.1|  predicted protein                                77.4    2e-13   
gb|KDO55179.1|  hypothetical protein CISIN_1g0084162mg                77.8    2e-13   Citrus sinensis [apfelsine]
gb|KFK25694.1|  hypothetical protein AALP_AA8G147000                  77.8    2e-13   Arabis alpina [alpine rockcress]
ref|XP_006470271.1|  PREDICTED: COPII coat assembly protein sec16...  77.8    2e-13   Citrus sinensis [apfelsine]
ref|XP_009766181.1|  PREDICTED: programmed cell death 6-interacti...  77.8    2e-13   Nicotiana sylvestris
gb|KJB40753.1|  hypothetical protein B456_007G076000                  77.4    2e-13   Gossypium raimondii
ref|XP_008245313.1|  PREDICTED: uncharacterized protein LOC103343438  75.5    2e-13   
dbj|BAK01901.1|  predicted protein                                    77.4    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009125983.1|  PREDICTED: WW domain-binding protein 11 isof...  77.4    2e-13   Brassica rapa
ref|XP_009125985.1|  PREDICTED: WW domain-binding protein 11 isof...  77.4    2e-13   Brassica rapa
gb|KHG20812.1|  Actin cytoskeleton-regulatory complex PAN1            77.4    2e-13   Gossypium arboreum [tree cotton]
emb|CDX91045.1|  BnaC02g05520D                                        77.0    2e-13   
emb|CDX85594.1|  BnaA02g02190D                                        77.0    2e-13   
gb|KJB75894.1|  hypothetical protein B456_012G063600                  77.0    3e-13   Gossypium raimondii
ref|XP_010910341.1|  PREDICTED: pollen-specific leucine-rich repe...  76.6    3e-13   Elaeis guineensis
ref|XP_010230500.1|  PREDICTED: uncharacterized protein LOC100838076  77.0    4e-13   Brachypodium distachyon [annual false brome]
ref|XP_010910342.1|  PREDICTED: pollen-specific leucine-rich repe...  76.6    4e-13   Elaeis guineensis
gb|KDO55178.1|  hypothetical protein CISIN_1g0084162mg                76.6    4e-13   Citrus sinensis [apfelsine]
ref|XP_011047322.1|  PREDICTED: vacuolar protein sorting-associat...  76.3    5e-13   Populus euphratica
ref|XP_009613822.1|  PREDICTED: SH3 domain-containing protein C23...  76.3    5e-13   Nicotiana tomentosiformis
ref|XP_008361778.1|  PREDICTED: uncharacterized protein LOC103425469  73.9    1e-12   
ref|XP_010453577.1|  PREDICTED: basic salivary proline-rich prote...  74.7    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010492262.1|  PREDICTED: basic salivary proline-rich prote...  74.7    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009611188.1|  PREDICTED: transcriptional regulator DEF1 is...  74.3    2e-12   Nicotiana tomentosiformis
ref|XP_009782100.1|  PREDICTED: pollen-specific leucine-rich repe...  74.3    3e-12   Nicotiana sylvestris
ref|XP_007036361.1|  Apoptosis-stimulating of p53 protein 1, puta...  73.6    3e-12   
emb|CBI14977.3|  unnamed protein product                              73.2    4e-12   Vitis vinifera
ref|XP_004252212.1|  PREDICTED: extensin-like                         73.6    4e-12   Solanum lycopersicum
ref|XP_010663116.1|  PREDICTED: vegetative cell wall protein gp1-...  72.8    5e-12   Vitis vinifera
ref|XP_002524656.1|  DNA binding protein, putative                    73.2    5e-12   Ricinus communis
ref|XP_006289230.1|  hypothetical protein CARUB_v10002686mg           72.4    8e-12   Capsella rubella
gb|KHN27461.1|  hypothetical protein glysoja_022170                   67.4    1e-11   Glycine soja [wild soybean]
ref|XP_009613823.1|  PREDICTED: putative uncharacterized protein ...  70.9    3e-11   Nicotiana tomentosiformis
ref|XP_010420094.1|  PREDICTED: protein transport protein sec31-like  70.9    4e-11   
gb|EPS66622.1|  hypothetical protein M569_08156                       67.4    4e-11   Genlisea aurea
gb|ADE75761.1|  unknown                                               70.1    5e-11   Picea sitchensis
ref|XP_006579780.1|  PREDICTED: serine/threonine-protein phosphat...  67.8    3e-10   Glycine max [soybeans]
ref|XP_002985569.1|  hypothetical protein SELMODRAFT_446314           65.9    2e-09   Selaginella moellendorffii
ref|XP_002987005.1|  hypothetical protein SELMODRAFT_425866           65.5    2e-09   Selaginella moellendorffii
ref|XP_006844887.1|  hypothetical protein AMTR_s00058p00125550        59.7    2e-07   
ref|XP_009628597.1|  PREDICTED: ataxin-2 homolog                      58.5    4e-07   Nicotiana tomentosiformis
ref|XP_004303103.1|  PREDICTED: transcriptional regulator DEF1        58.5    4e-07   Fragaria vesca subsp. vesca
ref|XP_008337475.1|  PREDICTED: altered inheritance of mitochondr...  58.2    5e-07   
gb|KDO69525.1|  hypothetical protein CISIN_1g009789mg                 57.4    7e-07   Citrus sinensis [apfelsine]
ref|XP_009782624.1|  PREDICTED: pollen-specific leucine-rich repe...  57.8    8e-07   Nicotiana sylvestris
ref|XP_010242911.1|  PREDICTED: RNA polymerase II degradation fac...  57.4    9e-07   Nelumbo nucifera [Indian lotus]
ref|XP_004243351.1|  PREDICTED: bromodomain-containing protein 4-...  57.4    9e-07   Solanum lycopersicum
ref|XP_009782976.1|  PREDICTED: vacuolar protein sorting-associat...  57.0    1e-06   Nicotiana sylvestris
emb|CDP14783.1|  unnamed protein product                              56.6    2e-06   Coffea canephora [robusta coffee]
ref|XP_006357482.1|  PREDICTED: transcription factor SPT20 homolog    56.6    2e-06   Solanum tuberosum [potatoes]
ref|XP_009628959.1|  PREDICTED: extensin-like                         56.2    2e-06   Nicotiana tomentosiformis
ref|XP_010496293.1|  PREDICTED: proline-rich receptor-like protei...  56.2    2e-06   
ref|XP_004248167.1|  PREDICTED: bromodomain-containing protein 4      55.5    4e-06   Solanum lycopersicum
ref|XP_006367642.1|  PREDICTED: adenylate cyclase, terminal-diffe...  55.1    5e-06   Solanum tuberosum [potatoes]
ref|XP_009336199.1|  PREDICTED: mediator of RNA polymerase II tra...  55.1    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_009336198.1|  PREDICTED: mediator of RNA polymerase II tra...  55.1    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_008341426.1|  PREDICTED: YLP motif-containing protein 1-like   54.7    7e-06   
ref|XP_009341977.1|  PREDICTED: ATP-dependent helicase brm-like i...  54.3    8e-06   Pyrus x bretschneideri [bai li]
ref|XP_009341976.1|  PREDICTED: ATP-dependent helicase brm-like i...  54.3    8e-06   Pyrus x bretschneideri [bai li]
ref|XP_004506616.1|  PREDICTED: transcription factor SPT20 homolog    53.9    1e-05   Cicer arietinum [garbanzo]
emb|CBI21851.3|  unnamed protein product                              51.6    1e-05   Vitis vinifera
ref|XP_008229157.1|  PREDICTED: mediator of RNA polymerase II tra...  53.9    1e-05   Prunus mume [ume]
ref|XP_008229158.1|  PREDICTED: mediator of RNA polymerase II tra...  53.9    1e-05   Prunus mume [ume]
ref|XP_007198900.1|  hypothetical protein PRUPE_ppa004117mg           53.9    1e-05   Prunus persica
ref|XP_009357856.1|  PREDICTED: putative uncharacterized protein ...  53.9    1e-05   Pyrus x bretschneideri [bai li]
ref|XP_002272844.1|  PREDICTED: arginine-glutamic acid dipeptide ...  53.5    2e-05   Vitis vinifera
ref|XP_010110218.1|  hypothetical protein L484_009824                 52.8    3e-05   Morus notabilis
ref|XP_009377181.1|  PREDICTED: protein transport protein SEC31-like  52.8    3e-05   Pyrus x bretschneideri [bai li]
gb|KEH17617.1|  structural constituent of cell wall protein, puta...  52.4    4e-05   Medicago truncatula
gb|KDO51849.1|  hypothetical protein CISIN_1g008878mg                 51.6    6e-05   Citrus sinensis [apfelsine]
gb|KDO51850.1|  hypothetical protein CISIN_1g008878mg                 51.6    6e-05   Citrus sinensis [apfelsine]
ref|XP_010035753.1|  PREDICTED: RNA polymerase II degradation fac...  51.6    7e-05   Eucalyptus grandis [rose gum]
ref|XP_009395702.1|  PREDICTED: pollen-specific leucine-rich repe...  51.6    7e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006447363.1|  hypothetical protein CICLE_v10014791mg           51.2    8e-05   Citrus clementina [clementine]
ref|XP_006447362.1|  hypothetical protein CICLE_v10014791mg           51.2    9e-05   Citrus clementina [clementine]
ref|XP_008342911.1|  PREDICTED: extensin-like isoform X2              51.2    9e-05   
ref|XP_010051997.1|  PREDICTED: LOW QUALITY PROTEIN: bromodomain-...  51.2    9e-05   Eucalyptus grandis [rose gum]
ref|XP_003539922.1|  PREDICTED: putative uncharacterized protein ...  51.2    1e-04   Glycine max [soybeans]
ref|XP_008342910.1|  PREDICTED: extensin-like isoform X1              51.2    1e-04   
ref|XP_006592435.1|  PREDICTED: putative uncharacterized protein ...  51.2    1e-04   Glycine max [soybeans]
ref|XP_010689008.1|  PREDICTED: RNA polymerase II degradation fac...  50.8    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004136824.1|  PREDICTED: uncharacterized protein LOC101206745  50.8    1e-04   Cucumis sativus [cucumbers]
ref|XP_008455322.1|  PREDICTED: transcription factor SPT20 homolog    50.8    1e-04   Cucumis melo [Oriental melon]
emb|CAN71577.1|  hypothetical protein VITISV_043279                   50.1    2e-04   Vitis vinifera
gb|KJB31694.1|  hypothetical protein B456_005G201600                  50.4    2e-04   Gossypium raimondii
ref|XP_006582794.1|  PREDICTED: vacuolar protein sorting-associat...  50.1    2e-04   
gb|KHN35253.1|  hypothetical protein glysoja_042323                   50.1    2e-04   Glycine soja [wild soybean]
ref|XP_001770189.1|  predicted protein                                49.7    3e-04   
gb|KHN31988.1|  hypothetical protein glysoja_025822                   48.9    5e-04   Glycine soja [wild soybean]
ref|XP_010919602.1|  PREDICTED: tyrosine-protein phosphatase non-...  48.9    5e-04   Elaeis guineensis
emb|CAB79632.1|  predicted proline-rich protein                       48.9    5e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EYU28592.1|  hypothetical protein MIMGU_mgv1a004659mg              48.9    6e-04   Erythranthe guttata [common monkey flower]
ref|XP_010919593.1|  PREDICTED: tyrosine-protein phosphatase non-...  48.5    6e-04   Elaeis guineensis
gb|EEC71500.1|  hypothetical protein OsI_03777                        48.5    6e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001044280.1|  Os01g0754500                                     48.5    7e-04   
ref|XP_008798248.1|  PREDICTED: putative cyclin-dependent serine/...  48.5    7e-04   Phoenix dactylifera
ref|XP_011098021.1|  PREDICTED: extensin                              48.5    7e-04   Sesamum indicum [beniseed]
ref|XP_003540363.1|  PREDICTED: integrator complex subunit 3 homo...  48.1    8e-04   Glycine max [soybeans]
ref|XP_010435634.1|  PREDICTED: proline-rich receptor-like protei...  48.1    0.001   Camelina sativa [gold-of-pleasure]



>ref|XP_008393001.1| PREDICTED: putative uncharacterized protein DDB_G0291608 [Malus 
domestica]
Length=525

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 95/158 (60%), Gaps = 14/158 (9%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFED-----HSFRFLeadtdddeeeaVDQFRLHRNRHYGAPLT  215
            MKTTEFMDKQ+MELS S  +D     +  +F   D DDD+  +  QFR  R      P  
Sbjct  1    MKTTEFMDKQIMELSRSHSDDFYQLSYPQQFDNDDKDDDDFVSSFQFRPGRRVVSQEPRI  60

Query  216  SS----SSLDQI-----GSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQL  368
            S+    SS+D++     GS      S + ++++ ++R M E    LL  +E LS R+SQL
Sbjct  61   SALERGSSVDRLNLAKXGSKXVDRASEDXALISVIERKMDEHFGNLLHGVEGLSARISQL  120

Query  369  ESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            E+++  LENS+ DLK S E +HGK DGKLRQLEN+LRE
Sbjct  121  ETRLRRLENSVGDLKDSTEINHGKADGKLRQLENMLRE  158



>ref|XP_002318061.2| hypothetical protein POPTR_0012s08510g [Populus trichocarpa]
 gb|EEE96281.2| hypothetical protein POPTR_0012s08510g [Populus trichocarpa]
Length=514

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 62/160 (39%), Positives = 97/160 (61%), Gaps = 17/160 (11%)
 Frame = +3

Query  42   LEAMKTTEFMDKQVMELSESQFEDHSFRFLeadtdddeeeaVDQFRLHRNRHY-------  200
            ++ M T+++MDKQ+ ELS+SQ    S  F+  D   + ++    F     R         
Sbjct  1    MKKMDTSKYMDKQITELSQSQ----SLNFMGDDDKQEVQDGDHGFEFDTVRSLSQSHDKD  56

Query  201  --GAPLTSSSSLDQIGSTKTTNK----SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLS  362
              G  LT  SS+D+I S K + +    S+N ++++E+DR MKE  + LL ++E LS R+S
Sbjct  57   LDGTSLTGWSSMDRIDSAKFSAEKVGASSNAALISEIDRKMKEHVDILLHSVECLSARVS  116

Query  363  QLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            QLESK H +E+ ++D+K  +E + GKTDGKLR+++NIL E
Sbjct  117  QLESKTHQIEDVVDDIKELLELNQGKTDGKLREMKNILVE  156



>ref|XP_011047827.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
isoform X2 [Populus euphratica]
Length=486

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 61/157 (39%), Positives = 95/157 (61%), Gaps = 17/157 (11%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSFRFLeadtdddeeeaVDQFRL---------HRNRHYG  203
            M T+++MDKQ+ ELS+SQ    S  FL  D   + ++    F           H     G
Sbjct  1    MDTSKYMDKQITELSQSQ----SLNFLGDDDKQEVKDGDHGFEFNTVCSLSQSHNKYLAG  56

Query  204  APLTSSSSLDQIGSTKTTNK----SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
              LT  SS+D+I S K + +    S+N ++++E+D+ MK   + LL ++E L+ R+SQLE
Sbjct  57   TSLTGWSSMDRIDSAKFSAEKVGASSNAALISEIDKKMKAHVDILLHSVECLNARVSQLE  116

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SK H +E+ ++D+K S+E + GKTDGKLR+++NIL E
Sbjct  117  SKTHQIEDVVDDIKESLELNQGKTDGKLREMKNILVE  153



>ref|XP_008374404.1| PREDICTED: TSC22 domain family protein 1-like [Malus domestica]
Length=529

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 91/160 (57%), Gaps = 17/160 (11%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHS-------FRFLeadtdddeeeaVDQFRLHRNRHYGAP  209
            MKTTEFMDKQ+MELS S  ED S       F   + D DDD   +  QFR  R      P
Sbjct  1    MKTTEFMDKQIMELSRSHSEDFSQLSYPQQFDNDDKDDDDDSVSSF-QFRPARRVASQEP  59

Query  210  ----LTSSSSLDQI-----GSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLS  362
                L S SS+D +     GS        + ++++ ++R M +    LL A+E LS  +S
Sbjct  60   SISALESGSSMDYLNLAKSGSKYXVQACEDSALISXIERKMNQHFGNLLHAVEGLSAXIS  119

Query  363  QLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            QLE+++  L NS++D K S E +HGK DGKLRQLEN+LRE
Sbjct  120  QLETRLRRLXNSVDDFKDSTEINHGKADGKLRQLENMLRE  159



>ref|XP_011047825.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
isoform X1 [Populus euphratica]
Length=511

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 61/157 (39%), Positives = 95/157 (61%), Gaps = 17/157 (11%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSFRFLeadtdddeeeaVDQFRL---------HRNRHYG  203
            M T+++MDKQ+ ELS+SQ    S  FL  D   + ++    F           H     G
Sbjct  1    MDTSKYMDKQITELSQSQ----SLNFLGDDDKQEVKDGDHGFEFNTVCSLSQSHNKYLAG  56

Query  204  APLTSSSSLDQIGSTKTTNK----SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
              LT  SS+D+I S K + +    S+N ++++E+D+ MK   + LL ++E L+ R+SQLE
Sbjct  57   TSLTGWSSMDRIDSAKFSAEKVGASSNAALISEIDKKMKAHVDILLHSVECLNARVSQLE  116

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SK H +E+ ++D+K S+E + GKTDGKLR+++NIL E
Sbjct  117  SKTHQIEDVVDDIKESLELNQGKTDGKLREMKNILVE  153



>ref|XP_008245310.1| PREDICTED: uncharacterized protein LOC103343434 [Prunus mume]
Length=442

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 95/158 (60%), Gaps = 13/158 (8%)
 Frame = +3

Query  48   AMKTTEFMDKQVMELSESQFEDHS---FRFLeadtdddeeeaVDQFRLHRNRHYGA----  206
            AM ++EFMDKQ+MELS S  +D S   +     D +D ++++V  F     RH  +    
Sbjct  50   AMTSSEFMDKQIMELSRSHSDDLSQLSYPRDLRDDEDKDDDSVSSFHFRPTRHVVSQQSR  109

Query  207  --PLTSSSSLDQIGSTKTTNKS----NNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQL  368
                 + SS+D I   K+  K     ++ ++++ + + M    + +L A+E LS RLSQL
Sbjct  110  VSTFENCSSMDHIDLAKSGRKYAGAFDDSALISVIGQKMSHHFDNMLHAVEGLSARLSQL  169

Query  369  ESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            E+++  LENS++DLK S E +HG+ DGKLRQLENILRE
Sbjct  170  ETRLRRLENSVDDLKDSTEINHGRNDGKLRQLENILRE  207



>ref|XP_006833453.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
 gb|ERM98731.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
Length=695

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 64/162 (40%), Positives = 93/162 (57%), Gaps = 19/162 (12%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSFRFL----eadtdddeeeaVDQFRLHRNRHYGAP---  209
            M ++ FMDKQ+M LS SQ  D  F  L    +      +E+ +  +     R   +P   
Sbjct  1    MNSSHFMDKQIMGLSGSQNSDF-FELLNPPSQEHNGSKKEDMLPSYDFQPIRPIVSPPSP  59

Query  210  -LTSSSSLDQIGSTKTTNKSN----------NMSMVAEVDRIMKELSNKLLRAIEDLSGR  356
             L SSS+  + GS +    +N          + ++V+E+DR +K+  + LL ++E +S R
Sbjct  60   ELQSSSNFRKYGSLELKEPTNASQEHERDASDAAIVSEIDRTVKKHVDNLLHSLEGVSAR  119

Query  357  LSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            LSQLES+   LENS+++LKVS+   HG TDGKLRQLENILRE
Sbjct  120  LSQLESRTRRLENSVDELKVSVGNSHGSTDGKLRQLENILRE  161



>ref|XP_007210457.1| hypothetical protein PRUPE_ppa005168m1g, partial [Prunus persica]
 gb|EMJ11656.1| hypothetical protein PRUPE_ppa005168m1g, partial [Prunus persica]
Length=271

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 94/157 (60%), Gaps = 13/157 (8%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHS---FRFLeadtdddeeeaVDQFRLHRNRHYGA-----  206
            M ++EFMDKQ+MELS S  +D S   +     D +D ++++V  F     RH  +     
Sbjct  1    MTSSEFMDKQIMELSRSHSDDLSQLSYPRDLRDDEDKDDDSVSSFHFRPTRHVVSQQSRV  60

Query  207  -PLTSSSSLDQIGSTKTTNKS----NNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
                + SS+D I   K+  K     ++ ++++ + + M    + +L A+E LS RLSQLE
Sbjct  61   STFENCSSMDHIDLAKSGCKYAGAFDDSALISVIGQKMSHHFDNMLHAVEGLSARLSQLE  120

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +++  LENS++DLK S E +HG+ DGKLRQLENILR+
Sbjct  121  TRLRRLENSVDDLKDSTEINHGRNDGKLRQLENILRQ  157



>ref|XP_007150938.1| hypothetical protein PHAVU_004G007500g [Phaseolus vulgaris]
 gb|ESW22932.1| hypothetical protein PHAVU_004G007500g [Phaseolus vulgaris]
Length=575

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 47/91 (52%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +3

Query  222  SSLDQIGSTKTT----NKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYL  389
            SSLD I   K        +++ SM+AE+DR M++    +L  +E +S RL+QLE++ H+L
Sbjct  110  SSLDSIEPAKVIVEKDRSASDASMLAEIDRTMQKHMENMLNVLEGVSARLTQLETRTHHL  169

Query  390  ENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            ENS++DLKVS+  +HG TDGKLRQLENILRE
Sbjct  170  ENSVDDLKVSVGNNHGITDGKLRQLENILRE  200



>gb|ACZ74657.1| hypothetical protein [Phaseolus vulgaris]
Length=574

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 47/91 (52%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +3

Query  222  SSLDQIGSTKTT----NKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYL  389
            SSLD I   K        +++ SM+AE+DR M++    +L  +E +S RL+QLE++ H+L
Sbjct  109  SSLDSIEPAKVIVEKDRSASDASMLAEIDRTMQKHMENMLNVLEGVSARLTQLETRTHHL  168

Query  390  ENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            ENS++DLKVS+  +HG TDGKLRQLENILRE
Sbjct  169  ENSVDDLKVSVGNNHGITDGKLRQLENILRE  199



>ref|XP_010248593.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nelumbo nucifera]
Length=554

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 62/177 (35%), Positives = 93/177 (53%), Gaps = 34/177 (19%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSFRFLeadtdd----deeeaVDQFRLHRNRHYGAPLTS  218
            M +++FMDKQVM LS SQ  D  F  L    +      +EE +  +     R  G P + 
Sbjct  1    MNSSQFMDKQVMGLSGSQNNDF-FDLLNPHEEQGGGAKKEEILPSYDFQPIRPTGLPQSP  59

Query  219  SSSLDQIGSTKTTN-----------------------------KSNNMSMVAEVDRIMKE  311
            +     +G T+  N                             K+ + + V+E+DR +K+
Sbjct  60   NHEGSNVGGTRVWNSADSKATASSQIRNYGSLDSMKISPEEDRKAYDAATVSEIDRTVKK  119

Query  312  LSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             ++ LL A+E +S RL+QLES+  +LE+S++DLK+S+  +HG TDGKLRQLEN LRE
Sbjct  120  YADNLLHALEGVSARLTQLESRTRHLESSVDDLKLSVGNNHGSTDGKLRQLENSLRE  176



>ref|XP_010663115.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 isoform 
X1 [Vitis vinifera]
Length=524

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 56/148 (38%), Positives = 89/148 (60%), Gaps = 8/148 (5%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSFRFLeadtdddeeeaVDQFRLHRNRHYGAPLTSSSSL  230
            M  ++FMDKQ+ ELS S   D  +     + +D+E+           R    PL +SSS+
Sbjct  1    MNPSKFMDKQITELSPSTIHDFPYVSDLHEEEDEEDHLFPSSNFLPIR----PLPNSSSM  56

Query  231  DQIGSTKTTNK----SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENS  398
            D+  S K  ++    S + ++++ VD+ MKE ++  L  ++ L  RLSQLES+   +E+ 
Sbjct  57   DRFDSAKAAHEKVGTSYDGALISVVDKKMKEHTDTFLHVVDALITRLSQLESRTRNIESY  116

Query  399  MNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +++LK S EY+HG+T+GKL+QLEN LRE
Sbjct  117  VDELKASTEYNHGRTNGKLKQLENTLRE  144



>ref|XP_004298978.1| PREDICTED: uncharacterized protein LOC101312152 [Fragaria vesca 
subsp. vesca]
Length=522

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 90/148 (61%), Gaps = 8/148 (5%)
 Frame = +3

Query  57   TTEFMDKQVMELSESQFEDHSFRFLeadtdddeeeaVDQF--RLH-RNRHYGAPLTS-SS  224
            T+EFMDKQ+MELS S  +D  F  L         +  D     +H R   +G P  S +S
Sbjct  4    TSEFMDKQIMELSRSYSDD--FSQLTYPPHQLGNDNDDDLLSSVHFRPVRHGVPQQSRAS  61

Query  225  SLDQIGSTKTTNK--SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENS  398
            +L+  GS     +  S + +++A +D  M +    LL A+E LS R+SQLE+++  +ENS
Sbjct  62   TLENRGSMDQIEREQSRDSALIAVIDGKMNQHFGNLLHAVEGLSARVSQLETRLRLVENS  121

Query  399  MNDLKVSIEYDHGKTDGKLRQLENILRE  482
            ++DLK   +Y++GKTDGKLR++ENILR+
Sbjct  122  VDDLKDCTDYNYGKTDGKLREVENILRK  149



>ref|XP_011097415.1| PREDICTED: protein enabled-like [Sesamum indicum]
Length=543

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 71/102 (70%), Gaps = 8/102 (8%)
 Frame = +3

Query  201  GAPLTSSSSLDQ-------IG-STKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGR  356
             +P+ + +SLD        +G S K  N S ++S+V+E+DR MK+ ++ L+  ++ +S R
Sbjct  95   ASPIRNYTSLDAGEPAKFILGKSHKPVNASLDVSLVSEIDRTMKKYADNLMHTLDGVSAR  154

Query  357  LSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            LSQLE++   LENSM+DLK SI+ + G TDGK+RQLE+ILRE
Sbjct  155  LSQLETRSRNLENSMDDLKESIDNNQGSTDGKIRQLEDILRE  196



>emb|CAN60421.1| hypothetical protein VITISV_021069 [Vitis vinifera]
Length=604

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = +3

Query  192  RHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            R+YG+    S+ L +I   K  N   + ++V+E+DR MK+ ++ LL  +E LS RL+QLE
Sbjct  84   RNYGS--LDSNELSKISLEKDRNI--DAAIVSEIDRTMKKXADNLLHXLEGLSARLTQLE  139

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            S+   LENS++DLKVS+  +HG  DGK+RQLENILRE
Sbjct  140  SRTRNLENSVDDLKVSVGNNHGSADGKMRQLENILRE  176



>ref|XP_003525675.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Glycine max]
Length=573

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +3

Query  222  SSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYL  389
            SSLD +   K   + +    + +M++E+DR MK+    +L  +E +S RL+QLE++ H+L
Sbjct  114  SSLDSMEPAKVIVEKDRSAFDATMLSEIDRTMKKHMENMLHVLEGVSARLTQLETRTHHL  173

Query  390  ENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            ENS++DLKVS+  +HG TDGKLRQLENILRE
Sbjct  174  ENSVDDLKVSVGNNHGSTDGKLRQLENILRE  204



>ref|XP_010033310.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Eucalyptus grandis]
 gb|KCW52919.1| hypothetical protein EUGRSUZ_J02234 [Eucalyptus grandis]
Length=576

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/98 (48%), Positives = 69/98 (70%), Gaps = 4/98 (4%)
 Frame = +3

Query  201  GAPLTSSSSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQL  368
             AP+ + SSLD     K   + +    + SMV+E+DR MK+ ++ LL  +E +S RL+QL
Sbjct  118  AAPVRNYSSLDSFEPAKIIAEKDQHAFDASMVSEIDRTMKKHADSLLHVLEGVSARLTQL  177

Query  369  ESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            ES+   LENS++DLKVS++ ++G TDGK+RQLENILR+
Sbjct  178  ESRTRNLENSVDDLKVSVDNNYGTTDGKMRQLENILRD  215



>gb|KHN27460.1| hypothetical protein glysoja_022169 [Glycine soja]
Length=573

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +3

Query  222  SSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYL  389
            SSLD +   K   + +    + +M++E+DR MK+    +L  +E +S RL+QLE++ H+L
Sbjct  114  SSLDSMEPAKVIVEKDRSAFDATMLSEIDRTMKKHMENMLHVLEGVSARLTQLETRTHHL  173

Query  390  ENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            ENS++DLKVS+  +HG TDGKLRQLENILRE
Sbjct  174  ENSVDDLKVSVGNNHGSTDGKLRQLENILRE  204



>ref|XP_002275607.1| PREDICTED: protein enabled [Vitis vinifera]
Length=563

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = +3

Query  192  RHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            R+YG+    S+ L +I   K  N   + ++V+E+DR MK+ ++ LL  +E LS RL+QLE
Sbjct  95   RNYGS--LDSNELSKISLEKDRNI--DAAIVSEIDRTMKKHADNLLHVLEGLSARLTQLE  150

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            S+   LENS++DLKVS+  +HG  DGK+RQLENILRE
Sbjct  151  SRTRNLENSVDDLKVSVGNNHGSADGKMRQLENILRE  187



>emb|CBI34879.3| unnamed protein product [Vitis vinifera]
Length=465

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 96/189 (51%), Gaps = 47/189 (25%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSE-----------SQFEDH-SFRFLeadtdddeeeaVDQFRLHRNR  194
            M T++FMDKQ+M+LS            S  +DH +           +EE V  +     R
Sbjct  1    MNTSQFMDKQIMDLSAGSQSNDFINLMSPEDDHLTGVGGGGGVGSKKEEIVPSYDFLPIR  60

Query  195  HYGAPLTSSSSLDQIGS-------TKTTNKSN--------------------------NM  275
              G+  +  S+LD +G        + T +K+N                          + 
Sbjct  61   PKGS--SQFSNLDAVGGAGGPRAWSSTDSKTNTPGIRNYGSLDSNELSKISLEKDRNIDA  118

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++V+E+DR MK+ ++ LL  +E LS RL+QLES+   LENS++DLKVS+  +HG  DGK+
Sbjct  119  AIVSEIDRTMKKHADNLLHVLEGLSARLTQLESRTRNLENSVDDLKVSVGNNHGSADGKM  178

Query  456  RQLENILRE  482
            RQLENILRE
Sbjct  179  RQLENILRE  187



>ref|XP_008795992.1| PREDICTED: protein transport protein SEC31-like [Phoenix dactylifera]
Length=553

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 62/179 (35%), Positives = 94/179 (53%), Gaps = 35/179 (20%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHS--FRFLeadtdddeeeaVDQ------FRLHRNRHYGA  206
            MKT+EFMDKQ++ LS SQ       F  ++   +       D+      F+  R      
Sbjct  1    MKTSEFMDKQILGLSGSQKGGGGELFDLMKPQEEHPINGKKDEILPSYDFQPIRTLGSSP  60

Query  207  PLTSSSSLDQ--IGSTKTTNKSNNM-------------------------SMVAEVDRIM  305
            P  S++ L +  +GS  +   S+N+                         + VAEVDR +
Sbjct  61   PTASAAPLSKPFLGSVDSKMASSNLKNAGILDPYELIKASHEKEKSAYDAATVAEVDRTV  120

Query  306  KELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            K+ ++ LL A+E +S RL++LE++ H LE+S++ LKV I  ++G TDGKL+QLENILRE
Sbjct  121  KKYADNLLHALEGVSSRLTELENRTHQLESSVDGLKVMIGNNNGTTDGKLKQLENILRE  179



>emb|CDP02078.1| unnamed protein product [Coffea canephora]
Length=551

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 94/182 (52%), Gaps = 39/182 (21%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQF--------------EDH---------------SFRFLeadt  143
            M T++FMDKQ+M+LS SQ               EDH                F+ L    
Sbjct  1    MNTSQFMDKQIMDLSNSQSLNSHNDFIDLINPREDHRIGNSDKKEEILPSYDFQPLRPIG  60

Query  144  dddeeeaVDQFRLHRNR-----HYGAPLTSSSSLDQIGSTKTT-NKSNNM---SMVAEVD  296
             + +   +D      N      H G  + + SS D     +    K  N+    +V+E+D
Sbjct  61   TEIDSGNLDAPPRAWNSADNKTHTGG-IRTYSSFDSFEPGRVILEKDQNVVDPKLVSEID  119

Query  297  RIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENIL  476
            R MK+ ++ L+  ++ +S RL+QLES+  +LENS+++LKVS+  +HG +DG++RQLENIL
Sbjct  120  RTMKKYADNLMHGLDSVSARLTQLESRTRHLENSLDELKVSVGTNHGSSDGRMRQLENIL  179

Query  477  RE  482
            RE
Sbjct  180  RE  181



>ref|XP_008801947.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Phoenix 
dactylifera]
Length=539

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            +++ VAE+DR +K+ ++ LL A+E +S RLSQLES+  YLE+S+++LKVS+  +HG TDG
Sbjct  104  DVAAVAEIDRTVKKYADNLLHALEGVSSRLSQLESRTRYLESSVDELKVSVGNNHGSTDG  163

Query  450  KLRQLENILRE  482
            KLRQLENILRE
Sbjct  164  KLRQLENILRE  174



>ref|XP_010108811.1| hypothetical protein L484_020546 [Morus notabilis]
 gb|EXC20326.1| hypothetical protein L484_020546 [Morus notabilis]
Length=591

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 69/99 (70%), Gaps = 5/99 (5%)
 Frame = +3

Query  201  GAPLTSSSSLDQIGSTK-----TTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQ  365
            G+P  + SSLD +   K       +  ++ +++AE+D+ MK+ ++ LL  ++ +S RL+Q
Sbjct  103  GSPFRNYSSLDSVEPAKFILEKDQSSFDSSTIMAEIDKTMKKHADNLLHVLDGVSARLTQ  162

Query  366  LESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            LES+   LENS++DLKVS+  +HG TDGK+RQLENILRE
Sbjct  163  LESRTRNLENSVDDLKVSVGNNHGSTDGKMRQLENILRE  201



>ref|XP_011464066.1| PREDICTED: formin-like protein 3 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=550

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  NRHYGAPLTSSSSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGR  356
            N +  AP+ +  S+D +   K   + +    + ++++E+D+ MK+ ++ LL+ +E +S R
Sbjct  78   NSNTNAPVRNYGSVDSLKPAKDIVEKDRNAPDATVISEIDQTMKKYADNLLQVMEGISAR  137

Query  357  LSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            L+QLES+  +LENS++DLKVS+  +HG  DGK+RQLENILR+
Sbjct  138  LTQLESRTCHLENSVDDLKVSVGNNHGNADGKMRQLENILRD  179



>ref|XP_004299014.1| PREDICTED: formin-like protein 3 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=561

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 59/190 (31%), Positives = 93/190 (49%), Gaps = 46/190 (24%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSE---------------SQFEDH----------------SFRFLea  137
            M TT FMDKQ+M+LS                SQ E+H                ++ F   
Sbjct  1    MNTTSFMDKQIMDLSHGSSQNNNDFLDLMNNSQEEEHQVGRGNGLTKKEEILPNYDFHPI  60

Query  138  dtdddeeeaVDQF-----------RLHRNRHYGAPLTSSSSLDQIGSTKTTNKSN----N  272
                        F               N +  AP+ +  S+D +   K   + +    +
Sbjct  61   RPITGVSSHSQNFDATPNLGGGGVSTMSNSNTNAPVRNYGSVDSLKPAKDIVEKDRNAPD  120

Query  273  MSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGK  452
             ++++E+D+ MK+ ++ LL+ +E +S RL+QLES+  +LENS++DLKVS+  +HG  DGK
Sbjct  121  ATVISEIDQTMKKYADNLLQVMEGISARLTQLESRTCHLENSVDDLKVSVGNNHGNADGK  180

Query  453  LRQLENILRE  482
            +RQLENILR+
Sbjct  181  MRQLENILRD  190



>ref|NP_001042136.2| Os01g0169900 [Oryza sativa Japonica Group]
 dbj|BAD68319.1| vegetative cell wall protein gp1 -like [Oryza sativa Japonica 
Group]
 gb|EAY72703.1| hypothetical protein OsI_00570 [Oryza sativa Indica Group]
 gb|EAZ10703.1| hypothetical protein OsJ_00537 [Oryza sativa Japonica Group]
 dbj|BAH00414.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04050.2| Os01g0169900 [Oryza sativa Japonica Group]
Length=580

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ S+ LL A+E +S RLSQLE + H+LENS++DLK++I   +G TDGKLRQ
Sbjct  134  MADIDRTMKKYSDNLLHALEGVSSRLSQLEGRTHHLENSVDDLKITIGNYNGSTDGKLRQ  193

Query  462  LENILRE  482
            LEN+LRE
Sbjct  194  LENMLRE  200



>ref|XP_007222918.1| hypothetical protein PRUPE_ppa003684mg [Prunus persica]
 gb|EMJ24117.1| hypothetical protein PRUPE_ppa003684mg [Prunus persica]
Length=556

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = +3

Query  204  APLTSSSSLDQIGSTKTT-NKSNNM---SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            +P+ +  SLD I  ++    K  N+   ++V+E+DR MK+  N LL  +E +S +L+QLE
Sbjct  99   SPIRNYGSLDSIKPSELILEKDQNVPDATIVSEIDRTMKKHVNSLLHVLEGVSEKLTQLE  158

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            S+  +LENS+ DLK+S+  +HG TDGK+RQLEN+LR+
Sbjct  159  SRTCHLENSVEDLKISVGNNHGNTDGKMRQLENVLRD  195



>ref|XP_008230557.1| PREDICTED: protein transport protein SEC31 [Prunus mume]
Length=581

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 68/97 (70%), Gaps = 4/97 (4%)
 Frame = +3

Query  204  APLTSSSSLDQIGSTKTT-NKSNNM---SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            AP+ +  SLD I   K    K  N+   ++V+E+D+ MK+ ++ LL  +E +S RL+QLE
Sbjct  108  APIRNYGSLDSIEPAKVILQKDRNVLDATVVSEIDQAMKKHADNLLHVLEGVSARLTQLE  167

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            S+  +LENS++DLKVS+  +HG  DGK+R+LE+ILR+
Sbjct  168  SRTRHLENSVDDLKVSVGNNHGNADGKMRRLEDILRD  204



>ref|XP_006603779.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
isoform X2 [Glycine max]
Length=466

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            + +M++E+DR +K+    +L  +E +S RL+QLE++ H+LENS++DLKVS+   HG TDG
Sbjct  27   DATMLSEIDRTVKKHMENMLHVLEGVSARLTQLETRTHHLENSVDDLKVSVGNSHGSTDG  86

Query  450  KLRQLENILRE  482
            KLRQ+EN LRE
Sbjct  87   KLRQMENSLRE  97



>ref|XP_009334114.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Pyrus 
x bretschneideri]
Length=583

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +3

Query  201  GAPLTSSSSLDQIGSTKTT-NKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESK  377
             +P+ +  S+D +   K    K +N ++V+E+D+ MK+ ++ LL  +E +S RL+QLES+
Sbjct  118  ASPIRNYGSMDSLEPGKLILEKEHNAAIVSEIDQTMKKHTDNLLHVLEGVSARLTQLESR  177

Query  378  MHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
               LENS++DLK+S+  +HG  DGK+RQLE ILR+
Sbjct  178  TRNLENSVDDLKISVGNNHGNADGKMRQLEGILRD  212



>ref|XP_010906083.1| PREDICTED: protein transport protein SEC31 [Elaeis guineensis]
Length=541

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 60/174 (34%), Positives = 87/174 (50%), Gaps = 30/174 (17%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSFRFLeadtdddeeeaV-------DQFRLHRNRHYGAP  209
            MK++ FMDKQV  +SE       F  ++A  +      V         +     R  G+ 
Sbjct  1    MKSSHFMDKQVTGMSEKSQGGDLFDLMDAQEEPRNNGGVIKKEEILPSYDFQPIRTVGSW  60

Query  210  LTSSSSLDQIGSTKTTNKS-----------------------NNMSMVAEVDRIMKELSN  320
               ++ LD   S K  + S                        +++ VAE+D I+K+ ++
Sbjct  61   PPMNAGLDAADSKKIGSSSLRYSGILEPHETAKVSHDKQRDAYDVATVAEIDCIVKKYAD  120

Query  321  KLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             LL A+E +  RLSQLES+  YLE  +++LKVS+  +HG TDGKLRQLENILRE
Sbjct  121  NLLHALEGVGSRLSQLESRTRYLEGCVDELKVSVGNNHGSTDGKLRQLENILRE  174



>gb|KCW54142.1| hypothetical protein EUGRSUZ_I00119 [Eucalyptus grandis]
Length=435

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +3

Query  222  SSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYL  389
            SSLD     K   + +    + SMV+E+DR MK+ ++ LL  +E +S  L+QLES+   L
Sbjct  93   SSLDSFEPAKIIAEKDQHAFDASMVSEIDRTMKKHADSLLHVLEGVSAGLTQLESRTRNL  152

Query  390  ENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            ENS++DLKVS++ ++G TDGK+RQLENILR+
Sbjct  153  ENSVDDLKVSVDNNYGTTDGKMRQLENILRD  183



>ref|XP_003554822.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
isoform X1 [Glycine max]
 gb|KHN19672.1| hypothetical protein glysoja_037174 [Glycine soja]
Length=578

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 42/95 (44%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = +3

Query  210  LTSSSSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESK  377
            L + +SLD +   K   + +    + +M++E+DR +K+    +L  +E +S RL+QLE++
Sbjct  115  LKNYNSLDSMEPAKVIVEKDQSAFDATMLSEIDRTVKKHMENMLHVLEGVSARLTQLETR  174

Query  378  MHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             H+LENS++DLKVS+   HG TDGKLRQ+EN LRE
Sbjct  175  THHLENSVDDLKVSVGNSHGSTDGKLRQMENSLRE  209



>ref|XP_010551915.1| PREDICTED: actin cytoskeleton-regulatory complex protein PAN1 
[Tarenaya hassleriana]
Length=550

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  264  SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKT  443
            + N S+++E+DR MK+ ++ LL A+E LS RL+QLE++   LEN ++DLKVS+   HG T
Sbjct  127  APNTSILSEIDRTMKKHADNLLHAMEGLSARLTQLETRTRNLENLVDDLKVSVGNSHGST  186

Query  444  DGKLRQLENILRE  482
            DGK+RQLENIL E
Sbjct  187  DGKMRQLENILLE  199



>ref|XP_010694912.1| PREDICTED: putative uncharacterized protein FLJ22184 [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 68/96 (71%), Gaps = 7/96 (7%)
 Frame = +3

Query  216  SSSSLDQIGSTK-------TTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLES  374
            S SSLD +   +        + K+N+ ++++E+D+ MK  ++ +L AI+ LS RLSQLE+
Sbjct  104  SYSSLDHVDHVEPDKIILEKSQKANDSAIISEIDQTMKRHTDSVLHAIDGLSARLSQLEN  163

Query  375  KMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +  +LE+S+++LK+SI  +HG TDGK+RQLENIL E
Sbjct  164  RTRHLEHSVDELKLSIGNNHGSTDGKMRQLENILLE  199



>gb|AAF01541.1|AC009325_11 unknown protein [Arabidopsis thaliana]
Length=493

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 88/179 (49%), Gaps = 35/179 (20%)
 Frame = +3

Query  51   MKTTEFMDKQVME---------------LSESQFEDHSFRFLeadtd--ddeeeaVDQFR  179
            M T +FMDKQ+M+               ++    +DH  + +  D      +E  V  + 
Sbjct  1    MNTCQFMDKQIMDLSSSSSLPSTDFIDLMNNHDGDDHQKKQVIGDNGLDSKKEVIVPSYD  60

Query  180  LHRNRHYGAPLTSSSSLDQIGST------------------KTTNKSNNMSMVAEVDRIM  305
             H  R   A   S S+LD  GST                  K  N  N   M   +DR M
Sbjct  61   FHPIRPTTAARLSHSALDLAGSTTRNFGSLDSIEPSKLVPDKGQNVFNTTIMSEIIDRTM  120

Query  306  KELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            K+ ++ LL  +E +S RLSQLE++ H LEN ++DLKVS++  HG TDGK+RQL+NIL E
Sbjct  121  KKHTDTLLHVMEGVSARLSQLETRTHNLENLVDDLKVSVDNSHGSTDGKMRQLKNILVE  179



>ref|XP_008784980.1| PREDICTED: uncharacterized protein LOC103703781 [Phoenix dactylifera]
Length=875

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 94/180 (52%), Gaps = 37/180 (21%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSFRFLeadtd-------ddeeeaVDQFRLHRNRHYGA-  206
            M T+ FMDKQ++ LS SQ +  S   L+             +EE +  +  H  R  G+ 
Sbjct  1    MNTSRFMDKQILGLSGSQ-QGGSGELLDLMNPEEEHQINGKKEETLPSYDFHPMRTLGSS  59

Query  207  -PLTSSSSLDQ--IGSTKTTNKSNNM-------------------------SMVAEVDRI  302
             P  S++ L +   G+  +   S+N+                         + VAE+DR 
Sbjct  60   PPTASTAPLPRPSWGAVDSKMASSNLKNAGILEPHELTKVSHEKEKSAYDAATVAEIDRT  119

Query  303  MKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +K+ ++ LLR +E +S RL QLES+ H+LE+S+++LKV+I    G TDGKLRQLENIL E
Sbjct  120  VKKYADNLLRTLEGVSSRLMQLESRTHHLESSVDELKVTIGNSSGTTDGKLRQLENILTE  179



>ref|XP_009595507.1| PREDICTED: uncharacterized protein LOC104091790 isoform X2 [Nicotiana 
tomentosiformis]
Length=101

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  225  SLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLE  392
            SLD +   K     N    + S++ E+D  +K+ ++ LL AIE +S RLSQ+E++ H +E
Sbjct  6    SLDSLAPAKLIVDKNLSTVDSSLLFEIDHTVKKYADSLLFAIESVSARLSQIETRSHQIE  65

Query  393  NSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             S++DLK+S++ +HG TDGKLR +ENI RE
Sbjct  66   ASLDDLKLSVDTNHGSTDGKLRLVENIFRE  95



>ref|XP_010037529.1| PREDICTED: vegetative cell wall protein gp1-like [Eucalyptus 
grandis]
 gb|KCW49241.1| hypothetical protein EUGRSUZ_K02812 [Eucalyptus grandis]
Length=553

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N ++++ ++R M E ++ +L A+E +S RLSQLE++   LEN+++D+K S+EY+HGKTDG
Sbjct  67   NETLISLIERKMTEHNDTVLHAVEGVSARLSQLETRTRRLENAVDDMKESLEYNHGKTDG  126

Query  450  KLRQLENILRE  482
            KLR+LEN+LRE
Sbjct  127  KLRELENLLRE  137



>ref|XP_010102503.1| hypothetical protein L484_014559 [Morus notabilis]
 gb|EXB93567.1| hypothetical protein L484_014559 [Morus notabilis]
Length=613

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 97/173 (56%), Gaps = 21/173 (12%)
 Frame = +3

Query  27   TRRYYLE-AMKTTEFMDKQVMELSESQ---FEDHSFRF---------LeadtdddeeeaV  167
             R+Y L  AMK+++FMDK++ ELS S    F D S+           L      D+  + 
Sbjct  79   ARKYSLHFAMKSSDFMDKRISELSRSHSDDFSDLSYSRGREPEEDDDLSYGLTKDDLSST  138

Query  168  DQFRLHRN----RHYGAPLTSSSSLDQIGSTKTTNK----SNNMSMVAEVDRIMKELSNK  323
              FR  R       Y +P  + +S+D I   K+ +K    S++  +++ +DR M+E S  
Sbjct  139  FHFRPVRPVVSPDSYDSPFQNRASMDYIDPPKSDSKNVGASSDRGLISMIDRKMEEHSKN  198

Query  324  LLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            LL  +E L+ R+ QLES+   +E+S+++LK S E++HG T+GKL QLENIL E
Sbjct  199  LLHVMEGLNVRMCQLESRTRKIEDSVDELKDSSEFNHGWTEGKLTQLENILTE  251



>ref|XP_004232320.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Solanum lycopersicum]
Length=545

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 46/101 (46%), Positives = 68/101 (67%), Gaps = 11/101 (11%)
 Frame = +3

Query  192  RHYGAPLTSSSSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
            R+YG       SLD IG TK   + +      S ++E+D  +K+ ++ LL A+E +S RL
Sbjct  94   RNYG-------SLDTIGPTKVILEKDLGSVYSSQLSEIDHTVKKYADNLLHAVEGVSARL  146

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE++   ++NS+++LK+S+  +HG TDGKLRQLENILRE
Sbjct  147  SQLETRNRQIDNSIDELKLSVGNNHGVTDGKLRQLENILRE  187



>ref|XP_008365379.1| PREDICTED: protein enabled-like [Malus domestica]
Length=583

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  201  GAPLTSSSSLDQIGSTKTT-NKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESK  377
             +P+ +  S+D +   K    K  N ++V+E+D+ MK+ ++ LL  +E +S RL+QLES+
Sbjct  118  ASPIRNYGSMDSLEPGKLILEKDRNAAIVSEIDQTMKKHADNLLHMLEGVSARLTQLESR  177

Query  378  MHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
               LENS++DLK+S+  +HG TDG +RQLE ILR+
Sbjct  178  TRNLENSVDDLKISVGNNHGNTDGTMRQLEGILRD  212



>ref|XP_008379205.1| PREDICTED: protein enabled [Malus domestica]
Length=583

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  201  GAPLTSSSSLDQIGSTKTT-NKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESK  377
             +P+ +  S+D +   K    K  N ++V+E+D+ MK+ ++ LL  +E +S RL+QLES+
Sbjct  118  ASPIRNYGSMDSLEPGKLILEKDRNAAIVSEIDQTMKKHADNLLHMLEGVSARLTQLESR  177

Query  378  MHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
               LENS++DLK+S+  +HG TDG +RQLE ILR+
Sbjct  178  TRNLENSVDDLKISVGNNHGNTDGTMRQLEGILRD  212



>ref|XP_006643803.1| PREDICTED: vegetative cell wall protein gp1-like [Oryza brachyantha]
Length=573

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ S+ LL A+E +S RLSQLE + H+LENS+++LK++I   +G TDGKLRQ
Sbjct  132  MADIDRTMKKYSDNLLHALEGVSSRLSQLEGQTHHLENSVDELKLTIGNYNGSTDGKLRQ  191

Query  462  LENILRE  482
            LEN+LRE
Sbjct  192  LENMLRE  198



>ref|XP_009595505.1| PREDICTED: uncharacterized protein LOC104091790 isoform X1 [Nicotiana 
tomentosiformis]
Length=113

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  225  SLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLE  392
            SLD +   K     N    + S++ E+D  +K+ ++ LL AIE +S RLSQ+E++ H +E
Sbjct  6    SLDSLAPAKLIVDKNLSTVDSSLLFEIDHTVKKYADSLLFAIESVSARLSQIETRSHQIE  65

Query  393  NSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             S++DLK+S++ +HG TDGKLR +ENI RE
Sbjct  66   ASLDDLKLSVDTNHGSTDGKLRLVENIFRE  95



>ref|XP_007031556.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
 gb|EOY02482.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
Length=541

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            S+VAE+DR MK+ ++ L+  +E +S RL+QLES+   LENS++DLKVS+  +HG T+GK+
Sbjct  115  SIVAEIDRTMKKHTDNLIHMLEVVSARLTQLESRTRNLENSVDDLKVSVGNNHGSTEGKM  174

Query  456  RQLENILRE  482
            RQLENIL E
Sbjct  175  RQLENILNE  183



>ref|XP_006341319.1| PREDICTED: trithorax group protein osa-like [Solanum tuberosum]
Length=526

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 96/172 (56%), Gaps = 32/172 (19%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSES--------------------QFEDHSFRFLeadtdddeeeaVD  170
            M T+++MDKQ+M+LS S                    + E+H  R +E+  + +    +D
Sbjct  1    MNTSQYMDKQIMDLSSSLSNNDFINLHDDQHHITGGVKGENHPVRPIESFPNYN----ID  56

Query  171  QFRLHRNRHYGAPLTSS----SSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKL  326
              ++   R + +  T +    SS D I   K   + +    + S+++E+D  +K+ ++ L
Sbjct  57   WIQVDGARAWNSADTKTNTNYSSADSIEPAKLIVEKDLSTIDASLLSEIDHTVKKYADNL  116

Query  327  LRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            L AIE +S RLSQLE++ H +E  + +LK+S++ +HG TDGKLR +ENILRE
Sbjct  117  LHAIESVSARLSQLETRSHQIEAFVVELKLSVDNNHGNTDGKLRLVENILRE  168



>gb|KDO69523.1| hypothetical protein CISIN_1g009789mg [Citrus sinensis]
Length=521

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            +++E+D+ +KE    +L  +  LS R++QLES+M  +ENS++DLKV+IEY++GKTDGKLR
Sbjct  68   LISEIDQKIKEHVGSVLHEVSGLSARVTQLESRMRRVENSVDDLKVAIEYNYGKTDGKLR  127

Query  459  QLENILRE  482
            +L+NI+RE
Sbjct  128  ELDNIMRE  135



>ref|XP_006439889.1| hypothetical protein CICLE_v10019708mg [Citrus clementina]
 gb|ESR53129.1| hypothetical protein CICLE_v10019708mg [Citrus clementina]
Length=525

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            +++E+D+ +KE    +L  +  LS R++QLES+M  +ENS++DLKV+IEY++GKTDGKLR
Sbjct  72   LISEIDQKIKEHVGSVLHEVSGLSARVTQLESRMRRVENSVDDLKVAIEYNYGKTDGKLR  131

Query  459  QLENILRE  482
            +L+NI+RE
Sbjct  132  ELDNIMRE  139



>gb|KDO69524.1| hypothetical protein CISIN_1g009789mg [Citrus sinensis]
Length=525

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            +++E+D+ +KE    +L  +  LS R++QLES+M  +ENS++DLKV+IEY++GKTDGKLR
Sbjct  72   LISEIDQKIKEHVGSVLHEVSGLSARVTQLESRMRRVENSVDDLKVAIEYNYGKTDGKLR  131

Query  459  QLENILRE  482
            +L+NI+RE
Sbjct  132  ELDNIMRE  139



>ref|XP_006476848.1| PREDICTED: AT-rich interactive domain-containing protein 1A-like 
[Citrus sinensis]
Length=525

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            +++E+D+ +KE    +L  +  LS R++QLES+M  +ENS++DLKV+IEY++GKTDGKLR
Sbjct  72   LISEIDQKIKEHVGSVLHEVSGLSARVTQLESRMRRVENSVDDLKVAIEYNYGKTDGKLR  131

Query  459  QLENILRE  482
            +L+NI+RE
Sbjct  132  ELDNIMRE  139



>gb|KDP45326.1| hypothetical protein JCGZ_09575 [Jatropha curcas]
Length=579

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 47/102 (46%), Positives = 67/102 (66%), Gaps = 11/102 (11%)
 Frame = +3

Query  189  NRHYGAPLTSSSSLDQIGSTKTT-NKSNNM---SMVAEVDRIMKELSNKLLRAIEDLSGR  356
            +R+YG       SLD I   K    K  N    ++V E+D+ MK+ ++ LL  +E +S R
Sbjct  109  SRNYG-------SLDSIEPAKVVVEKDQNALGAAIVMEIDKTMKKHADSLLHIMEGVSAR  161

Query  357  LSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            L+QLES+   LENS++DLK+S+  ++G TDGK+RQLENILRE
Sbjct  162  LTQLESRTRNLENSVDDLKLSVGNNNGSTDGKMRQLENILRE  203



>ref|XP_009388841.1| PREDICTED: bromodomain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=538

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 67/83 (81%), Gaps = 4/83 (5%)
 Frame = +3

Query  246  TKTTNK----SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLK  413
            TKT+++    +++++ VAE+D  +K  ++ L+ A+E LS RLS++ES+ H++ENS+++LK
Sbjct  115  TKTSHEKEKSAHDIAFVAEIDHTVKRYADNLMNALEGLSSRLSKIESRTHHMENSVDELK  174

Query  414  VSIEYDHGKTDGKLRQLENILRE  482
            V+IE ++G T+GKL+Q+EN+L+E
Sbjct  175  VAIENNNGSTNGKLKQIENVLKE  197



>ref|XP_006408524.1| hypothetical protein EUTSA_v10020517mg [Eutrema salsugineum]
 gb|ESQ49977.1| hypothetical protein EUTSA_v10020517mg [Eutrema salsugineum]
Length=519

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 66/102 (65%), Gaps = 11/102 (11%)
 Frame = +3

Query  189  NRHYGAPLTSSSSLDQIGSTKTTN-KSNNMS---MVAEVDRIMKELSNKLLRAIEDLSGR  356
            NR +G       SLD I      + K  N+S   +++++DR MK+  + LL  +E +S R
Sbjct  106  NRGFG-------SLDSIEPANLVHEKGQNLSDTTILSDIDRTMKKHVDTLLHVMEGVSAR  158

Query  357  LSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            L+QLE++ H LEN ++DLKVS+E  HG TDGK+RQLENIL E
Sbjct  159  LTQLETRTHNLENLVDDLKVSVENSHGSTDGKMRQLENILAE  200



>ref|XP_010940140.1| PREDICTED: protein diaphanous homolog 1-like [Elaeis guineensis]
Length=549

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 59/178 (33%), Positives = 91/178 (51%), Gaps = 34/178 (19%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSF-RFLeadtdddeeeaVDQ------FRLHRNRHYGAP  209
            M T++FMDKQ++ LS SQ         L+   +       D+      F+    R    P
Sbjct  1    MNTSQFMDKQILGLSGSQKGGGELLDLLKPQEEHPINGKKDEILPSYDFQPILTRGSSPP  60

Query  210  LTSSSSLDQ--IGSTKTTNKSNNM-------------------------SMVAEVDRIMK  308
              S+  L +  +G+  +   S+N+                         + VAEVDR +K
Sbjct  61   TASAHPLSKPFLGAVDSKMASSNLKNAGILEPYELAKASHEKEKSAYDAATVAEVDRTVK  120

Query  309  ELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            + ++ LL A+E +S RL++LES+ H LE+S++ LK+ I  ++G TDGKLRQLEN+LRE
Sbjct  121  KYADNLLHALEGVSSRLTELESRAHQLESSVDGLKMMIGNNNGTTDGKLRQLENVLRE  178



>gb|EMS67668.1| hypothetical protein TRIUR3_30524 [Triticum urartu]
Length=566

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ S+ LL A+E +S RLSQLE + H+LE+S++D K++I   +G TDGKLRQ
Sbjct  101  IADIDRTMKKYSDNLLYALEGVSSRLSQLEGRTHHLESSVDDFKLTIGNFNGSTDGKLRQ  160

Query  462  LENILRE  482
            LEN+LRE
Sbjct  161  LENMLRE  167



>ref|XP_007217219.1| hypothetical protein PRUPE_ppa003425mg [Prunus persica]
 gb|EMJ18418.1| hypothetical protein PRUPE_ppa003425mg [Prunus persica]
Length=575

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 67/97 (69%), Gaps = 4/97 (4%)
 Frame = +3

Query  204  APLTSSSSLDQIGSTKTT-NKSNNM---SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            AP+ +  SLD I   K    K  N+   ++V+E+D+ MK+ ++ LL  +E +S RL+QLE
Sbjct  108  APIRNYGSLDSIEPAKVILQKDRNVLDATVVSEIDQAMKKHADNLLHVLEGVSARLTQLE  167

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            S+  +LENS++DLKVS+  +HG  DGK+ +LE+ILR+
Sbjct  168  SRTRHLENSVDDLKVSVGNNHGNADGKMIRLEDILRD  204



>gb|EYU44780.1| hypothetical protein MIMGU_mgv1a004985mg [Erythranthe guttata]
Length=501

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +3

Query  249  KTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEY  428
            K +N S + S+V+E+D+ MK+  + L  A++++S RLSQLE++   LE+S++DLKVS+  
Sbjct  65   KPSNASLDASLVSEIDKTMKKYMDNLTHAVDNMSARLSQLETRTRNLEHSIDDLKVSVGN  124

Query  429  DHGKTDGKLRQLENILRE  482
            +HG TDGK+R LENIL E
Sbjct  125  NHGITDGKMRLLENILNE  142



>ref|NP_186805.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE73688.1| uncharacterized protein AT3G01560 [Arabidopsis thaliana]
Length=511

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +3

Query  204  APLTSSSSLDQIGSTK-TTNKSNNM---SMVAEV-DRIMKELSNKLLRAIEDLSGRLSQL  368
            +P T+  SLD I  +K   +K  N+   ++++E+ DR MK+ ++ LL  +E +S RLSQL
Sbjct  100  SPNTNFGSLDSIEPSKLVPDKGQNVFNTTIMSEIIDRTMKKHTDTLLHVMEGVSARLSQL  159

Query  369  ESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            E++ H LEN ++DLKVS++  HG TDGK+RQL+NIL E
Sbjct  160  ETRTHNLENLVDDLKVSVDNSHGSTDGKMRQLKNILVE  197



>ref|XP_002440684.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
 gb|EES19114.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
Length=582

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ ++ LL A+E +S RLSQLE + ++LENS+ +LK++I  ++G TDGKLRQ
Sbjct  142  IADIDRTMKKYADNLLHALESVSSRLSQLEDRTYHLENSVGELKLTIGNNNGSTDGKLRQ  201

Query  462  LENILRE  482
             EN LRE
Sbjct  202  FENTLRE  208



>ref|XP_006338590.1| PREDICTED: AT-rich interactive domain-containing protein 1A-like 
[Solanum tuberosum]
Length=549

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 45/101 (45%), Positives = 67/101 (66%), Gaps = 11/101 (11%)
 Frame = +3

Query  192  RHYGAPLTSSSSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
            R+YG       SLD I  TK   + +      S+++E+D  +K+ ++ LL A+E +S RL
Sbjct  94   RNYG-------SLDSIDPTKVIVEKDLGSVYSSLLSEIDHTVKKYADNLLHAVEGVSARL  146

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE++   ++NS+++LK+S+   HG TDGKLRQLENILRE
Sbjct  147  SQLETRNRQIDNSVDELKLSVGNSHGVTDGKLRQLENILRE  187



>ref|XP_008219121.1| PREDICTED: uncharacterized protein LOC103319367 [Prunus mume]
Length=1861

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            + ++V+E+DR MK+  + LL  +E +S +L+QLES+  +LENS++DLK+S+  +HG TDG
Sbjct  125  DATIVSEIDRTMKKHVDSLLHVLEGVSEKLTQLESRTRHLENSVDDLKISVGNNHGNTDG  184

Query  450  KLRQLENILRE  482
            K+RQLEN+LR+
Sbjct  185  KMRQLENVLRD  195



>ref|XP_003568842.1| PREDICTED: zyxin-like [Brachypodium distachyon]
Length=573

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +3

Query  261  KSN-NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHG  437
            +SN N   +A++DR MK+ ++ LL A+E +S RLSQLE + H+LE+S+ +LK++I   +G
Sbjct  133  RSNFNAVTIADIDRTMKKYADNLLNALEGVSSRLSQLEGRTHHLEDSVGELKLTIGNSNG  192

Query  438  KTDGKLRQLENILRE  482
             TDGKLRQ EN LRE
Sbjct  193  STDGKLRQFENTLRE  207



>emb|CDM81418.1| unnamed protein product [Triticum aestivum]
Length=603

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ S+ LL A+E +S RLSQLE + H+LE+S+++ K++I   +G TDGKLRQ
Sbjct  138  IADIDRTMKKYSDNLLYALEGVSSRLSQLEGRTHHLESSVDEFKLTIGNYNGSTDGKLRQ  197

Query  462  LENILRE  482
            LEN+LRE
Sbjct  198  LENMLRE  204



>dbj|BAK07367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ S+ LL A+E +S RLSQLE + H+LE+S+++ K++I   +G TDGKLRQ
Sbjct  130  IADIDRTMKKYSDNLLYALEGVSSRLSQLEGRTHHLESSVDEFKLTIGNYNGSTDGKLRQ  189

Query  462  LENILRE  482
            LEN+LRE
Sbjct  190  LENMLRE  196



>gb|KEH24794.1| DNA-binding protein, putative [Medicago truncatula]
Length=565

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  225  SLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLE  392
            SLD     K T + N    + S++ E+DR MK+  + L   +E +S RL+Q+E++ H+LE
Sbjct  104  SLDSFEPAKVTVEKNQSAVDASILLEIDRTMKKHMDNLHHVLEGVSARLTQVETRTHHLE  163

Query  393  NSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +SM+DLKVS+  +HG TDGKLR LENIL E
Sbjct  164  SSMDDLKVSVGNNHGITDGKLRLLENILSE  193



>ref|XP_006297454.1| hypothetical protein CARUB_v10013474mg [Capsella rubella]
 gb|EOA30352.1| hypothetical protein CARUB_v10013474mg [Capsella rubella]
Length=514

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 65/95 (68%), Gaps = 5/95 (5%)
 Frame = +3

Query  213  TSSSSLDQIGSTK-TTNKS----NNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESK  377
            T   SLD I  +K   +K     +N ++++E+DR MK+ ++ LL  +E ++ RL+QLE++
Sbjct  134  TGFGSLDSIEPSKLVPDKGHHHMSNTTILSEIDRTMKKHTDTLLHVMEAVNARLTQLETR  193

Query  378  MHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
              YLEN ++DLKVS++  HG TDGK RQL+NIL E
Sbjct  194  TQYLENLVDDLKVSLDNTHGTTDGKFRQLKNILLE  228



>ref|XP_004489226.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Cicer arietinum]
Length=550

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 4/91 (4%)
 Frame = +3

Query  222  SSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYL  389
            SSLD     K T + +    + +++ E+DR MK   + L   +E +S RL+QLE++ H+L
Sbjct  90   SSLDSFEPAKVTVEKDRNTVDAAILLEIDRTMKRHMDNLHHVLEGVSARLTQLETRTHHL  149

Query  390  ENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            E+SM+DLKVS+  +HG TDGKLR LENIL+E
Sbjct  150  ESSMDDLKVSVGNNHGITDGKLRLLENILQE  180



>ref|XP_009362961.1| PREDICTED: histone acetyltransferase KAT6A-like isoform X2 [Pyrus 
x bretschneideri]
Length=356

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  228  LDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMND  407
            L + GS      S + ++++ ++R M +    LL A+E LS R+SQLE+++  L+NS++D
Sbjct  63   LAKSGSNHVDRASEDSALISVIERKMDDHFGNLLHAVEGLSARISQLETRLCRLQNSVDD  122

Query  408  LKVSIEYDHGKTDGKLRQLENILRE  482
             K S E +HGK DGKLRQLEN+LRE
Sbjct  123  FKDSTEINHGKADGKLRQLENMLRE  147



>ref|XP_002884275.1| hypothetical protein ARALYDRAFT_477359 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60534.1| hypothetical protein ARALYDRAFT_477359 [Arabidopsis lyrata subsp. 
lyrata]
Length=474

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 64/91 (70%), Gaps = 2/91 (2%)
 Frame = +3

Query  216  SSSSLDQIGSTK-TTNKSNNMSMVAEV-DRIMKELSNKLLRAIEDLSGRLSQLESKMHYL  389
            S+S    I  +K   +K  N+S+++E+ DR MK+ ++ LL  +E +S RLSQLES+   L
Sbjct  91   STSGFGSIEPSKLVPDKGQNVSIMSEIIDRTMKKHTDTLLHVMEGVSARLSQLESRTLNL  150

Query  390  ENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            EN ++DLKVS++  HG TDGK+RQL+NIL E
Sbjct  151  ENLVDDLKVSVDNSHGTTDGKIRQLKNILVE  181



>gb|KDP31054.1| hypothetical protein JCGZ_11430 [Jatropha curcas]
Length=518

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 54/152 (36%), Positives = 88/152 (58%), Gaps = 13/152 (9%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSFRFLeadtdddeeea----VDQFRLHRNRHYGAPLTS  218
            M ++++MDKQ+ ELS+     +  RFL  D ++++++         + H     G     
Sbjct  1    MNSSKYMDKQITELSK-----YRRRFLGDDEEEEDDQDRGFDFHTIQSHTKSFEGTHFRG  55

Query  219  SSSLDQIGSTKTTNKS----NNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHY  386
             SS D I STK + +     +++ +++ +D+ +KE  + LL A+E LS RLSQ+ES+   
Sbjct  56   WSSKDHIDSTKFSGEKAGIFSDVELISSIDQKLKEHVDVLLHAVECLSARLSQMESRTRQ  115

Query  387  LENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             EN+ +DLK S+E+ HG TD KL +LE IL E
Sbjct  116  AENTFDDLKESVEFSHGSTDRKLMELETILIE  147



>ref|XP_009611187.1| PREDICTED: transcriptional regulator DEF1 isoform X1 [Nicotiana 
tomentosiformis]
Length=551

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 60/185 (32%), Positives = 94/185 (51%), Gaps = 41/185 (22%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDHSFRFLeadtdd-------deeeaVDQFRLHRNRHYGAP  209
            M T+++MDKQ+M+LS SQ  +  F  L     D        +E+ V  +  H  R  G+ 
Sbjct  1    MNTSQYMDKQIMDLSNSQNNNSDFIDLVNPQVDHHISGDPKKEDIVPSYEFHPIRPIGSS  60

Query  210  LTSS------------------------SSLDQIGSTKTTNKSN----------NMSMVA  287
               S                        SS+   GS  +T  +             S+++
Sbjct  61   SPKSNVDSSNVGAAARAWNSADSKNNTESSIRNYGSLDSTEAAKVIVEKDLSSVYSSLLS  120

Query  288  EVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLE  467
            E+D  +K+ ++ LL A+E +S RLSQLE++   ++NS+++LK+S+  +HG TDGKLRQLE
Sbjct  121  EIDHTVKKYADNLLHAMEGVSARLSQLETRSRQIDNSVDELKLSVGNNHGVTDGKLRQLE  180

Query  468  NILRE  482
            NILR+
Sbjct  181  NILRQ  185



>gb|KFK37621.1| hypothetical protein AALP_AA3G007100 [Arabis alpina]
Length=508

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 61/183 (33%), Positives = 93/183 (51%), Gaps = 43/183 (23%)
 Frame = +3

Query  57   TTEFMDKQVMELSESQFEDHSFRFLeadtdddeeeaVDQFRLHRN-------------RH  197
            +++FMDKQ+M+LS S     +  F++     D++    Q  L  N             R 
Sbjct  4    SSQFMDKQIMDLSSSSSPPST-DFIDLMNTTDDDHQKHQIGLESNKEEIVPSYDFQPIRP  62

Query  198  YGAPLTSSSSLDQIGSTK----------------------------TTNKSNNMSMVAEV  293
            Y A   S S+LD  GST                              + KS N+ +++E+
Sbjct  63   YTAAGLSHSALDLAGSTSARVWSASDFKPISTSSNKGFGSIEPAKLVSEKSQNV-IISEI  121

Query  294  DRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENI  473
            DR +K+  + LL  +E +S RL+QLE++ H LEN ++DLKVS+E  HG +DGK+R+L+NI
Sbjct  122  DRTVKKHVDTLLHVMEGVSARLTQLETRTHNLENLVDDLKVSVENSHGSSDGKMRRLQNI  181

Query  474  LRE  482
            L E
Sbjct  182  LVE  184



>ref|XP_004960805.1| PREDICTED: protein diaphanous homolog 1-like [Setaria italica]
Length=568

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 63/97 (65%), Gaps = 5/97 (5%)
 Frame = +3

Query  207  PLTSSSSLD---QIGSTKTTNKSNNMSMVA--EVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            PL +S  L+    +       + +N S V   ++DR MK+ ++ LL A+E +S RLSQLE
Sbjct  97   PLKTSGVLEPHHMLKKVSHEEERSNFSAVTIVDIDRTMKKYADNLLHALEGVSSRLSQLE  156

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             + ++LENS+ +LK++I  ++G TDGKLRQ EN LRE
Sbjct  157  DRTYHLENSVGELKLTIGNNNGSTDGKLRQFENTLRE  193



>ref|XP_006655038.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Oryza 
brachyantha]
Length=495

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 58/77 (75%), Gaps = 2/77 (3%)
 Frame = +3

Query  258  NKSNNMSMV--AEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYD  431
            ++ +N+S V  A++DR MK+ ++ LL A+E +S RLSQLE + H+LENS+ +LK++I   
Sbjct  46   DERSNLSAVSIADIDRTMKKYADNLLHALEGVSSRLSQLEGRTHHLENSVGELKLTIGNY  105

Query  432  HGKTDGKLRQLENILRE  482
            +G TDGKLRQ EN LRE
Sbjct  106  NGSTDGKLRQFENTLRE  122



>ref|XP_002455112.1| hypothetical protein SORBIDRAFT_03g004550 [Sorghum bicolor]
 gb|EES00232.1| hypothetical protein SORBIDRAFT_03g004550 [Sorghum bicolor]
Length=571

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ S+ LL A+E +S RLSQ+E + H LENS+++LK++I   +G TDGKLR 
Sbjct  139  IADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGNYNGSTDGKLRH  198

Query  462  LENILRE  482
            LEN+LRE
Sbjct  199  LENMLRE  205



>ref|XP_011098435.1| PREDICTED: protein diaphanous homolog 1-like [Sesamum indicum]
Length=564

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +3

Query  249  KTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEY  428
            K +N   ++S+V+E+D+ MK+    L+  ++ +S RLSQLE++   LENS++DLKVS+  
Sbjct  122  KPSNVPLDVSLVSEIDKTMKKYMENLMHEVDKMSARLSQLETRTRSLENSIDDLKVSVGS  181

Query  429  DHGKTDGKLRQLENILRE  482
            + G TDGK+R LENILRE
Sbjct  182  NCGSTDGKMRLLENILRE  199



>ref|NP_001140648.1| uncharacterized protein LOC100272723 [Zea mays]
 gb|ACF84264.1| unknown [Zea mays]
 tpg|DAA53270.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=568

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ S+ LL A+E +S RLSQ+E + H LENS+++LK++I   +G TDGKLR 
Sbjct  140  IADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGNYNGSTDGKLRH  199

Query  462  LENILRE  482
            LEN+LRE
Sbjct  200  LENMLRE  206



>gb|EMS54596.1| Tryptophan aminotransferase 1 [Triticum urartu]
Length=891

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +3

Query  192  RHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            +H  A +     L ++   +  +  N ++ +A++DR MK+ ++ LL A+E +S RL+QLE
Sbjct  69   KHKSAAMMEPRVLKKVSHEEERSNFNAVT-IADIDRTMKKYADNLLHAMEGVSSRLAQLE  127

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             + H+LE+S+ +LK+++   +G TDGKLRQ EN LRE
Sbjct  128  GRTHHLEDSVGELKLTVGNYNGSTDGKLRQFENTLRE  164



>gb|KJB40752.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=519

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 4/90 (4%)
 Frame = +3

Query  225  SLDQIGSTK----TTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLE  392
            SLD I   K       K  + S+VA +DR MK+ ++ L+  +E +  RL+QLES+   LE
Sbjct  43   SLDSIEPVKDILEKDQKGFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSNLE  102

Query  393  NSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             S++DLK+S+  +HG  DGK+RQLENIL+E
Sbjct  103  TSVDDLKMSVGNNHGSIDGKMRQLENILKE  132



>ref|XP_011046206.1| PREDICTED: uncharacterized protein LOC105140870 [Populus euphratica]
Length=510

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 91/162 (56%), Gaps = 28/162 (17%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQF-------------EDHSFRFLeadtdddeeeaV-DQFRLHR  188
            M T+ +MDKQ+ +LS+SQ               DH F F  + +       V D+  L  
Sbjct  1    MDTSRYMDKQITQLSKSQPFNFLDDDDEQEENGDHGFEFNTSRSLSKSHNKVLDETNL--  58

Query  189  NRHYGAPLTSSSSLDQIGSTKTTNKS----NNMSMVAEVDRIMKELSNKLLRAIEDLSGR  356
             R +       SS+D I   K + +     +N +++ E+D  MKE ++ LL ++E LS +
Sbjct  59   -RGW-------SSMDCIDYAKFSPEKVGIFSNAALIFEIDVKMKEHADILLHSVECLSTQ  110

Query  357  LSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +S+LES+ H LEN +++LK S +++ GKTDGKLR+++NIL E
Sbjct  111  VSRLESRTHQLENVVHELKESTDFNQGKTDGKLREIKNILVE  152



>gb|KHG02060.1| Myosin-2 [Gossypium arboreum]
Length=542

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            + S++AE+DR MK+ ++ L+  +E +S RL+QLES+  +LENS++DLKVS+  +HG TD 
Sbjct  119  DTSILAEIDRTMKKHTDNLMHMMEKVSDRLTQLESRTRHLENSLDDLKVSVGNNHGSTDR  178

Query  450  KLRQLENILRE  482
            K++QLENIL E
Sbjct  179  KMKQLENILTE  189



>ref|XP_002511348.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51950.1| conserved hypothetical protein [Ricinus communis]
Length=488

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 41/91 (45%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +3

Query  222  SSLDQIGSTKTTNK----SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYL  389
            SS+D I S K ++     S+N  +++ +D+ +KE  + LL ++E LS R+SQ+E+++  +
Sbjct  24   SSMDHIASNKLSDNEVGTSSNAELISRIDQKLKEHIDILLHSVEYLSARVSQMETRVRQV  83

Query  390  ENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            E S + LK SIE++HGKTDGKL +LENIL E
Sbjct  84   EISFDGLKESIEFNHGKTDGKLWELENILTE  114



>gb|EMT01630.1| hypothetical protein F775_09697 [Aegilops tauschii]
Length=574

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +3

Query  261  KSN-NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHG  437
            +SN N   +A++DR MK+ ++ LL A+E +S RL+QLE + H+LE+S+ +LK+++   +G
Sbjct  126  RSNFNAVTIADIDRTMKKYADNLLHAMEGVSSRLAQLEGRTHHLEDSVGELKLTVGNYNG  185

Query  438  KTDGKLRQLENILRE  482
             TDGKLRQ EN LRE
Sbjct  186  STDGKLRQFENTLRE  200



>gb|AFW80147.1| putative DUF1421 domain family protein [Zea mays]
Length=563

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +3

Query  258  NKSNNMSM-VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDH  434
            +KSN  ++ +A++DR MK+ S+ LL A+E +S RLSQ+E + H LENS+++LK++I   +
Sbjct  123  DKSNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGNYN  182

Query  435  GKTDGKLRQLENILRE  482
            G TDGKLR LEN+LRE
Sbjct  183  GSTDGKLRNLENMLRE  198



>ref|NP_001054762.2| Os05g0169400 [Oryza sativa Japonica Group]
 dbj|BAF16676.2| Os05g0169400, partial [Oryza sativa Japonica Group]
Length=536

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ ++ LL A+E +S RLSQLE + H+LENS+ +LK+ I   +G TDGKLRQ
Sbjct  99   IADIDRTMKKYADNLLHALESVSSRLSQLEGRTHHLENSVGELKLIIGNYNGSTDGKLRQ  158

Query  462  LENILRE  482
             EN LRE
Sbjct  159  FENTLRE  165



>gb|EAY96697.1| hypothetical protein OsI_18619 [Oryza sativa Indica Group]
 gb|EEE62479.1| hypothetical protein OsJ_17276 [Oryza sativa Japonica Group]
Length=574

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ ++ LL A+E +S RLSQLE + H+LENS+ +LK+ I   +G TDGKLRQ
Sbjct  137  IADIDRTMKKYADNLLHALESVSSRLSQLEGRTHHLENSVGELKLIIGNYNGSTDGKLRQ  196

Query  462  LENILRE  482
             EN LRE
Sbjct  197  FENTLRE  203



>emb|CAB87621.1| putative protein [Arabidopsis thaliana]
Length=530

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++ +DR MK  ++KLL  +E +S RL+QLE++   LEN ++D+KVS+   HGKTDGKL
Sbjct  108  AIISAIDRTMKAHADKLLHVMEGVSARLTQLETRTRDLENLVDDVKVSVGNSHGKTDGKL  167

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  168  RQLENIMLE  176



>ref|XP_004968338.1| PREDICTED: class E vacuolar protein-sorting machinery protein 
HSE1-like [Setaria italica]
Length=570

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            +A++DR MK+ S+ +L A+E +S RLSQ+ES+ H LENS+++LK++I   +G TDGKLR 
Sbjct  136  MADIDRTMKKYSDNILHALEGVSSRLSQMESRTHQLENSVDELKLTIGNYNGGTDGKLRH  195

Query  462  LENILRE  482
            LEN+LRE
Sbjct  196  LENMLRE  202



>ref|XP_009362960.1| PREDICTED: uncharacterized protein LOC103952977 isoform X1 [Pyrus 
x bretschneideri]
Length=440

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  228  LDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMND  407
            L + GS      S + ++++ ++R M +    LL A+E LS R+SQLE+++  L+NS++D
Sbjct  147  LAKSGSNHVDRASEDSALISVIERKMDDHFGNLLHAVEGLSARISQLETRLCRLQNSVDD  206

Query  408  LKVSIEYDHGKTDGKLRQLENILRE  482
             K S E +HGK DGKLRQLEN+LRE
Sbjct  207  FKDSTEINHGKADGKLRQLENMLRE  231



>ref|NP_196958.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH20220.1| AT5G14540 [Arabidopsis thaliana]
 gb|AED92045.1| uncharacterized protein AT5G14540 [Arabidopsis thaliana]
Length=547

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++ +DR MK  ++KLL  +E +S RL+QLE++   LEN ++D+KVS+   HGKTDGKL
Sbjct  125  AIISAIDRTMKAHADKLLHVMEGVSARLTQLETRTRDLENLVDDVKVSVGNSHGKTDGKL  184

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  185  RQLENIMLE  193



>ref|XP_009403230.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Musa acuminata subsp. malaccensis]
Length=550

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +3

Query  240  GSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVS  419
             S +    + +++MVAE+D  +K  ++ L+ A+E ++ RL QLE++ H+LENS+++LKV+
Sbjct  117  ASHQKEKSTYDVAMVAEIDTTVKRYADNLMNALEGVNSRLLQLENRTHHLENSVDELKVA  176

Query  420  IEYDHGKTDGKLRQLENILRE  482
            I  ++G TDG+LRQ +NILRE
Sbjct  177  IGNNNGSTDGRLRQFDNILRE  197



>gb|KDO55180.1| hypothetical protein CISIN_1g0084162mg, partial [Citrus sinensis]
Length=462

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  267  NNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTD  446
            ++ ++V+++D+ MK+ ++ LL  +E +S RL+QL+++   LE+S++DLKVS+  +H  TD
Sbjct  19   SDATIVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTD  78

Query  447  GKLRQLENILRE  482
            GK+RQ+ENILRE
Sbjct  79   GKMRQVENILRE  90



>ref|XP_006369924.1| hypothetical protein POPTR_0001s35000g [Populus trichocarpa]
 gb|ERP66493.1| hypothetical protein POPTR_0001s35000g [Populus trichocarpa]
Length=288

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 62/97 (64%), Gaps = 5/97 (5%)
 Frame = +3

Query  207  PLTSSSSLDQIGSTKTTNKSN-----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            PL +  SLD +   K   + +       S+++E+DR M + S+ LL A+E +S RL+QLE
Sbjct  103  PLRNYGSLDSMEPAKVVMEKDRSVFDAASIISEIDRTMNKFSDNLLHALEGVSARLTQLE  162

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            S+  +LENS++DLK+S+  +H  T G +R L NILRE
Sbjct  163  SRTRHLENSVDDLKLSVGNNHESTQGNMRHLHNILRE  199



>gb|KJB40754.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=566

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = +3

Query  204  APLTSSSSLDQIGSTK----TTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            A +    SLD I   K       K  + S+VA +DR MK+ ++ L+  +E +  RL+QLE
Sbjct  83   AKIKKYGSLDSIEPVKDILEKDQKGFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLE  142

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            S+   LE S++DLK+S+  +HG  DGK+RQLENIL+E
Sbjct  143  SRTSNLETSVDDLKMSVGNNHGSIDGKMRQLENILKE  179



>ref|XP_010908580.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Elaeis guineensis]
Length=523

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            + + VAE+D  +K+ ++ LL  +E +S RL+QLES+ H+LE+S+++LKV+     G TDG
Sbjct  109  DAATVAEIDHTVKKYADNLLHTLEGVSSRLTQLESRTHHLESSVDELKVTTGNSSGTTDG  168

Query  450  KLRQLENILR  479
            KLRQLENILR
Sbjct  169  KLRQLENILR  178



>ref|XP_006446566.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
 gb|ESR59806.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
Length=574

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +3

Query  207  PLTSSSSLDQIGSTK-TTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMH  383
            P+ +  SLD     K      ++ ++V+++D+ MK+ ++ LL  +E +S RL+QL+++  
Sbjct  102  PVRNFGSLDNFDCPKFNLGNRSDATIVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTR  161

Query  384  YLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             LE+S++DLKVS+  +H  TDGK+RQ+ENILRE
Sbjct  162  NLESSVDDLKVSVGSNHASTDGKMRQVENILRE  194



>ref|NP_001147786.1| LOC100281396 [Zea mays]
 gb|ACG28711.1| proline-rich protein [Zea mays]
Length=563

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +3

Query  258  NKSNNMSM-VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDH  434
            +KSN  ++ +A++DR MK+ S+ LL A+E +S RLSQ+E + H LEN +++LK++I   +
Sbjct  123  DKSNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENCVDELKLTIGNYN  182

Query  435  GKTDGKLRQLENILRE  482
            G TDGKLR LEN+LRE
Sbjct  183  GSTDGKLRNLENMLRE  198



>ref|XP_002873675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49934.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++ +DR MK  ++ LL  +E +S RL+QLE++   LEN ++D+KVS+   HGKTDGKL
Sbjct  119  AIISAIDRTMKAHADSLLHVMEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGKTDGKL  178

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  179  RQLENIMLE  187



>gb|KDO55179.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=566

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +3

Query  207  PLTSSSSLDQIGSTK-TTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMH  383
            P+ +  SLD     K      ++ ++V+++D+ MK+ ++ LL  +E +S RL+QL+++  
Sbjct  102  PVRNFGSLDNFDCPKFNLGNRSDATIVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTR  161

Query  384  YLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             LE+S++DLKVS+  +H  TDGK+RQ+ENILRE
Sbjct  162  NLESSVDDLKVSVGSNHASTDGKMRQVENILRE  194



>gb|KFK25694.1| hypothetical protein AALP_AA8G147000 [Arabis alpina]
Length=530

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 44/101 (44%), Positives = 66/101 (65%), Gaps = 9/101 (9%)
 Frame = +3

Query  207  PLTSSS-----SLDQIGSTKT-TNKSNN---MSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
            P+++SS     SLD +  +K    K  N    ++++ +DR MK+ ++ LL  +E +S RL
Sbjct  74   PVSTSSARSYGSLDSVEPSKLFAEKDRNGPESAIISAIDRTMKKHADNLLHVMEGVSARL  133

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +QLE++   LEN ++D+KVS+   HG TDGKLRQLENIL E
Sbjct  134  TQLETRTRNLENLVDDVKVSVGNSHGNTDGKLRQLENILLE  174



>ref|XP_006470271.1| PREDICTED: COPII coat assembly protein sec16-like [Citrus sinensis]
Length=574

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +3

Query  204  APLTSSSSLDQIGSTK--TTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESK  377
            +P+ +  SLD     K    N+S+  ++V+++D+ MK+ ++ LL  +E +S RL+QL+++
Sbjct  101  SPVRNFGSLDNFDCPKFNLGNRSD-ATIVSDIDQTMKKYADNLLHVLEGVSARLTQLDAR  159

Query  378  MHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
               LE+S++DLKVS+  +H  TDGK+RQ+ENILRE
Sbjct  160  TRNLESSVDDLKVSVGSNHASTDGKMRQVENILRE  194



>ref|XP_009766181.1| PREDICTED: programmed cell death 6-interacting protein-like [Nicotiana 
sylvestris]
Length=549

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 93/187 (50%), Gaps = 50/187 (27%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQ------------------------FEDHSFRFLeadtdddee  158
            M T+++MD+Q+M+L+ SQ                           + FR +        +
Sbjct  1    MNTSQYMDRQIMDLTNSQSNNDFINLMNPHEDISGSTKGESIVPGYEFRPIRPTGSSPPK  60

Query  159  eaVD-------------QFRLH--RNRHYGAPLTSSSSLDQIGSTKTTNKSN----NMSM  281
              +D             +F+ +  R R+YG       SLD +   K +   +    + S+
Sbjct  61   SHIDSGHITGARDWNSVEFKSNTSRIRNYG-------SLDSLAPAKLSGDKDLSTVDSSL  113

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            + E+D  +K+ ++ LL AIE +S RLSQ+E++   +E+S++ LK+S++ ++G TDGKLR 
Sbjct  114  LFEIDHTVKDYADNLLHAIESMSARLSQVETRSRQIESSLDGLKLSVDNNNGSTDGKLRL  173

Query  462  LENILRE  482
            +ENI RE
Sbjct  174  VENIFRE  180



>gb|KJB40753.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=565

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 4/90 (4%)
 Frame = +3

Query  225  SLDQIGSTK----TTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLE  392
            SLD I   K       K  + S+VA +DR MK+ ++ L+  +E +  RL+QLES+   LE
Sbjct  89   SLDSIEPVKDILEKDQKGFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSNLE  148

Query  393  NSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             S++DLK+S+  +HG  DGK+RQLENIL+E
Sbjct  149  TSVDDLKMSVGNNHGSIDGKMRQLENILKE  178



>ref|XP_008245313.1| PREDICTED: uncharacterized protein LOC103343438 [Prunus mume]
Length=289

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +3

Query  219  SSSLDQIGSTKTTNKS----NNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHY  386
             SS+D I   K+  K     ++ ++++ + + M    + LL A+E LS  LSQLE+++  
Sbjct  55   CSSMDHIDLAKSGCKYAGAFDDSALISVIGQKMSHHFDNLLHAVEGLSAPLSQLETRLRR  114

Query  387  LENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            LENS++DLK S E +HG+ DGKLRQLENILRE
Sbjct  115  LENSVDDLKDSTEINHGRNDGKLRQLENILRE  146



>dbj|BAK01901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +3

Query  261  KSN-NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHG  437
            +SN N   +A++DR MK+ ++ LL A+E +S RL+QLE + H+LE+S+ +LK+++   +G
Sbjct  124  RSNFNAVTIADIDRTMKKYADNLLHALEGVSSRLAQLEGRTHHLEDSVGELKLTVGNYNG  183

Query  438  KTDGKLRQLENILRE  482
             TDGKLRQ EN LRE
Sbjct  184  STDGKLRQFENTLRE  198



>ref|XP_009125983.1| PREDICTED: WW domain-binding protein 11 isoform X1 [Brassica 
rapa]
Length=537

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++E+DR+MK+ ++ L+  +E +S RL+QLES+   LEN ++D+KVS+   HG TDGK+
Sbjct  119  AILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKM  178

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  179  RQLENIMLE  187



>ref|XP_009125985.1| PREDICTED: WW domain-binding protein 11 isoform X2 [Brassica 
rapa]
Length=536

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++E+DR+MK+ ++ L+  +E +S RL+QLES+   LEN ++D+KVS+   HG TDGK+
Sbjct  118  AILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKM  177

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  178  RQLENIMLE  186



>gb|KHG20812.1| Actin cytoskeleton-regulatory complex PAN1 [Gossypium arboreum]
Length=566

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = +3

Query  204  APLTSSSSLDQIGSTK----TTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLE  371
            A +    SLD I   K       K  + S+VA +DR MK+ ++ L+  +E +  RL+QLE
Sbjct  83   AKIKMYGSLDSIEPVKDILEKDQKGFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLE  142

Query  372  SKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            S+   LE S++DLK+S+  +HG  DGK+RQLENIL+E
Sbjct  143  SRTSKLETSVDDLKMSVGNNHGSIDGKMRQLENILKE  179



>emb|CDX91045.1| BnaC02g05520D [Brassica napus]
Length=486

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++E+DR+MK+ ++ L+  +E +S RL+QLES+   LEN ++D+KVS+   HG TDGK+
Sbjct  117  AILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKM  176

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  177  RQLENIMLE  185



>emb|CDX85594.1| BnaA02g02190D [Brassica napus]
Length=487

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++E+DR+MK+ ++ L+  +E +S RL+QLES+   LEN ++D+KVS+   HG TDGK+
Sbjct  118  AILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKM  177

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  178  RQLENIMLE  186



>gb|KJB75894.1| hypothetical protein B456_012G063600 [Gossypium raimondii]
Length=622

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            + S++AE+D+ MK+ ++ L+  +E +S RL+QLES+  +LENS++DLKVS+  +HG TD 
Sbjct  198  DTSILAEIDQTMKKHTDNLMHMMEKVSDRLTQLESRTRHLENSLDDLKVSVVNNHGSTDR  257

Query  450  KLRQLENILRE  482
            K++QLENIL E
Sbjct  258  KMKQLENILTE  268



>ref|XP_010910341.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X1 [Elaeis guineensis]
Length=535

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            +++ V E+DR +K+ ++ LL A+E +S RLSQLES+  YL +S+++LKVS+  +H  T+G
Sbjct  105  DVARVVEIDRAVKKYADNLLHALEGVSSRLSQLESRTCYLGSSVDELKVSVGNNHRSTNG  164

Query  450  KLRQLENILRE  482
            +LRQ+ENILRE
Sbjct  165  RLRQIENILRE  175



>ref|XP_010230500.1| PREDICTED: uncharacterized protein LOC100838076 [Brachypodium 
distachyon]
Length=961

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            VA++DR MK+ S+ L  A+E +S RL QLE + H+LENS+++  ++I   +G TDGKLRQ
Sbjct  129  VADIDRTMKKYSDNLFHALEGVSSRLLQLERRTHHLENSVDEFNLTIGNYNGSTDGKLRQ  188

Query  462  LENILRE  482
            LEN+LRE
Sbjct  189  LENMLRE  195



>ref|XP_010910342.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X2 [Elaeis guineensis]
Length=533

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            +++ V E+DR +K+ ++ LL A+E +S RLSQLES+  YL +S+++LKVS+  +H  T+G
Sbjct  103  DVARVVEIDRAVKKYADNLLHALEGVSSRLSQLESRTCYLGSSVDELKVSVGNNHRSTNG  162

Query  450  KLRQLENILRE  482
            +LRQ+ENILRE
Sbjct  163  RLRQIENILRE  173



>gb|KDO55178.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=564

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 56/193 (29%), Positives = 93/193 (48%), Gaps = 50/193 (26%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQFEDH-----------------------------------SFR  125
            M T++FMDKQ+M+L+ S   D                                    S+ 
Sbjct  1    MNTSQFMDKQIMDLTSSPSMDKDLMDLTNHHRPPQHEEDDRDANNNGIGIKKEEIVPSYD  60

Query  126  FLeadtdddeeeaVDQFRLHRNRHYGAPLTSSS-------------SLDQIGSTK-TTNK  263
            FL       +   +D   ++ +   GA + +SS             SLD     K     
Sbjct  61   FLPIRGGLSQSLNLDS-SVNNDAAVGARVWNSSENKPNSSLPPNFGSLDNFDCPKFNLGN  119

Query  264  SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKT  443
             ++ ++V+++D+ MK+ ++ LL  +E +S RL+QL+++   LE+S++DLKVS+  +H  T
Sbjct  120  RSDATIVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHAST  179

Query  444  DGKLRQLENILRE  482
            DGK+RQ+ENILRE
Sbjct  180  DGKMRQVENILRE  192



>ref|XP_011047322.1| PREDICTED: vacuolar protein sorting-associated protein 37C [Populus 
euphratica]
Length=552

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            S+++E+DR M + S+ L+ A+E +S RL+QLES+  +LENS++DLK+S+  +H  T G +
Sbjct  131  SIISEIDRTMNKFSDNLVHALEGVSARLTQLESRTRHLENSVDDLKLSVGNNHESTQGSM  190

Query  456  RQLENILRE  482
            R L NILRE
Sbjct  191  RHLHNILRE  199



>ref|XP_009613822.1| PREDICTED: SH3 domain-containing protein C23A1.17-like isoform 
X1 [Nicotiana tomentosiformis]
Length=552

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 52/184 (28%), Positives = 85/184 (46%), Gaps = 36/184 (20%)
 Frame = +3

Query  36   YYLEAMKTTEFMDKQVMELSESQFEDHSFRFLeadtdddeeeaVDQFRLHRNRHYGAPLT  215
            Y   +M T+++MDKQ+M+L+ SQ  +     +    D       +        H   P  
Sbjct  2    YTTPSMNTSQYMDKQIMDLTNSQSNNDFINLMNPHQDISGGTKGESIVPSYESHPIRPTG  61

Query  216  SSSSLDQIGSTKTTN------------------------------------KSNNMSMVA  287
            SS     I S  TT                                     K+ + S++ 
Sbjct  62   SSPPKSNIDSGHTTGARAWNSAEFKSKTASIRNYGSLDSLAPAKLIVDKDLKTVDSSLLF  121

Query  288  EVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLE  467
            E+D  +K+ ++ LL AIE +S RLSQ+E++   +E S++DLK+S++ +HG TDGKL+ +E
Sbjct  122  EIDHTVKKYADSLLLAIESVSARLSQVETRNRQIETSLDDLKLSVDTNHGSTDGKLKLVE  181

Query  468  NILR  479
            +I R
Sbjct  182  SIFR  185



>ref|XP_008361778.1| PREDICTED: uncharacterized protein LOC103425469 [Malus domestica]
Length=342

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = +3

Query  204  APLTSSSSLDQIGSTKTTNKSN-NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKM  380
            +P+ S  S+D +   K   +++ N ++V+E+D+ MK+ ++ LL  +E +S RL+QLES+ 
Sbjct  119  SPIRSYGSMDSLEPGKLILENDRNAAIVSEIDQTMKKHTDNLLHVLESVSARLTQLESRT  178

Query  381  HYLENSMNDLKVSIEYDHGKTDGKLRQLENI  473
              LEN ++DLK+S+  +HG TDG +RQLE++
Sbjct  179  RNLENYVDDLKISVGNNHGNTDGTMRQLEDL  209



>ref|XP_010453577.1| PREDICTED: basic salivary proline-rich protein 2-like [Camelina 
sativa]
Length=547

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++ +DR MK  ++ L+  IE +S RL+QLE++   LEN ++D+KVS+   HG TDGKL
Sbjct  126  AILSAIDRTMKAHADNLIHVIEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGTTDGKL  185

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  186  RQLENIMLE  194



>ref|XP_010492262.1| PREDICTED: basic salivary proline-rich protein 2-like [Camelina 
sativa]
Length=547

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++ +DR MK  ++ L+  IE +S RL+QLE++   LEN ++D+KVS+   HG TDGKL
Sbjct  126  AILSAIDRTMKAHADNLIHVIEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGTTDGKL  185

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  186  RQLENIMLE  194



>ref|XP_009611188.1| PREDICTED: transcriptional regulator DEF1 isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  288  EVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLE  467
            E+D  +K+ ++ LL A+E +S RLSQLE++   ++NS+++LK+S+  +HG TDGKLRQLE
Sbjct  115  EIDHTVKKYADNLLHAMEGVSARLSQLETRSRQIDNSVDELKLSVGNNHGVTDGKLRQLE  174

Query  468  NILRE  482
            NILR+
Sbjct  175  NILRQ  179



>ref|XP_009782100.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=545

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 58/179 (32%), Positives = 91/179 (51%), Gaps = 41/179 (23%)
 Frame = +3

Query  69   MDKQVMELSESQFEDHSFRFLeadtdd-------deeeaVDQFRLHRNRHYGAPLTSS--  221
            MDKQ+M+LS SQ  ++ F  L     D        +E+ V  +  H  R  G+    S  
Sbjct  1    MDKQIMDLSNSQNNNNDFIDLVNPQVDHHISGDPKKEDIVPSYEFHPIRPIGSSSPKSNV  60

Query  222  ----------------------SSLDQIGSTKTTNKSNNM----------SMVAEVDRIM  305
                                  SS+   GS  +T  +  +          S+++E+D  +
Sbjct  61   DSSNVGAAARAWNSADSKNNTESSIRNYGSLDSTEAAKAIVEKDLSSVYSSLLSEIDHTV  120

Query  306  KELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            K+ ++ LL A+E +S RLSQLE++   ++NS+++LK+S+  +HG TDGKLRQLENILR+
Sbjct  121  KKYADNLLHAMEGVSARLSQLETRSRQIDNSVDELKLSVGNNHGVTDGKLRQLENILRQ  179



>ref|XP_007036361.1| Apoptosis-stimulating of p53 protein 1, putative [Theobroma cacao]
 gb|EOY20862.1| Apoptosis-stimulating of p53 protein 1, putative [Theobroma cacao]
Length=480

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +3

Query  264  SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKT  443
            S   +++AE+DR +KE +  ++  +  LS R+SQLES+   LEN++ DLK S+E++HG+ 
Sbjct  58   SYGAALIAEIDRKIKEHTENVVCVVGGLSARVSQLESRTRQLENAVGDLKGSVEFNHGRV  117

Query  444  DGKLRQLENILRE  482
            +GK+R+L N+L E
Sbjct  118  EGKIRELGNVLGE  130



>emb|CBI14977.3| unnamed protein product [Vitis vinifera]
Length=400

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++ VD+ MKE ++  L  ++ L  RLSQLES+   +E+ +++LK S EY+HG+T+GKL
Sbjct  21   ALISVVDKKMKEHTDTFLHVVDALITRLSQLESRTRNIESYVDELKASTEYNHGRTNGKL  80

Query  456  RQLENILRE  482
            +QLEN LRE
Sbjct  81   KQLENTLRE  89



>ref|XP_004252212.1| PREDICTED: extensin-like [Solanum lycopersicum]
Length=504

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 53/154 (34%), Positives = 88/154 (57%), Gaps = 12/154 (8%)
 Frame = +3

Query  51   MKTTEFMDKQVMELSESQ--FEDHSFRFLeadtdddeeeaVDQFRLHRNRHYGAPLTSS-  221
            M T + +DKQ+M+LS +      H  +       +     ++ F  + + H+ AP T + 
Sbjct  1    MNTCKCIDKQIMDLSTNNDFINLHDDQHHITAGVNHPVRPIESFP-NCSIHW-APDTKTN  58

Query  222  ---SSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKM  380
               SS D I   K   + +    + S+++E+D  +K+ ++ LL AIE +S RLSQLE++ 
Sbjct  59   TNYSSPDSIEPAKLIVEKDLSTIDASLLSEIDHTVKKYADNLLHAIESVSARLSQLETRS  118

Query  381  HYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
              +E+ +  LK+S++ +HG TDGKLR +ENILRE
Sbjct  119  RQIEDFVVKLKLSVDNNHGNTDGKLRLVENILRE  152



>ref|XP_010663116.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663117.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663118.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663119.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
Length=469

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++ VD+ MKE ++  L  ++ L  RLSQLES+   +E+ +++LK S EY+HG+T+GKL
Sbjct  21   ALISVVDKKMKEHTDTFLHVVDALITRLSQLESRTRNIESYVDELKASTEYNHGRTNGKL  80

Query  456  RQLENILRE  482
            +QLEN LRE
Sbjct  81   KQLENTLRE  89



>ref|XP_002524656.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF37675.1| DNA binding protein, putative [Ricinus communis]
Length=568

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 11/99 (11%)
 Frame = +3

Query  192  RHYGAPLTSSSSLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
            RHYG       SLD I   K   +++    + ++V+E+D+ MK+ ++ LL  +E +S RL
Sbjct  124  RHYG-------SLDSIEPAKVVVENDRSAFDAAIVSEIDKTMKKHTDNLLHLLEGVSARL  176

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENIL  476
            +QLE +   LENS+++LKVSI  +HG TDGK+ Q+E +L
Sbjct  177  TQLEIRSRCLENSVDELKVSIGNNHGNTDGKIEQVEKVL  215



>ref|XP_006289230.1| hypothetical protein CARUB_v10002686mg [Capsella rubella]
 gb|EOA22128.1| hypothetical protein CARUB_v10002686mg [Capsella rubella]
Length=541

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 40/101 (40%), Positives = 65/101 (64%), Gaps = 9/101 (9%)
 Frame = +3

Query  207  PLTSSS-----SLDQIGSTKTTNKSN----NMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
            P+ +SS     S+D +  +K   + +    + ++++ +DR MK  ++ L+  IE +S RL
Sbjct  90   PVATSSARSYGSMDSLEPSKLFAEKDRNAPDSAILSAIDRTMKAHADNLIHVIECVSARL  149

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +QLE++   LEN ++D+KVS+   HG TDGKLRQLENI+ E
Sbjct  150  TQLETRTRNLENLVDDVKVSVGNSHGTTDGKLRQLENIMLE  190



>gb|KHN27461.1| hypothetical protein glysoja_022170 [Glycine soja]
Length=89

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  279  MVAEVDRIMKELSNK-LLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            M++++DR  K+   + +L  +   S RL+QLE++ H+LENS+ +LKVS+  +HG TDGKL
Sbjct  1    MLSKIDRTKKKKHKENMLHVLAGASARLTQLETRTHHLENSVENLKVSVGNNHGSTDGKL  60

Query  456  RQLENILRE  482
            RQL NIL E
Sbjct  61   RQLANILGE  69



>ref|XP_009613823.1| PREDICTED: putative uncharacterized protein FLJ22184 isoform 
X2 [Nicotiana tomentosiformis]
Length=461

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  261  KSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGK  440
            K+ + S++ E+D  +K+ ++ LL AIE +S RLSQ+E++   +E S++DLK+S++ +HG 
Sbjct  22   KTVDSSLLFEIDHTVKKYADSLLLAIESVSARLSQVETRNRQIETSLDDLKLSVDTNHGS  81

Query  441  TDGKLRQLENILR  479
            TDGKL+ +E+I R
Sbjct  82   TDGKLKLVESIFR  94



>ref|XP_010420094.1| PREDICTED: protein transport protein sec31-like [Camelina sativa]
Length=545

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            ++++ +D  MK  ++ L+  IE +S RL+QLE++   LEN ++D+KVS+   HG TDGKL
Sbjct  125  AILSAIDLTMKAHADNLIHVIEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGITDGKL  184

Query  456  RQLENILRE  482
            RQLENI+ E
Sbjct  185  RQLENIMLE  193



>gb|EPS66622.1| hypothetical protein M569_08156, partial [Genlisea aurea]
Length=164

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N S+++E+DRIMK+  + L  +++ ++ RLSQL+++ H +EN++ DL++SI+  H  TD 
Sbjct  44   NTSLISEIDRIMKKYMDDLSHSVDTITARLSQLDTRTHKIENAIEDLELSIDNKHAITDV  103

Query  450  KLRQLENILRE  482
            K+  LENI+ E
Sbjct  104  KMTALENIMNE  114



>gb|ADE75761.1| unknown [Picea sitchensis]
Length=534

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  282  VAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQ  461
            V  V+RIMK+  + LL A+E +S RLS LES   +LE S+ +LK++++ +HG TDGKLR 
Sbjct  102  VEAVERIMKQYIDNLLHALEGISRRLSHLESTTRHLETSLGELKMTVDNNHGATDGKLRL  161

Query  462  LENILRE  482
            LEN  RE
Sbjct  162  LENHTRE  168



>ref|XP_006579780.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
isoform X2 [Glycine max]
Length=463

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = +3

Query  279  MVAEVDRIMKELSNK-LLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            M++++DR  K+   + +L  +   S RL+QLE++ H+LENS+ +LKVS+  +HG TDGKL
Sbjct  1    MLSKIDRTKKKKHKENMLHVLAGASARLTQLETRTHHLENSVENLKVSVGNNHGSTDGKL  60

Query  456  RQLENILRE  482
            RQL NIL E
Sbjct  61   RQLANILGE  69



>ref|XP_002985569.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
 gb|EFJ13443.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
Length=538

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            +  A V+R MK+ ++ LLR +E + GRLSQLE+    LE +    K +   +HG+TDG+L
Sbjct  121  ATAAAVERTMKKYADNLLRVLEGMGGRLSQLEAATQRLEVAFEKSKSANANNHGETDGRL  180

Query  456  RQLENILRE  482
            R LEN+LRE
Sbjct  181  RMLENMLRE  189



>ref|XP_002987005.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
 gb|EFJ11848.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
Length=548

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  276  SMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKL  455
            +  A V+R MK+ ++ LLR +E + GRLSQLE+    LE +    K +   +HG+TDG+L
Sbjct  121  ATAAAVERTMKKYADNLLRVLEGMGGRLSQLEAATQRLEVAFEKSKSANANNHGETDGRL  180

Query  456  RQLENILRE  482
            R LEN+LRE
Sbjct  181  RMLENMLRE  189



>ref|XP_006844887.1| hypothetical protein AMTR_s00058p00125550 [Amborella trichopoda]
 gb|ERN06562.1| hypothetical protein AMTR_s00058p00125550 [Amborella trichopoda]
Length=532

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +3

Query  186  RNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQ  365
            + R +G P    S L+        N+  N+ ++  V++ MK+  + LL  IE +SGR+SQ
Sbjct  4    KKREFGEPTIGRSFLN---VCNEQNEDFNVEVITTVEKTMKKCMDTLLCFIEGISGRMSQ  60

Query  366  LESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +ES    +E S+ +L+    +DHG+++ KL  LE  L+E
Sbjct  61   MESYCCNIERSIGELRSDFVHDHGESNSKLTSLEKHLQE  99



>ref|XP_009628597.1| PREDICTED: ataxin-2 homolog [Nicotiana tomentosiformis]
Length=535

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/101 (32%), Positives = 56/101 (55%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H++R     +T SS       +     S N  M+  V++ MK+ ++ L+R +E +S RL
Sbjct  52   FHKSR-----MTRSSMFPAPAYSPPEESSFNQDMICTVEKTMKKYADNLMRFLEGISSRL  106

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DHG+ D KL+ LE  ++E
Sbjct  107  SQLELYCYNLDKSIGEMRSDLVRDHGEADSKLKALEKHVQE  147



>ref|XP_004303103.1| PREDICTED: transcriptional regulator DEF1 [Fragaria vesca subsp. 
vesca]
Length=540

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 60/101 (59%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H++R   +P+ SS++  Q         S N  ++A V++ MK+ ++ L+R +E +S RL
Sbjct  54   FHKSRMARSPMYSSAAYGQ------PEDSLNQEVIATVEKSMKKYADNLMRFLEGISSRL  107

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DHG+ D KL+ LE  L+E
Sbjct  108  SQLELYCYNLDKSIGEMRSDLNRDHGEADTKLKSLEKHLQE  148



>ref|XP_008337475.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
[Malus domestica]
Length=521

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/101 (32%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H++R     + SS +  Q        +S +  ++A V++ MK+ ++ L+R +E +S RL
Sbjct  53   FHKSRMSRQSMFSSPAYSQ------PEESLHQDVIATVEKSMKKYADNLMRFLEGISSRL  106

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DHG+ D KL+ LE  L+E
Sbjct  107  SQLELYCYNLDKSIGEMRTDLGRDHGEADSKLKSLEKHLQE  147



>gb|KDO69525.1| hypothetical protein CISIN_1g009789mg [Citrus sinensis]
Length=421

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  378  MHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            M  +ENS++DLKV+IEY++GKTDGKLR+L+NI+RE
Sbjct  1    MRRVENSVDDLKVAIEYNYGKTDGKLRELDNIMRE  35



>ref|XP_009782624.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=539

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  M+  VD+ MK+ ++ ++R +E +S RLSQLE   + L+ S+ +++  +  DHG+ D 
Sbjct  80   NQDMICTVDKTMKKYADNIMRFLEGISSRLSQLELYCYNLDKSIGEMRADLVRDHGEADS  139

Query  450  KLRQLENILRE  482
            KL+ LE  ++E
Sbjct  140  KLKALEKHVQE  150



>ref|XP_010242911.1| PREDICTED: RNA polymerase II degradation factor 1 [Nelumbo nucifera]
Length=560

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  261  KSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGK  440
            +S N  ++A V+R MK+ ++ LLR +E +SGRL QLE   + LE S+ +++  +E D+ +
Sbjct  72   ESFNQEVIATVERTMKKYADNLLRFLEGISGRLQQLELYCYNLEKSVGEMRSDLERDNNE  131

Query  441  TDGKLRQLENILRE  482
             + KL+ LE  ++E
Sbjct  132  ANSKLKSLEKHVQE  145



>ref|XP_004243351.1| PREDICTED: bromodomain-containing protein 4-like [Solanum lycopersicum]
Length=537

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/101 (31%), Positives = 56/101 (55%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H++R     +T SS       +     S N  M+  +++ MK+ ++ L+R +E +S RL
Sbjct  54   FHKSR-----MTRSSMFPAPAYSPPEESSFNQDMICTIEKTMKKYTDNLMRFLEGISSRL  108

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DHG+ D KL+ LE  ++E
Sbjct  109  SQLELYCYNLDKSIGEMRSDLVRDHGEADSKLKALEKHVQE  149



>ref|XP_009782976.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Nicotiana sylvestris]
Length=535

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H++R     +T SS       +     S N  M++ V++ MK+ ++ L+R +E +S RL
Sbjct  52   FHKSR-----MTRSSMFPAPAYSPPEESSFNQDMISTVEKTMKKYADNLMRFLEGISSRL  106

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DHG+ D KL+ LE  ++E
Sbjct  107  SQLELYCYNLDKSIGEMRSDLVRDHGEADSKLKALEKHVQE  147



>emb|CDP14783.1| unnamed protein product [Coffea canephora]
Length=539

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H+NR     +  SS       +     S N  ++A V+R MK+ ++ L+R +E +S RL
Sbjct  56   FHKNR-----MARSSVFPAASYSPPEESSFNQDVIATVERTMKKYADNLMRFLEGISSRL  110

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DH + + KL+ LE  L+E
Sbjct  111  SQLELYCYNLDKSIAEMRSELGGDHTEAETKLKSLEKHLQE  151



>ref|XP_006357482.1| PREDICTED: transcription factor SPT20 homolog [Solanum tuberosum]
Length=537

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 56/101 (55%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H++R     +T SS       +     S N  M+  +++ MK+ ++ L+R +E +S RL
Sbjct  54   FHKSR-----MTRSSMFPAPAYSPPEESSFNQDMICTIEKTMKKYTDNLMRFLEGISSRL  108

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DHG+ D KL+ LE  ++E
Sbjct  109  SQLELYCYNLDKSIGEMRSDLVRDHGEADSKLKALEKHVQE  149



>ref|XP_009628959.1| PREDICTED: extensin-like [Nicotiana tomentosiformis]
Length=534

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  M+  V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG+ D 
Sbjct  80   NQDMICTVEKTMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRADLVRDHGEADS  139

Query  450  KLRQLENILRE  482
            KL+ LE  ++E
Sbjct  140  KLKALEKHVQE  150



>ref|XP_010496293.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Camelina 
sativa]
Length=478

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 83/176 (47%), Gaps = 37/176 (21%)
 Frame = +3

Query  54   KTTEFMDKQVMELSESQFEDHSFRFLeadtd-ddeeeaVDQFRLHRNRHY-GAPLTSSSS  227
            ++++FMDKQ+M+LS S      F FL  D   + +EE V  +     R    APL+ S S
Sbjct  4    RSSQFMDKQIMDLSSSP-PSTDFNFLVNDHIHNKKEEIVPSYDFQPIRSTSAAPLSHSPS  62

Query  228  -------------------------LDQIGSTKTTNK------SNNMSMVAEVDRIMKEL  314
                                     LD I  +K          SN  ++++E+D  +K+ 
Sbjct  63   DLLGSTTTSSSTEPRVNWSSKGFGSLDSIEPSKLVPDDKAHYVSNTTTILSEIDTTVKKH  122

Query  315  SNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             + LL  +E +  RL+QLE++   L+N ++DLKVS++     TD K  QL  IL E
Sbjct  123  VDTLLHVMESVCSRLTQLETRTLNLQNLVDDLKVSVD---NTTDAKFTQLTTILLE  175



>ref|XP_004248167.1| PREDICTED: bromodomain-containing protein 4 [Solanum lycopersicum]
Length=545

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H+NR     +T SS       +     S N  M+  V++ MK+ ++ L+R +E +S RL
Sbjct  55   FHKNR-----MTRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYTDNLMRFLEGISSRL  109

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DHG+ D KL+ LE  ++E
Sbjct  110  SQLELYCYNLDKSIGEMRSDLVRDHGEADLKLKALEKHVQE  150



>ref|XP_006367642.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
[Solanum tuberosum]
Length=548

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 5/101 (5%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H+NR     +T SS       +     S N  M+  V++ MK+ ++ L+R +E +S RL
Sbjct  55   FHKNR-----MTRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYTDNLMRFLEGISSRL  109

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DHG+ D KL+ LE  ++E
Sbjct  110  SQLELYCYNLDKSIGEMRSDLVRDHGEADLKLKALEKHVQE  150



>ref|XP_009336199.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Pyrus x bretschneideri]
Length=521

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 31/101 (31%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
            +HR+R    P+ SS +  Q        +S +  + A V++ MK+ ++ L+R +E +S RL
Sbjct  53   IHRSRLARQPMFSSPAFSQ------PEESLHQDVTATVEKSMKKYADNLMRFLEGISSRL  106

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + ++ S+ +++  +  DH + + KL+ LE  L+E
Sbjct  107  SQLELYCYNVDKSIGEMRSELGRDHEEAESKLKSLEKHLQE  147



>ref|XP_009336198.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Pyrus x bretschneideri]
Length=522

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 31/101 (31%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
            +HR+R    P+ SS +  Q        +S +  + A V++ MK+ ++ L+R +E +S RL
Sbjct  54   IHRSRLARQPMFSSPAFSQ------PEESLHQDVTATVEKSMKKYADNLMRFLEGISSRL  107

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + ++ S+ +++  +  DH + + KL+ LE  L+E
Sbjct  108  SQLELYCYNVDKSIGEMRSELGRDHEEAESKLKSLEKHLQE  148



>ref|XP_008341426.1| PREDICTED: YLP motif-containing protein 1-like [Malus domestica]
Length=552

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +3

Query  201  GAPLTSSSSLDQIGSTKTT-NKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESK  377
             +P+ +  S+D +   K    K  N+ +++E+D+ MK+ ++ LL  +E +S RL+QLES+
Sbjct  107  ASPIRNYGSMDSLEPAKLVLEKDRNVVILSEIDQTMKKHADNLLHVLEGVSARLTQLESR  166

Query  378  MHYLENSMNDLK  413
               LENS++DLK
Sbjct  167  SRNLENSVDDLK  178



>ref|XP_009341977.1| PREDICTED: ATP-dependent helicase brm-like isoform X2 [Pyrus 
x bretschneideri]
Length=521

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 31/101 (31%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             HR+R    P+ SS +  Q        +S +  + A V++ MK+ ++ L+R +E +S RL
Sbjct  53   FHRSRMSRQPMFSSPAFSQ------PEESLHQDVTATVEKSMKKYADNLMRFLEGISSRL  106

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + ++ S+ +++  +  DH + + KL+ LE  L+E
Sbjct  107  SQLELYCYNVDKSIGEMRSDLGRDHEEAESKLKSLEKHLQE  147



>ref|XP_009341976.1| PREDICTED: ATP-dependent helicase brm-like isoform X1 [Pyrus 
x bretschneideri]
Length=522

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 31/101 (31%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             HR+R    P+ SS +  Q        +S +  + A V++ MK+ ++ L+R +E +S RL
Sbjct  54   FHRSRMSRQPMFSSPAFSQ------PEESLHQDVTATVEKSMKKYADNLMRFLEGISSRL  107

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + ++ S+ +++  +  DH + + KL+ LE  L+E
Sbjct  108  SQLELYCYNVDKSIGEMRSDLGRDHEEAESKLKSLEKHLQE  148



>ref|XP_004506616.1| PREDICTED: transcription factor SPT20 homolog [Cicer arietinum]
Length=523

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG+ D KL+
Sbjct  81   VIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLNRDHGEQDSKLK  140

Query  459  QLENILRE  482
             LE  L+E
Sbjct  141  SLEKHLQE  148



>emb|CBI21851.3| unnamed protein product [Vitis vinifera]
Length=151

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  M++ V++ +K+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG+ D 
Sbjct  75   NQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGEADS  134

Query  450  KLRQLENILRE  482
            KL+ L+  ++E
Sbjct  135  KLKSLDKHIQE  145



>ref|XP_008229157.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X1 [Prunus mume]
Length=530

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG+ D KL+
Sbjct  82   VIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGEADSKLK  141

Query  459  QLENILRE  482
             LE  L+E
Sbjct  142  SLEKHLQE  149



>ref|XP_008229158.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X2 [Prunus mume]
Length=529

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG+ D KL+
Sbjct  81   VIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGEADSKLK  140

Query  459  QLENILRE  482
             LE  L+E
Sbjct  141  SLEKHLQE  148



>ref|XP_007198900.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
 gb|EMJ00099.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
Length=529

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG+ D KL+
Sbjct  81   VIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGEADSKLK  140

Query  459  QLENILRE  482
             LE  L+E
Sbjct  141  SLEKHLQE  148



>ref|XP_009357856.1| PREDICTED: putative uncharacterized protein DDB_G0294196 [Pyrus 
x bretschneideri]
 ref|XP_009357877.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Pyrus x bretschneideri]
Length=521

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/101 (31%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
             H++R     + SS +  Q        +S +  ++A V++ MK+ ++ L+R +E +S RL
Sbjct  53   FHKSRMSRQSMFSSPAYSQ------PEESLHQDVIATVEKSMKKYADNLMRFLEGISSRL  106

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + L+ S+ +++  +  DH + D KL+ LE  L+E
Sbjct  107  SQLELYCYNLDKSIGEMRSDLGRDHEEADSKLKSLEKHLQE  147



>ref|XP_002272844.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Vitis 
vinifera]
Length=550

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  264  SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKT  443
            S N  M++ V++ +K+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG+ 
Sbjct  73   SLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGEA  132

Query  444  DGKLRQLENILRE  482
            D KL+ L+  ++E
Sbjct  133  DSKLKSLDKHIQE  145



>ref|XP_010110218.1| hypothetical protein L484_009824 [Morus notabilis]
 gb|EXC25515.1| hypothetical protein L484_009824 [Morus notabilis]
Length=527

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 58/110 (53%), Gaps = 12/110 (11%)
 Frame = +3

Query  189  NRHYGAPLTSSSSLDQIGSTK------------TTNKSNNMSMVAEVDRIMKELSNKLLR  332
            N  +  P+ SSSS     +T+                S N  +++ V++ MK  ++ L+R
Sbjct  37   NGGHSEPVISSSSGKDFHNTRRGRSVFTGAAYTQPEDSFNQDVISAVEKSMKRNADNLMR  96

Query  333  AIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
             +E +S RLSQLE   + L+ S+ +++  +  DHG+ D KL+ ++  L+E
Sbjct  97   FLEGISSRLSQLELYCYNLDKSIGEMRSDLIRDHGEADSKLKAIDKHLQE  146



>ref|XP_009377181.1| PREDICTED: protein transport protein SEC31-like [Pyrus x bretschneideri]
Length=552

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +3

Query  201  GAPLTSSSSLDQIGSTKTT-NKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESK  377
             +P+ +  S+D +   K    K  N  + +E+D+ MK+ ++ LL  +E +S RL+QLES+
Sbjct  107  ASPIRNYGSMDSLEPAKLVLEKDRNAVIQSEIDQTMKKHADNLLHVLEGVSARLTQLESR  166

Query  378  MHYLENSMNDLK  413
               LE+S+NDLK
Sbjct  167  SRNLEDSVNDLK  178



>gb|KEH17617.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=527

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG  D KL+
Sbjct  74   VIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEIRSDLNRDHGDQDSKLK  133

Query  459  QLENILRE  482
             LE  ++E
Sbjct  134  SLEKHVQE  141



>gb|KDO51849.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=549

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  +V+ V+  MK+ ++ ++R +E +S RLSQLE   + L+ SM +++  +  DHG+ D 
Sbjct  75   NEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSMVEMRSDLVRDHGEADT  134

Query  450  KLRQLENILRE  482
            KL+ LE  L+E
Sbjct  135  KLKSLEKHLQE  145



>gb|KDO51850.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=550

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  +V+ V+  MK+ ++ ++R +E +S RLSQLE   + L+ SM +++  +  DHG+ D 
Sbjct  76   NEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSMVEMRSDLVRDHGEADT  135

Query  450  KLRQLENILRE  482
            KL+ LE  L+E
Sbjct  136  KLKSLEKHLQE  146



>ref|XP_010035753.1| PREDICTED: RNA polymerase II degradation factor 1-like [Eucalyptus 
grandis]
 gb|KCW47211.1| hypothetical protein EUGRSUZ_K01026 [Eucalyptus grandis]
Length=535

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  ++A V++ MK+ ++ L+R +E +S RLS+LE   + L+ S+ +++  +  DHG  D 
Sbjct  79   NQDLIASVEKSMKKHTDSLMRFLEGISSRLSELELYCYNLDKSIGEMRSQLNRDHGDADT  138

Query  450  KLRQLENILRE  482
            KL+ L+  L+E
Sbjct  139  KLKSLDKHLQE  149



>ref|XP_009395702.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=581

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/68 (37%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            +++ V++ MK+ ++ LLR+++ +SGRLSQLE   + LE S+ +L+     D  + D K +
Sbjct  73   IISAVEKCMKKYADNLLRSLDGISGRLSQLEIFCYKLERSLGELRADFLQDQSEKDLKFK  132

Query  459  QLENILRE  482
             LE  L+E
Sbjct  133  SLEKHLQE  140



>ref|XP_006447363.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60603.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=554

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  +V+ V+  MK+ ++ ++R +E +S RLSQLE   + L+ SM +++  +  DHG+ D 
Sbjct  76   NEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSMVEMRSDLVRDHGEADT  135

Query  450  KLRQLENILRE  482
            KL+ LE  L+E
Sbjct  136  KLKSLEKHLQE  146



>ref|XP_006447362.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60602.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=553

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  +V+ V+  MK+ ++ ++R +E +S RLSQLE   + L+ SM +++  +  DHG+ D 
Sbjct  75   NEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDKSMVEMRSDLVRDHGEADT  134

Query  450  KLRQLENILRE  482
            KL+ LE  L+E
Sbjct  135  KLKSLEKHLQE  145



>ref|XP_008342911.1| PREDICTED: extensin-like isoform X2 [Malus domestica]
Length=521

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/101 (30%), Positives = 56/101 (55%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
              R+R    P+ SS +  Q        +S +  + A V++ MK+ ++ L+R +E +S RL
Sbjct  53   FQRSRMSRQPMFSSPAYSQ------PEESLHQDVTATVEKSMKKYADNLMRFLEGISSRL  106

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + ++ S+ +++  +  DH + + KL+ LE  L+E
Sbjct  107  SQLELYCYNVDKSIGEMRSDLGRDHEEAESKLKSLEKHLQE  147



>ref|XP_010051997.1| PREDICTED: LOW QUALITY PROTEIN: bromodomain-containing protein 
4 [Eucalyptus grandis]
Length=513

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/80 (33%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +3

Query  243  STKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSI  422
            S+     S N  +V+ V++ MK  ++ ++R +E +S RLSQLE   + L+ S+ +++  +
Sbjct  23   SSTQPEDSXNSDLVSTVEKSMKRNTDSIMRFLEGISSRLSQLELYCYNLDKSIGEMRSEL  82

Query  423  EYDHGKTDGKLRQLENILRE  482
              DH + D KL+ LE  ++E
Sbjct  83   TRDHDEADVKLKSLEKHVQE  102



>ref|XP_003539922.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoformX1 [Glycine max]
Length=533

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  264  SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKT  443
            S +  ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ ++K  I  DH + 
Sbjct  64   SLSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMKCDINRDHVEQ  123

Query  444  DGKLRQLENILRE  482
            + +L+ LE  ++E
Sbjct  124  ESRLKSLEKHVQE  136



>ref|XP_008342910.1| PREDICTED: extensin-like isoform X1 [Malus domestica]
Length=522

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/101 (30%), Positives = 56/101 (55%), Gaps = 6/101 (6%)
 Frame = +3

Query  180  LHRNRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRL  359
              R+R    P+ SS +  Q        +S +  + A V++ MK+ ++ L+R +E +S RL
Sbjct  54   FQRSRMSRQPMFSSPAYSQ------PEESLHQDVTATVEKSMKKYADNLMRFLEGISSRL  107

Query  360  SQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            SQLE   + ++ S+ +++  +  DH + + KL+ LE  L+E
Sbjct  108  SQLELYCYNVDKSIGEMRSDLGRDHEEAESKLKSLEKHLQE  148



>ref|XP_006592435.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoform X2 [Glycine max]
Length=534

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  264  SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKT  443
            S +  ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ ++K  I  DH + 
Sbjct  65   SLSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMKCDINRDHVEQ  124

Query  444  DGKLRQLENILRE  482
            + +L+ LE  ++E
Sbjct  125  ESRLKSLEKHVQE  137



>ref|XP_010689008.1| PREDICTED: RNA polymerase II degradation factor 1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            +++ V+R MK+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DH + D KL+
Sbjct  81   LISAVERTMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLGRDHSEADSKLK  140

Query  459  QLENILRE  482
             LE  L+E
Sbjct  141  FLEKHLQE  148



>ref|XP_004136824.1| PREDICTED: uncharacterized protein LOC101206745 [Cucumis sativus]
 ref|XP_004155474.1| PREDICTED: uncharacterized protein LOC101231079 [Cucumis sativus]
 gb|KGN43616.1| hypothetical protein Csa_7G048000 [Cucumis sativus]
Length=515

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            + ++++ V+  MK+ S+ LLR +E +S RLSQLE   + L+ S+ +++  +  DH + D 
Sbjct  75   SQNVISTVENSMKKHSDNLLRFLEGISSRLSQLELYCYNLDKSVGEMRSELARDHEEADS  134

Query  450  KLRQLENILRE  482
            KL+ LE  ++E
Sbjct  135  KLKSLEKHVQE  145



>ref|XP_008455322.1| PREDICTED: transcription factor SPT20 homolog [Cucumis melo]
Length=514

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            + ++++ V+  MK+ S+ LLR +E +S RLSQLE   + L+ S+ +++  +  DH + D 
Sbjct  75   SQNVISTVENSMKKHSDNLLRFLEGISSRLSQLELYCYNLDKSVGEMRSELARDHEEADS  134

Query  450  KLRQLENILRE  482
            KL+ LE  ++E
Sbjct  135  KLKSLEKHVQE  145



>emb|CAN71577.1| hypothetical protein VITISV_043279 [Vitis vinifera]
Length=292

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  264  SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKT  443
            S N  M++ V++ +K+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG+ 
Sbjct  73   SLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGEA  132

Query  444  DGKLRQLENILRE  482
            D KL+ L+  ++E
Sbjct  133  DSKLKSLDKHIQE  145



>gb|KJB31694.1| hypothetical protein B456_005G201600 [Gossypium raimondii]
Length=546

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            + A V++ MK  ++ L+R +E +S RLSQLE   + L+ S+ D++  + + +G  D KL+
Sbjct  77   VAATVEKTMKRYTDNLMRFLEGISSRLSQLELYCYNLDRSIGDMRADLVHGNGDADSKLK  136

Query  459  QLENILRE  482
             +E  L+E
Sbjct  137  SIEKHLQE  144



>ref|XP_006582794.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Glycine max]
Length=486

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ ++K  I  DH + D +L+
Sbjct  73   VIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMKSDINRDHVEQDSRLK  132

Query  459  QLENILRE  482
             LE  ++E
Sbjct  133  SLEKHVQE  140



>gb|KHN35253.1| hypothetical protein glysoja_042323 [Glycine soja]
Length=531

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ ++K  I  DH + D +L+
Sbjct  73   VIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMKSDINRDHVEQDSRLK  132

Query  459  QLENILRE  482
             LE  ++E
Sbjct  133  SLEKHVQE  140



>ref|XP_001770189.1| predicted protein [Physcomitrella patens]
 gb|EDQ65023.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  345  LSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            +SGRL+QLE+    +E+S++ +KV    + G TDGKLR LEN++RE
Sbjct  1    MSGRLTQLETNSLRMEHSVDKIKVDAADNFGATDGKLRSLENMIRE  46



>gb|KHN31988.1| hypothetical protein glysoja_025822 [Glycine soja]
Length=505

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++A V++ MK+ ++ L+R +E +S RLSQLE   + L+ S+ ++K  I  DH + + +L+
Sbjct  70   VIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMKCDINRDHVEQESRLK  129

Query  459  QLENILRE  482
             LE  ++E
Sbjct  130  SLEKHVQE  137



>ref|XP_010919602.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X2 [Elaeis guineensis]
Length=488

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/68 (37%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++  V++ MK+ ++ LLR++E +SGRLSQLE     +E S+ + +  I  D  +T+ K +
Sbjct  45   VIPAVEKCMKKYADNLLRSLEGISGRLSQLELYCFKIERSIGEFRSDIIRDQSETELKFK  104

Query  459  QLENILRE  482
             LE  L+E
Sbjct  105  TLEKHLQE  112



>emb|CAB79632.1| predicted proline-rich protein [Arabidopsis thaliana]
Length=508

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/98 (29%), Positives = 51/98 (52%), Gaps = 0/98 (0%)
 Frame = +3

Query  189  NRHYGAPLTSSSSLDQIGSTKTTNKSNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQL  368
            N+ +     + SS+    S      S +  +   V+R MK  ++ ++R +E LS RLSQL
Sbjct  51   NKEFHKTRMARSSVFPTSSYSPPEDSLSQDITDTVERTMKMYADNMMRFLEGLSSRLSQL  110

Query  369  ESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLENILRE  482
            E   + L+ ++ +++  + + H   D KLR L+  L+E
Sbjct  111  ELYCYNLDKTIGEMRSELTHAHEDADVKLRSLDKHLQE  148



>gb|EYU28592.1| hypothetical protein MIMGU_mgv1a004659mg [Erythranthe guttata]
Length=516

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  +++ V+  MK+ ++ L+R +E +S RLSQLE   + L+ S+ +++  +  DHG+++ 
Sbjct  79   NQGVISTVENTMKKHTDNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGESES  138

Query  450  KLRQLENILRE  482
            KL+ L+  ++E
Sbjct  139  KLKSLDKHIQE  149



>ref|XP_010919593.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X1 [Elaeis guineensis]
Length=515

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/68 (37%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++  V++ MK+ ++ LLR++E +SGRLSQLE     +E S+ + +  I  D  +T+ K +
Sbjct  72   VIPAVEKCMKKYADNLLRSLEGISGRLSQLELYCFKIERSIGEFRSDIIRDQSETELKFK  131

Query  459  QLENILRE  482
             LE  L+E
Sbjct  132  TLEKHLQE  139



>gb|EEC71500.1| hypothetical protein OsI_03777 [Oryza sativa Indica Group]
Length=595

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +3

Query  291  VDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLEN  470
            V++ MK+ ++ LLR++E ++ RLSQLE   + LE SM +L+  +  D  +TD +L+ LE 
Sbjct  73   VEKCMKKYADNLLRSLEGITNRLSQLEIYCYKLERSMGELRSDVLRD--ETDQRLKSLEK  130

Query  471  ILRE  482
             L E
Sbjct  131  HLHE  134



>ref|NP_001044280.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAD87289.1| putative calcium-binding protein [Oryza sativa Japonica Group]
 dbj|BAF06194.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAG93651.1| unnamed protein product [Oryza sativa Japonica Group]
Length=594

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +3

Query  291  VDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLRQLEN  470
            V++ MK+ ++ LLR++E ++ RLSQLE   + LE SM +L+  +  D  +TD +L+ LE 
Sbjct  72   VEKCMKKYADNLLRSLEGITNRLSQLEIYCYKLERSMGELRSDVLRD--ETDQRLKSLEK  129

Query  471  ILRE  482
             L E
Sbjct  130  HLHE  133



>ref|XP_008798248.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 [Phoenix dactylifera]
Length=514

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/68 (34%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            M+A V++ MK+ ++ +LR +E +SGRLSQL+   + +E S+ + +  +  D  + + K +
Sbjct  70   MIAAVEKCMKKYADNVLRFLEGISGRLSQLDLHCYKIERSIGEFRSDVIRDQNEAEMKFK  129

Query  459  QLENILRE  482
             LE  L+E
Sbjct  130  SLEKHLQE  137



>ref|XP_011098021.1| PREDICTED: extensin [Sesamum indicum]
Length=525

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  270  NMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDG  449
            N  ++  V+  MK+ ++ ++R +E +S R+SQLE   + L+ S+ +++  +  DHG+++ 
Sbjct  79   NQGVITTVENTMKKYTDNIMRFLEGISSRMSQLELYCYNLDKSIGEMRSDLLRDHGESES  138

Query  450  KLRQLENILRE  482
            KL+ LE  ++E
Sbjct  139  KLKSLEKHIQE  149



>ref|XP_003540363.1| PREDICTED: integrator complex subunit 3 homolog isoform 1 [Glycine 
max]
 gb|KHN27890.1| hypothetical protein glysoja_007622 [Glycine soja]
Length=532

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  279  MVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKTDGKLR  458
            ++A V++ MK  ++ L+R +E LS RLSQLE   + L+ S+  ++  +  DH +TD KL+
Sbjct  75   VIAIVEKSMKTHADNLMRFLEGLSTRLSQLELYCYNLDKSIGAMQSDLTCDHEETDSKLK  134

Query  459  QLENILRE  482
             L+  L+E
Sbjct  135  SLDKHLQE  142



>ref|XP_010435634.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Camelina 
sativa]
Length=478

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = +3

Query  264  SNNMSMVAEVDRIMKELSNKLLRAIEDLSGRLSQLESKMHYLENSMNDLKVSIEYDHGKT  443
            SN  ++++++D  +K+  + LL  +E +  RL+QLE++   L+N ++DLKVS++      
Sbjct  101  SNTTTILSDIDSTVKKHVDTLLHVMEAVCARLTQLETRTLNLQNLVDDLKVSVD---NTN  157

Query  444  DGKLRQLENILRE  482
            D K  QL+ IL E
Sbjct  158  DVKFTQLKTILLE  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140