BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF004A03

Length=583
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006353238.1|  PREDICTED: protease Do-like 10, mitochondria...    130   6e-32   Solanum tuberosum [potatoes]
ref|XP_004250091.1|  PREDICTED: protease Do-like 10, mitochondrial      129   2e-31   Solanum lycopersicum
ref|XP_009803816.1|  PREDICTED: protease Do-like 10, mitochondrial      127   1e-30   Nicotiana sylvestris
gb|EYU39504.1|  hypothetical protein MIMGU_mgv1a003194mg                124   1e-29   Erythranthe guttata [common monkey flower]
gb|AFW57240.1|  hypothetical protein ZEAMMB73_939751                    122   2e-29   
ref|XP_011077091.1|  PREDICTED: protease Do-like 10, mitochondrial      124   2e-29   Sesamum indicum [beniseed]
ref|XP_008664017.1|  PREDICTED: uncharacterized protein LOC103642539    122   2e-29   
ref|XP_011011698.1|  PREDICTED: protease Do-like 10, mitochondrial      123   2e-29   Populus euphratica
ref|XP_004962074.1|  PREDICTED: protease Do-like 10, mitochondria...    123   4e-29   Setaria italica
ref|XP_007028417.1|  DegP protease 10 isoform 4                         121   4e-29   
ref|XP_008647597.1|  PREDICTED: hypothetical protein isoform X1         123   4e-29   Zea mays [maize]
ref|XP_009611385.1|  PREDICTED: protease Do-like 10, mitochondrial      122   5e-29   Nicotiana tomentosiformis
ref|XP_007028418.1|  DegP protease 10 isoform 5                         122   6e-29   
ref|XP_010528621.1|  PREDICTED: protease Do-like 10, mitochondrial      122   6e-29   Tarenaya hassleriana [spider flower]
gb|KJB49012.1|  hypothetical protein B456_008G097600                    121   7e-29   Gossypium raimondii
emb|CDP04134.1|  unnamed protein product                                122   7e-29   Coffea canephora [robusta coffee]
ref|XP_007028414.1|  DegP protease 10 isoform 1                         122   8e-29   
ref|NP_001142088.1|  hypothetical protein                               122   9e-29   Zea mays [maize]
gb|KDP32493.1|  hypothetical protein JCGZ_13418                         122   1e-28   Jatropha curcas
ref|XP_007028416.1|  DegP protease 10 isoform 3                         121   1e-28   
ref|XP_007028415.1|  DegP protease 10 isoform 2                         121   1e-28   
ref|XP_002514764.1|  serine endopeptidase degp2, putative               121   1e-28   
gb|KHG11681.1|  hypothetical protein F383_13103                         121   1e-28   Gossypium arboreum [tree cotton]
gb|EEE63742.1|  hypothetical protein OsJ_18561                          121   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441105.1|  hypothetical protein SORBIDRAFT_09g020480          121   2e-28   Sorghum bicolor [broomcorn]
gb|KJB49011.1|  hypothetical protein B456_008G097600                    120   2e-28   Gossypium raimondii
gb|KJB49013.1|  hypothetical protein B456_008G097600                    120   2e-28   Gossypium raimondii
gb|KJB49010.1|  hypothetical protein B456_008G097600                    121   2e-28   Gossypium raimondii
ref|XP_002463281.1|  hypothetical protein SORBIDRAFT_02g041140          121   2e-28   Sorghum bicolor [broomcorn]
ref|NP_001055560.1|  Os05g0417100                                       121   2e-28   
ref|XP_009420477.1|  PREDICTED: protease Do-like 10, mitochondrial      120   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776775.1|  PREDICTED: protease Do-like 10, mitochondria...    119   3e-28   
gb|EAY98063.1|  hypothetical protein OsI_19981                          120   3e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_002265825.2|  PREDICTED: protease Do-like 10, mitochondrial      120   4e-28   Vitis vinifera
ref|XP_002311275.1|  hypothetical protein POPTR_0008s07940g             120   5e-28   
ref|XP_008776774.1|  PREDICTED: protease Do-like 10, mitochondria...    119   6e-28   Phoenix dactylifera
ref|XP_006858733.1|  hypothetical protein AMTR_s00066p00121670          119   6e-28   
ref|XP_010927886.1|  PREDICTED: protease Do-like 10, mitochondrial      119   7e-28   Elaeis guineensis
gb|EPS58030.1|  hypothetical protein M569_16788                         114   1e-27   Genlisea aurea
ref|XP_003568444.1|  PREDICTED: protease Do-like 10, mitochondrial      118   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_006468667.1|  PREDICTED: protease Do-like 10, mitochondria...    117   4e-27   Citrus sinensis [apfelsine]
gb|KDO77072.1|  hypothetical protein CISIN_1g007765mg                   115   6e-27   Citrus sinensis [apfelsine]
ref|XP_007211387.1|  hypothetical protein PRUPE_ppa003181mg             117   7e-27   Prunus persica
ref|XP_010673840.1|  PREDICTED: protease Do-like 10, mitochondrial      117   8e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006448510.1|  hypothetical protein CICLE_v10014700mg             116   1e-26   Citrus clementina [clementine]
ref|XP_010277816.1|  PREDICTED: protease Do-like 10, mitochondrial      116   1e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008224670.1|  PREDICTED: protease Do-like 10, mitochondrial      116   1e-26   Prunus mume [ume]
gb|KDO77071.1|  hypothetical protein CISIN_1g007765mg                   114   2e-26   Citrus sinensis [apfelsine]
gb|EMS52153.1|  Protease Do-like 10, mitochondrial                      114   5e-26   Triticum urartu
ref|XP_006858734.1|  hypothetical protein AMTR_s00066p00122890          114   5e-26   Amborella trichopoda
ref|NP_568543.1|  protease Do-like 10                                   113   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868484.1|  DEGP10                                             113   2e-25   
ref|XP_006283411.1|  hypothetical protein CARUB_v10004459mg             110   1e-24   Capsella rubella
ref|XP_008377055.1|  PREDICTED: protease Do-like 10, mitochondrial      110   1e-24   
ref|XP_010450457.1|  PREDICTED: protease Do-like 10, mitochondrial      110   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_008441958.1|  PREDICTED: protease Do-like 10, mitochondrial      110   1e-24   
ref|XP_010435521.1|  PREDICTED: protease Do-like 10, mitochondrial      110   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010440803.1|  PREDICTED: protease Do-like 10, mitochondria...    110   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009139697.1|  PREDICTED: protease Do-like 10, mitochondrial      110   2e-24   Brassica rapa
emb|CDX74606.1|  BnaA04g07830D                                          110   2e-24   
ref|XP_004293434.2|  PREDICTED: protease Do-like 10, mitochondrial      109   2e-24   Fragaria vesca subsp. vesca
ref|XP_004152886.1|  PREDICTED: protease Do-like 10, mitochondria...    109   3e-24   Cucumis sativus [cucumbers]
ref|XP_004155122.1|  PREDICTED: protease Do-like 10, mitochondria...    109   3e-24   
ref|XP_006405960.1|  hypothetical protein EUTSA_v10027701mg             109   4e-24   Eutrema salsugineum [saltwater cress]
gb|KCW54014.1|  hypothetical protein EUGRSUZ_I00006                     107   4e-24   Eucalyptus grandis [rose gum]
emb|CDY53528.1|  BnaCnng25320D                                          108   6e-24   Brassica napus [oilseed rape]
ref|XP_007150859.1|  hypothetical protein PHAVU_004G000300g             107   1e-23   Phaseolus vulgaris [French bean]
ref|XP_010027457.1|  PREDICTED: protease Do-like 10, mitochondrial      107   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010110145.1|  Protease Do-like 10                                105   8e-23   Morus notabilis
gb|KEH24728.1|  DegP protease                                           104   2e-22   Medicago truncatula
ref|XP_003534464.1|  PREDICTED: protease Do-like 10, mitochondria...    103   4e-22   Glycine max [soybeans]
ref|XP_004489189.1|  PREDICTED: protease Do-like 10, mitochondria...    102   7e-22   Cicer arietinum [garbanzo]
ref|XP_006655329.1|  PREDICTED: protease Do-like 10, mitochondria...  99.0    8e-21   
gb|KCW54067.1|  hypothetical protein EUGRSUZ_I00047                   94.4    4e-19   Eucalyptus grandis [rose gum]
gb|KFK31613.1|  hypothetical protein AALP_AA6G135800                  92.4    5e-19   Arabis alpina [alpine rockcress]
ref|XP_010027524.1|  PREDICTED: protease Do-like 10, mitochondrial    94.7    5e-19   Eucalyptus grandis [rose gum]
ref|XP_010027526.1|  PREDICTED: protease Do-like 10, mitochondria...  93.2    1e-18   Eucalyptus grandis [rose gum]
ref|XP_010027525.1|  PREDICTED: protease Do-like 10, mitochondria...  93.2    2e-18   Eucalyptus grandis [rose gum]
gb|KCW54111.1|  hypothetical protein EUGRSUZ_I000921                  91.3    2e-18   Eucalyptus grandis [rose gum]
gb|KCW54109.1|  hypothetical protein EUGRSUZ_I00090                   89.0    2e-18   Eucalyptus grandis [rose gum]
ref|XP_010027559.1|  PREDICTED: protease Do-like 10, mitochondrial    91.3    7e-18   Eucalyptus grandis [rose gum]
ref|XP_010042932.1|  PREDICTED: protease Do-like 10, mitochondria...  89.0    1e-17   Eucalyptus grandis [rose gum]
ref|XP_010042933.1|  PREDICTED: protease Do-like 10, mitochondria...  88.6    1e-17   
ref|XP_002963416.1|  hypothetical protein SELMODRAFT_62730            89.0    3e-17   
ref|XP_002971553.1|  hypothetical protein SELMODRAFT_62447            88.6    4e-17   
ref|XP_003288812.1|  hypothetical protein DICPUDRAFT_153086           88.6    6e-17   Dictyostelium purpureum
ref|NP_564856.1|  putativeDegP protease 3                             88.6    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030295.1|  PREDICTED: uncharacterized protein LOC104420090  89.0    9e-17   
ref|XP_002888435.1|  predicted protein                                87.4    1e-16   
ref|XP_640805.1|  hypothetical protein DDB_G0281081                   87.8    1e-16   Dictyostelium discoideum AX4
emb|CDY35320.1|  BnaA04g15270D                                        85.1    1e-15   Brassica napus [oilseed rape]
ref|XP_005831529.1|  hypothetical protein GUITHDRAFT_72154            83.6    1e-15   Guillardia theta CCMP2712
ref|NP_564857.2|  DegP protease 4                                     84.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ABE65743.1|  DegP protease                                         84.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAB60913.1|  F5I14.17 gene product                                 84.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SHZ0.1|DEGP4_ARATH  RecName: Full=Protease Do-like 4, mitoch...  84.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004357429.1|  hypothetical protein DFA_02707                   84.0    3e-15   Cavenderia fasciculata
ref|XP_002888434.1|  predicted protein                                83.2    4e-15   
ref|XP_010511113.1|  PREDICTED: putative protease Do-like 3, mito...  83.2    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010418975.1|  PREDICTED: putative protease Do-like 3, mito...  82.4    9e-15   Camelina sativa [gold-of-pleasure]
gb|EFA82977.1|  hypothetical protein PPL_03755                        82.0    1e-14   Heterostelium album PN500
emb|CDY66494.1|  BnaCnng51100D                                        80.9    2e-14   Brassica napus [oilseed rape]
ref|XP_002951860.1|  trypsin family                                   80.9    2e-14   Volvox carteri f. nagariensis
ref|XP_006286181.1|  hypothetical protein CARUB_v10007745mg           80.5    2e-14   
ref|XP_010436835.1|  PREDICTED: LOW QUALITY PROTEIN: putative pro...  80.5    4e-14   
ref|XP_002886956.1|  hypothetical protein ARALYDRAFT_315601           80.1    4e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_009140719.1|  PREDICTED: putative protease Do-like 3, mito...  80.1    6e-14   Brassica rapa
ref|XP_010513422.1|  PREDICTED: putative protease Do-like 3, mito...  79.3    7e-14   Camelina sativa [gold-of-pleasure]
gb|AAB60923.1|  F5I14.16                                              79.3    8e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|GAM25013.1|  hypothetical protein SAMD00019534_081880             79.3    9e-14   Acytostelium subglobosum LB1
ref|XP_006301507.1|  hypothetical protein CARUB_v10021933mg           79.3    9e-14   Capsella rubella
sp|Q9FM41.1|DGP13_ARATH  RecName: Full=Putative protease Do-like 13   79.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002499997.1|  predicted protein                                78.6    1e-13   Micromonas commoda
ref|XP_002886957.1|  hypothetical protein ARALYDRAFT_894151           77.8    2e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_006391531.1|  hypothetical protein EUTSA_v10019570mg           75.9    1e-12   
ref|XP_003055699.1|  predicted protein                                75.1    2e-12   Micromonas pusilla CCMP1545
gb|EYU42546.1|  hypothetical protein MIMGU_mgv1a0052331mg             70.5    3e-12   Erythranthe guttata [common monkey flower]
ref|XP_006339987.1|  PREDICTED: protease Do-like 9-like               74.7    4e-12   Solanum tuberosum [potatoes]
gb|KDD74963.1|  hypothetical protein H632_c960p1                      74.3    4e-12   Helicosporidium sp. ATCC 50920
emb|CDY07457.1|  BnaA07g25360D                                        73.9    4e-12   Brassica napus [oilseed rape]
ref|XP_002502087.1|  predicted protein                                73.9    4e-12   Micromonas commoda
ref|XP_009105158.1|  PREDICTED: putative protease Do-like 3, mito...  73.9    4e-12   Brassica rapa
gb|KIY96346.1|  Protease Do-like 10                                   72.0    4e-12   Monoraphidium neglectum
ref|XP_004344572.1|  DegPtype protease                                73.9    6e-12   Acanthamoeba castellanii str. Neff
gb|KFK41004.1|  hypothetical protein AALP_AA2G073000                  72.8    1e-11   Arabis alpina [alpine rockcress]
ref|XP_002985706.1|  hypothetical protein SELMODRAFT_122577           72.8    1e-11   
ref|XP_005845738.1|  hypothetical protein CHLNCDRAFT_58432            73.6    1e-11   Chlorella variabilis
ref|NP_680437.1|  degradation of periplasmic protein 16               70.1    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011399889.1|  Protease Do-like 9                               71.6    3e-11   Auxenochlorella protothecoides
ref|XP_002866058.1|  hypothetical protein ARALYDRAFT_357728           71.2    4e-11   
ref|XP_004252189.1|  PREDICTED: protease Do-like 9                    71.2    4e-11   Solanum lycopersicum
ref|XP_001748733.1|  hypothetical protein                             71.2    5e-11   Monosiga brevicollis MX1
ref|XP_010440805.1|  PREDICTED: protease Do-like 10, mitochondria...  70.9    6e-11   
ref|XP_008353481.1|  PREDICTED: protease Do-like 9                    70.5    6e-11   
ref|XP_008341480.1|  PREDICTED: protease Do-like 9                    70.9    7e-11   
ref|XP_009349862.1|  PREDICTED: protease Do-like 9                    70.5    7e-11   Pyrus x bretschneideri [bai li]
ref|XP_004306333.2|  PREDICTED: protease Do-like 9                    70.5    8e-11   Fragaria vesca subsp. vesca
ref|XP_003057446.1|  predicted protein                                70.1    8e-11   Micromonas pusilla CCMP1545
gb|AAG50541.1|AC079828_12  hypothetical protein                       68.2    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405537.1|  hypothetical protein EUTSA_v10027697mg           70.5    9e-11   Eutrema salsugineum [saltwater cress]
ref|NP_175527.2|  DegP protease 6                                     67.8    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678715.1|  PREDICTED: protease Do-like 9                    69.7    1e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004306334.1|  PREDICTED: protease Do-like 9                    70.1    1e-10   Fragaria vesca subsp. vesca
ref|XP_009348028.1|  PREDICTED: protease Do-like 9                    69.7    1e-10   
ref|XP_009609751.1|  PREDICTED: protease Do-like 9                    69.7    1e-10   Nicotiana tomentosiformis
ref|XP_009794183.1|  PREDICTED: protease Do-like 9                    69.7    1e-10   Nicotiana sylvestris
ref|XP_010254385.1|  PREDICTED: protease Do-like 9                    69.7    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010272002.1|  PREDICTED: protease Do-like 9                    69.3    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_007216372.1|  hypothetical protein PRUPE_ppa021785mg           69.3    2e-10   
ref|XP_001693806.1|  predicted protein                                66.6    2e-10   Chlamydomonas reinhardtii
ref|XP_008230647.1|  PREDICTED: protease Do-like 9                    69.3    2e-10   Prunus mume [ume]
emb|CBI34956.3|  unnamed protein product                              68.9    2e-10   Vitis vinifera
ref|XP_002275131.1|  PREDICTED: protease Do-like 9                    68.9    2e-10   Vitis vinifera
emb|CAN62736.1|  hypothetical protein VITISV_027750                   68.9    2e-10   Vitis vinifera
ref|XP_008348037.1|  PREDICTED: protease Do-like 9                    68.9    3e-10   
ref|XP_009344540.1|  PREDICTED: protease Do-like 9 isoform X2         68.9    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_009344539.1|  PREDICTED: protease Do-like 9 isoform X1         68.9    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_003525265.1|  PREDICTED: protease Do-like 9-like               68.9    3e-10   Glycine max [soybeans]
ref|XP_005644766.1|  trypsin-like serine protease                     68.6    3e-10   Coccomyxa subellipsoidea C-169
ref|XP_003550747.1|  PREDICTED: protease Do-like 9-like               68.6    3e-10   Glycine max [soybeans]
ref|XP_001774430.1|  predicted protein                                68.2    4e-10   
gb|EYU29924.1|  hypothetical protein MIMGU_mgv1a005009mg              68.2    4e-10   Erythranthe guttata [common monkey flower]
ref|XP_011071819.1|  PREDICTED: protease Do-like 9 isoform X2         68.2    4e-10   Sesamum indicum [beniseed]
ref|XP_008348203.1|  PREDICTED: protease Do-like 9                    68.6    4e-10   
ref|XP_009140230.1|  PREDICTED: protease Do-like 9                    68.6    4e-10   Brassica rapa
ref|XP_006282154.1|  hypothetical protein CARUB_v10028411mg           68.2    4e-10   
ref|XP_002280249.1|  PREDICTED: protease Do-like 9                    68.6    4e-10   Vitis vinifera
ref|XP_006283387.1|  hypothetical protein CARUB_v10004432mg           68.2    4e-10   Capsella rubella
ref|XP_002868670.1|  hypothetical protein ARALYDRAFT_493972           68.2    4e-10   
ref|NP_568577.1|  DegP protease 9                                     68.2    5e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAX68967.1|  periplasmic serine endoprotease of the DegP/Htr ...  67.8    5e-10   uncultured bacterium
ref|XP_008341479.1|  PREDICTED: protease Do-like 9                    68.2    5e-10   Malus domestica [apple tree]
ref|XP_006446449.1|  hypothetical protein CICLE_v10014711mg           68.2    5e-10   Citrus clementina [clementine]
ref|XP_010450719.1|  PREDICTED: protease Do-like 9                    68.2    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006470390.1|  PREDICTED: protease Do-like 9-like               68.2    5e-10   Citrus sinensis [apfelsine]
gb|KDO66274.1|  hypothetical protein CISIN_1g036586mg                 68.2    5e-10   Citrus sinensis [apfelsine]
gb|EPS65237.1|  hypothetical protein M569_09541                       67.8    5e-10   Genlisea aurea
ref|NP_566551.1|  DegP protease 11                                    68.2    5e-10   
ref|XP_002511438.1|  serine endopeptidase degp2, putative             68.2    5e-10   Ricinus communis
sp|Q9LK71.2|DGP11_ARATH  RecName: Full=Putative protease Do-like ...  68.2    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009349861.1|  PREDICTED: protease Do-like 9                    68.2    5e-10   Pyrus x bretschneideri [bai li]
emb|CAN74170.1|  hypothetical protein VITISV_013882                   68.2    5e-10   Vitis vinifera
ref|XP_010446115.1|  PREDICTED: putative protease Do-like 3, mito...  67.8    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009139975.1|  PREDICTED: protease Do-like 9                    68.2    5e-10   Brassica rapa
dbj|BAB01153.1|  unnamed protein product                              68.2    5e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44585.1|  BnaA04g10050D                                        68.2    5e-10   Brassica napus [oilseed rape]
emb|CDY53116.1|  BnaCnng24440D                                        67.8    5e-10   Brassica napus [oilseed rape]
ref|XP_002154609.2|  PREDICTED: protease Do-like 10, mitochondria...  67.8    6e-10   Hydra vulgaris
ref|XP_008438126.1|  PREDICTED: protease Do-like 9                    67.8    6e-10   Cucumis melo [Oriental melon]
ref|XP_008230646.1|  PREDICTED: protease Do-like 9                    67.8    6e-10   Prunus mume [ume]
ref|XP_007217173.1|  hypothetical protein PRUPE_ppa003383mg           67.8    6e-10   Prunus persica
ref|XP_004152460.1|  PREDICTED: protease Do-like 9-like               67.8    6e-10   Cucumis sativus [cucumbers]
gb|KFK33145.1|  hypothetical protein AALP_AA6G336800                  67.8    6e-10   Arabis alpina [alpine rockcress]
ref|XP_007036141.1|  Protease Do-like 9 isoform 1                     67.8    6e-10   Theobroma cacao [chocolate]
ref|XP_010678716.1|  PREDICTED: protease Do-like 9 isoform X1         67.4    6e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010678718.1|  PREDICTED: protease Do-like 9 isoform X2         67.4    6e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008239730.1|  PREDICTED: protease Do-like 9                    67.8    6e-10   Prunus mume [ume]
ref|XP_002866059.1|  predicted protein                                67.4    7e-10   
ref|XP_007140930.1|  hypothetical protein PHAVU_008G153200g           67.8    7e-10   Phaseolus vulgaris [French bean]
ref|XP_010111534.1|  Protease Do-like 9                               67.8    7e-10   Morus notabilis
ref|XP_011028602.1|  PREDICTED: protease Do-like 9                    67.4    7e-10   Populus euphratica
ref|XP_002321577.2|  hypothetical protein POPTR_0015s08440g           67.4    8e-10   Populus trichocarpa [western balsam poplar]
ref|XP_007209088.1|  hypothetical protein PRUPE_ppa003679mg           67.4    8e-10   
emb|CDY15934.1|  BnaA04g11770D                                        67.4    8e-10   Brassica napus [oilseed rape]
gb|KHN18478.1|  Protease Do-like 9                                    67.4    8e-10   Glycine soja [wild soybean]
gb|KDP31134.1|  hypothetical protein JCGZ_11510                       67.4    8e-10   Jatropha curcas
emb|CDX99642.1|  BnaC04g33990D                                        67.4    8e-10   
ref|XP_007155398.1|  hypothetical protein PHAVU_003G198000g           67.4    9e-10   Phaseolus vulgaris [French bean]
ref|XP_004508846.1|  PREDICTED: protease Do-like 9-like               67.4    9e-10   Cicer arietinum [garbanzo]
ref|XP_005717037.1|  unnamed protein product                          65.9    9e-10   Chondrus crispus [carageen]
emb|CEF97941.1|  Serine endopeptidase DegP2                           67.0    1e-09   Ostreococcus tauri
ref|XP_003079294.1|  putative DegP2 protease (ISS)                    67.0    1e-09   
ref|XP_005827715.1|  hypothetical protein GUITHDRAFT_164606           67.0    1e-09   Guillardia theta CCMP2712
ref|XP_008882829.1|  trypsin domain-containing protein                67.0    1e-09   
ref|XP_002511437.1|  serine endopeptidase degp2, putative             66.6    1e-09   Ricinus communis
ref|XP_002981859.1|  hypothetical protein SELMODRAFT_154815           66.6    1e-09   
ref|XP_002982828.1|  hypothetical protein SELMODRAFT_116969           66.6    1e-09   
emb|CBI15070.3|  unnamed protein product                              66.2    1e-09   Vitis vinifera
gb|KCW56073.1|  hypothetical protein EUGRSUZ_I01831                   66.6    2e-09   Eucalyptus grandis [rose gum]
ref|XP_010678720.1|  PREDICTED: protease Do-like 9                    66.6    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003882743.1|  hypothetical protein NCLIV_025000                67.0    2e-09   Neospora caninum Liverpool
ref|XP_005537155.1|  DegP protease                                    66.2    2e-09   Cyanidioschyzon merolae strain 10D
ref|XP_006376843.1|  hypothetical protein POPTR_0012s07930g           66.2    2e-09   
ref|XP_011044336.1|  PREDICTED: protease Do-like 9                    66.2    2e-09   Populus euphratica
ref|XP_011015595.1|  PREDICTED: protease Do-like 9                    66.2    2e-09   Populus euphratica
gb|KCW49312.1|  hypothetical protein EUGRSUZ_K02868                   65.9    2e-09   Eucalyptus grandis [rose gum]
gb|KDP45394.1|  hypothetical protein JCGZ_09643                       66.2    2e-09   Jatropha curcas
ref|XP_011087156.1|  PREDICTED: protease Do-like 9                    66.2    2e-09   Sesamum indicum [beniseed]
ref|XP_010037587.1|  PREDICTED: protease Do-like 9                    65.9    2e-09   Eucalyptus grandis [rose gum]
ref|XP_006439769.1|  hypothetical protein CICLE_v10019344mg           65.9    2e-09   
gb|KDO69729.1|  hypothetical protein CISIN_1g007213mg                 65.9    2e-09   Citrus sinensis [apfelsine]
ref|XP_006476739.1|  PREDICTED: protease Do-like 9-like isoform X1    65.9    3e-09   Citrus sinensis [apfelsine]
gb|KFG65537.1|  trypsin domain-containing protein                     66.2    3e-09   Toxoplasma gondii RUB
gb|KFG52622.1|  trypsin domain-containing protein                     66.2    3e-09   Toxoplasma gondii FOU
gb|KFG35062.1|  trypsin domain-containing protein                     66.2    3e-09   Toxoplasma gondii p89
ref|XP_006439767.1|  hypothetical protein CICLE_v10019344mg           65.9    3e-09   
emb|CDP02144.1|  unnamed protein product                              65.5    3e-09   Coffea canephora [robusta coffee]
gb|KDO69730.1|  hypothetical protein CISIN_1g007213mg                 65.9    3e-09   Citrus sinensis [apfelsine]
gb|KDO69731.1|  hypothetical protein CISIN_1g007213mg                 65.5    3e-09   Citrus sinensis [apfelsine]
ref|XP_006439771.1|  hypothetical protein CICLE_v10019344mg           65.9    3e-09   
ref|XP_007514393.1|  predicted protein                                65.5    3e-09   Bathycoccus prasinos
gb|KFH10349.1|  trypsin domain-containing protein                     65.9    3e-09   Toxoplasma gondii VAND
gb|ESS31919.1|  trypsin domain-containing protein                     65.9    3e-09   Toxoplasma gondii VEG
gb|EPR62641.1|  trypsin domain-containing protein                     65.9    3e-09   Toxoplasma gondii GT1
ref|XP_002365392.1|  trypsin, putative                                65.9    3e-09   
gb|EPT29682.1|  trypsin domain-containing protein                     65.9    3e-09   Toxoplasma gondii ME49
gb|KFH07698.1|  trypsin domain-containing protein                     65.9    3e-09   Toxoplasma gondii MAS
ref|XP_006363999.1|  PREDICTED: protease Do-like 9-like               65.5    3e-09   Solanum tuberosum [potatoes]
ref|XP_010029214.1|  PREDICTED: protease Do-like 9                    65.5    3e-09   Eucalyptus grandis [rose gum]
ref|XP_003608950.1|  hypothetical protein MTR_4g106730                65.5    3e-09   Medicago truncatula
ref|XP_004252664.1|  PREDICTED: protease Do-like 9                    65.5    3e-09   Solanum lycopersicum
ref|XP_001417982.1|  predicted protein                                65.5    4e-09   Ostreococcus lucimarinus CCE9901
ref|XP_010111735.1|  Protease Do-like 9                               65.5    4e-09   Morus notabilis
ref|XP_004965071.1|  PREDICTED: protease Do-like 9-like               65.5    4e-09   Setaria italica
ref|XP_002946355.1|  trypsin family                                   65.1    4e-09   Volvox carteri f. nagariensis
ref|XP_008780936.1|  PREDICTED: protease Do-like 9                    65.1    4e-09   Phoenix dactylifera
ref|XP_010254399.1|  PREDICTED: protease Do-like 9 isoform X1         65.1    4e-09   Nelumbo nucifera [Indian lotus]
ref|WP_008337611.1|  serine protease                                  65.1    4e-09   Sulfurimonas gotlandica
ref|XP_010254417.1|  PREDICTED: protease Do-like 9 isoform X2         65.1    5e-09   Nelumbo nucifera [Indian lotus]
ref|XP_002517376.1|  serine endopeptidase degp2, putative             65.1    5e-09   Ricinus communis
ref|WP_025566621.1|  hypothetical protein                             64.7    5e-09   
ref|XP_002989968.1|  hypothetical protein SELMODRAFT_130891           65.1    5e-09   
ref|XP_003516811.1|  PREDICTED: protease Do-like 9-like               64.7    5e-09   Glycine max [soybeans]
ref|WP_011980004.1|  serine protease                                  64.7    6e-09   Sulfurovum sp. NBC37-1
ref|XP_002968921.1|  hypothetical protein SELMODRAFT_90340            64.7    6e-09   
gb|KHG27181.1|  Protease Do-like 9                                    64.3    6e-09   Gossypium arboreum [tree cotton]
ref|XP_002885149.1|  DEGP12                                           64.3    7e-09   
ref|XP_007031393.1|  Protease Do-like 9 isoform 2                     64.3    7e-09   
gb|KJB08193.1|  hypothetical protein B456_001G070400                  64.3    8e-09   Gossypium raimondii
ref|XP_007031394.1|  Protease Do-like 9 isoform 3                     64.3    8e-09   
ref|XP_004298924.1|  PREDICTED: protease Do-like 9                    64.3    8e-09   Fragaria vesca subsp. vesca
gb|KJB40785.1|  hypothetical protein B456_007G077100                  64.3    9e-09   Gossypium raimondii
gb|KJB40786.1|  hypothetical protein B456_007G077100                  64.3    9e-09   Gossypium raimondii
ref|XP_004989115.1|  hypothetical protein PTSG_09760                  64.3    9e-09   Salpingoeca rosetta
gb|KIY95877.1|  hypothetical protein MNEG_12084                       63.5    1e-08   Monoraphidium neglectum
emb|CDP16995.1|  unnamed protein product                              63.5    2e-08   Coffea canephora [robusta coffee]
emb|CBX27101.1|  Protease Do-like 10, mitochondrial                   63.2    2e-08   uncultured Desulfobacterium sp.
ref|WP_027353863.1|  hypothetical protein                             63.2    2e-08   
gb|AFV92884.1|  putative trypsin 1                                    61.2    2e-08   Eimeria tenella
gb|AFW76813.1|  hypothetical protein ZEAMMB73_778886                  63.2    2e-08   
ref|XP_007031392.1|  Protease Do-like 9 isoform 1                     63.2    2e-08   
ref|WP_041150988.1|  serine protease                                  62.8    2e-08   
ref|WP_041126407.1|  serine protease                                  62.8    2e-08   
ref|XP_008647464.1|  PREDICTED: uncharacterized protein LOC100217...  62.8    2e-08   
gb|KJB40784.1|  hypothetical protein B456_007G077100                  62.8    3e-08   
ref|XP_008647465.1|  PREDICTED: uncharacterized protein LOC100217...  62.8    3e-08   
ref|XP_002974405.1|  hypothetical protein SELMODRAFT_100929           62.8    3e-08   
ref|XP_002948745.1|  hypothetical protein VOLCADRAFT_58517            62.4    3e-08   
gb|EAY87490.1|  hypothetical protein OsI_08898                        62.8    3e-08   
dbj|BAD15737.1|  putative DegP2 protease                              62.8    3e-08   
ref|XP_006649039.1|  PREDICTED: protease Do-like 9-like               62.4    3e-08   
ref|XP_006655949.1|  PREDICTED: protease Do-like 9-like               62.4    3e-08   
ref|XP_010913539.1|  PREDICTED: protease Do-like 9 isoform X1         62.4    3e-08   
ref|XP_010227815.1|  PREDICTED: protease Do-like 9                    62.4    3e-08   
ref|XP_009379979.1|  PREDICTED: protease Do-like 9                    62.4    3e-08   
sp|Q9LK70.1|DGP12_ARATH  RecName: Full=Putative protease Do-like ...  62.4    3e-08   
gb|KIZ01125.1|  Protease Do-like 10                                   62.0    4e-08   
ref|XP_008643959.1|  PREDICTED: uncharacterized protein LOC100381...  62.4    4e-08   
ref|NP_566552.1|  DEGP protease 12                                    62.4    4e-08   
ref|XP_004953885.1|  PREDICTED: protease Do-like 9-like               62.4    4e-08   
gb|AFW73360.1|  hypothetical protein ZEAMMB73_819902                  62.4    4e-08   
ref|XP_001701981.1|  DegP-type protease                               62.4    4e-08   
ref|XP_006836679.1|  hypothetical protein AMTR_s00088p00077590        62.0    5e-08   
ref|XP_010236127.1|  PREDICTED: protease Do-like 9 isoform X2         61.6    5e-08   
ref|WP_029955043.1|  hypothetical protein                             58.9    5e-08   
emb|CBJ48373.1|  conserved unknown protein                            62.0    5e-08   
ref|WP_039778564.1|  hypothetical protein                             60.8    6e-08   
ref|XP_007144566.1|  hypothetical protein PHAVU_007G1665000g          59.3    6e-08   
ref|XP_010424503.1|  PREDICTED: putative protease Do-like 11, mit...  61.6    6e-08   
dbj|BAK07966.1|  predicted protein                                    61.6    6e-08   
gb|EMS45662.1|  Protease Do-like 9                                    61.6    6e-08   
ref|WP_041142445.1|  serine protease                                  61.2    6e-08   
dbj|BAK01822.1|  predicted protein                                    61.2    7e-08   
gb|ACX50966.1|  trypsin-like protease                                 58.9    7e-08   
ref|XP_010236126.1|  PREDICTED: protease Do-like 9 isoform X1         61.2    7e-08   
emb|CDY42478.1|  BnaA10g08540D                                        58.9    8e-08   
emb|CDJ41808.1|  trypsin, putative                                    61.6    8e-08   
ref|XP_009768575.1|  PREDICTED: protease Do-like 2, chloroplastic...  61.2    9e-08   
gb|ABW31588.1|  trypsin-like serine protease, putative                60.8    9e-08   
ref|XP_009768576.1|  PREDICTED: protease Do-like 2, chloroplastic...  61.2    9e-08   
gb|ABW33227.1|  protease, putative                                    60.8    1e-07   
ref|WP_041661167.1|  hypothetical protein                             60.8    1e-07   
dbj|BAJ90442.1|  predicted protein                                    60.8    1e-07   
dbj|GAK48960.1|  protease, putative                                   60.8    1e-07   
ref|WP_035225140.1|  hypothetical protein                             60.5    1e-07   
ref|XP_006479864.1|  PREDICTED: protease Do-like 2, chloroplastic...  60.8    1e-07   
ref|XP_006444216.1|  hypothetical protein CICLE_v10019366mg           60.8    1e-07   
ref|WP_020653587.1|  hypothetical protein                             60.5    1e-07   
ref|XP_003564034.1|  PREDICTED: protease Do-like 9                    60.8    1e-07   
emb|CDJ32682.1|  hypothetical protein EMH_0077000                     59.7    2e-07   
emb|CCK81051.1|  serine protease, related to trypsin                  60.1    2e-07   
ref|WP_041280057.1|  hypothetical protein                             60.1    2e-07   
gb|AIA26574.1|  serine protease                                       60.1    2e-07   
ref|WP_038960950.1|  hypothetical protein                             59.7    2e-07   
ref|XP_004495997.1|  PREDICTED: protease Do-like 2, chloroplastic...  60.1    2e-07   
ref|WP_043320011.1|  protease                                         59.7    2e-07   
ref|XP_002885148.1|  hypothetical protein ARALYDRAFT_479117           59.7    2e-07   
gb|EJK64737.1|  hypothetical protein THAOC_14498                      60.1    2e-07   
ref|XP_009631856.1|  PREDICTED: protease Do-like 2, chloroplastic...  59.7    2e-07   
ref|XP_009631857.1|  PREDICTED: protease Do-like 2, chloroplastic...  59.7    3e-07   
gb|KEH43264.1|  DegP protease                                         59.7    3e-07   
emb|CDJ67056.1|  trypsin, putative                                    59.7    3e-07   
ref|NP_001057235.1|  Os06g0234100                                     59.3    4e-07   
ref|XP_009587779.1|  PREDICTED: protease Do-like 2, chloroplastic...  59.3    4e-07   
ref|XP_009587776.1|  PREDICTED: protease Do-like 2, chloroplastic...  59.3    4e-07   
ref|XP_011071818.1|  PREDICTED: protease Do-like 9 isoform X1         58.9    5e-07   
ref|XP_010424502.1|  PREDICTED: putative protease Do-like 12, mit...  58.5    5e-07   
gb|EWM29652.1|  protease do-like 9                                    58.9    5e-07   
gb|EWM29653.1|  protease do-like 9                                    58.5    5e-07   
ref|XP_009773293.1|  PREDICTED: protease Do-like 2, chloroplastic     58.5    6e-07   
ref|WP_033230185.1|  protease                                         58.5    6e-07   
ref|XP_005758709.1|  hypothetical protein EMIHUDRAFT_249947           56.2    6e-07   
ref|WP_020149666.1|  MULTISPECIES: hypothetical protein               58.5    6e-07   
ref|XP_010456846.1|  PREDICTED: putative protease Do-like 11, mit...  58.5    7e-07   
ref|WP_020036555.1|  hypothetical protein                             58.2    7e-07   
ref|XP_005850048.1|  hypothetical protein CHLNCDRAFT_34342            58.5    7e-07   
emb|CCF73353.1|  unnamed protein product                              58.2    8e-07   
ref|XP_003520225.1|  PREDICTED: protease Do-like 2, chloroplastic...  58.2    8e-07   
ref|XP_003536894.1|  PREDICTED: protease Do-like 2, chloroplastic...  58.2    8e-07   
ref|WP_013553975.1|  serine protease                                  58.2    8e-07   
ref|XP_006588605.1|  PREDICTED: protease Do-like 2, chloroplastic...  58.2    9e-07   
gb|EMT08042.1|  Protease Do-like protein 9                            58.2    9e-07   
ref|XP_005650005.1|  trypsin-like serine protease                     58.2    9e-07   
ref|XP_010323029.1|  PREDICTED: protease Do-like 2, chloroplastic     57.8    1e-06   
emb|CDR95924.1|  DegP protease, putative                              57.8    1e-06   
ref|XP_006352804.1|  PREDICTED: protease Do-like 2, chloroplastic...  57.8    1e-06   
gb|KDP28079.1|  hypothetical protein JCGZ_13850                       57.8    1e-06   
ref|XP_006352803.1|  PREDICTED: protease Do-like 2, chloroplastic...  57.4    1e-06   
ref|XP_006352801.1|  PREDICTED: protease Do-like 2, chloroplastic...  57.8    1e-06   
ref|XP_011033618.1|  PREDICTED: protease Do-like 2, chloroplastic     57.8    1e-06   
ref|XP_010437094.1|  PREDICTED: putative protease Do-like 11, mit...  57.4    1e-06   
ref|XP_010545055.1|  PREDICTED: protease Do-like 2, chloroplastic     57.4    1e-06   
ref|XP_002321037.1|  putative DegP2 protease family protein           57.4    1e-06   
ref|WP_034747755.1|  peptidase S1                                     57.4    1e-06   
ref|WP_035822344.1|  peptidase S1                                     57.4    1e-06   
ref|WP_034780798.1|  peptidase S1                                     57.4    1e-06   
ref|WP_043462854.1|  peptidase S1                                     57.4    1e-06   
ref|XP_006352802.1|  PREDICTED: protease Do-like 2, chloroplastic...  57.4    1e-06   
gb|EZP41597.1|  Protease Do                                           57.4    1e-06   
ref|XP_011011013.1|  PREDICTED: LOW QUALITY PROTEIN: protease Do-...  57.4    1e-06   
ref|XP_005704064.1|  serine-type endopeptidase isoform 1              57.4    2e-06   
emb|CDJ46859.1|  trypsin, putative                                    57.4    2e-06   
ref|XP_005704063.1|  serine-type endopeptidase isoform 2              57.0    2e-06   
ref|XP_003881237.1|  peptidase S1, chymotrypsin:PDZ/DHR/GLGF doma...  57.4    2e-06   
ref|XP_002520690.1|  serine endopeptidase degp2, putative             57.0    2e-06   
ref|XP_006855396.1|  hypothetical protein AMTR_s00057p00143260        57.0    2e-06   
ref|XP_011082504.1|  PREDICTED: protease Do-like 2, chloroplastic     56.6    2e-06   
ref|XP_005760844.1|  hypothetical protein EMIHUDRAFT_465602           56.6    2e-06   
ref|XP_006366368.1|  PREDICTED: protease Do-like 2, chloroplastic...  56.6    2e-06   
ref|XP_009118165.1|  PREDICTED: protease Do-like 2, chloroplastic     56.6    2e-06   
emb|CDJ32622.1|  trypsin, putative                                    56.6    3e-06   
ref|XP_010941774.1|  PREDICTED: protease Do-like 2, chloroplastic     56.6    3e-06   
ref|XP_010684757.1|  PREDICTED: protease Do-like 2, chloroplastic...  56.6    3e-06   
ref|XP_008386612.1|  PREDICTED: protease Do-like 2, chloroplastic     56.6    3e-06   
ref|WP_040629054.1|  protease                                         56.6    3e-06   
ref|XP_006281902.1|  hypothetical protein CARUB_v10028106mg           56.2    3e-06   
ref|XP_010684759.1|  PREDICTED: protease Do-like 2, chloroplastic...  56.6    3e-06   
ref|XP_007200306.1|  hypothetical protein PRUPE_ppa002853mg           56.6    3e-06   
ref|XP_010247118.1|  PREDICTED: protease Do-like 2, chloroplastic     56.6    3e-06   
ref|XP_008368916.1|  PREDICTED: protease Do-like 2, chloroplastic     56.2    3e-06   
ref|WP_013942997.1|  protease Do-like 10                              56.2    3e-06   
emb|CDJ58148.1|  trypsin, putative                                    56.6    3e-06   
ref|XP_004290719.1|  PREDICTED: protease Do-like 2, chloroplastic...  56.2    3e-06   
ref|XP_010041338.1|  PREDICTED: protease Do-like 2, chloroplastic     56.2    3e-06   
ref|XP_010070002.1|  PREDICTED: protease Do-like 2, chloroplastic     56.2    3e-06   
ref|XP_011458665.1|  PREDICTED: protease Do-like 2, chloroplastic...  56.2    3e-06   
ref|XP_008235077.1|  PREDICTED: protease Do-like 2, chloroplastic     56.2    4e-06   
ref|WP_036240147.1|  peptidase S1                                     56.2    4e-06   
ref|XP_002286231.1|  trypsin-like serine protease                     55.8    4e-06   
gb|EPS74298.1|  hypothetical protein M569_00454                       55.8    4e-06   
ref|XP_004247469.1|  PREDICTED: protease Do-like 2, chloroplastic     56.2    4e-06   
ref|XP_008889209.1|  serine protease                                  56.2    4e-06   
gb|EYU46652.1|  hypothetical protein MIMGU_mgv1a0034322mg             55.5    4e-06   
gb|KJB47048.1|  hypothetical protein B456_008G008100                  55.8    5e-06   
emb|CBI32271.3|  unnamed protein product                              55.8    5e-06   
ref|XP_008655948.1|  PREDICTED: protease Do-like 9 isoform X2         55.5    5e-06   
ref|XP_011079745.1|  PREDICTED: protease Do-like 2, chloroplastic     55.8    5e-06   
ref|XP_002270247.1|  PREDICTED: protease Do-like 2, chloroplastic     55.8    5e-06   
ref|XP_001610362.1|  DegP protease                                    55.5    6e-06   
ref|WP_029921778.1|  peptidase S1                                     55.5    6e-06   
gb|AFW80833.1|  hypothetical protein ZEAMMB73_088014                  55.1    6e-06   
ref|WP_036245588.1|  peptidase S1                                     55.5    6e-06   
gb|KJB47046.1|  hypothetical protein B456_008G008100                  55.5    6e-06   
ref|XP_008655947.1|  PREDICTED: protease Do-like 9 isoform X1         55.1    6e-06   
gb|KFH05116.1|  serine protease                                       55.5    6e-06   
gb|KFG62805.1|  serine protease                                       55.5    6e-06   
gb|KFK37548.1|  hypothetical protein AALP_AA4G271000                  55.5    7e-06   
gb|KFK37547.1|  hypothetical protein AALP_AA4G271000                  55.5    7e-06   
gb|KCW54069.1|  hypothetical protein EUGRSUZ_I00050                   55.1    7e-06   
gb|KFG31101.1|  serine protease                                       55.5    7e-06   
gb|ESS33926.1|  serine protease                                       55.5    7e-06   
gb|KFG42321.1|  serine protease                                       55.5    7e-06   
gb|EPR59808.1|  serine protease                                       55.5    7e-06   
ref|XP_001689823.1|  DegP-type protease                               55.5    7e-06   
gb|KFG99954.1|  serine protease                                       55.5    7e-06   
ref|XP_002368468.1|  trypsin, putative                                55.5    8e-06   
ref|XP_009384166.1|  PREDICTED: protease Do-like 2, chloroplastic     55.1    8e-06   
emb|CBX28524.1|  hypothetical protein N47_G38480                      55.1    8e-06   
ref|XP_005774372.1|  hypothetical protein EMIHUDRAFT_74740            55.1    8e-06   
ref|XP_005767710.1|  hypothetical protein EMIHUDRAFT_103267           55.1    8e-06   
gb|KJB47047.1|  hypothetical protein B456_008G008100                  55.1    8e-06   
ref|XP_004148888.1|  PREDICTED: protease Do-like 2, chloroplastic...  55.1    9e-06   
ref|XP_007050777.1|  DEGP protease 2 isoform 2                        55.1    9e-06   
ref|WP_040848703.1|  peptidase S1 and S6 chymotrypsin/Hap             55.1    9e-06   
ref|XP_007050776.1|  DEGP protease 2 isoform 1                        55.1    9e-06   
ref|XP_010507830.1|  PREDICTED: protease Do-like 2, chloroplastic     55.1    9e-06   
ref|XP_010518515.1|  PREDICTED: protease Do-like 2, chloroplastic...  55.1    9e-06   
ref|XP_010518514.1|  PREDICTED: protease Do-like 2, chloroplastic...  55.1    9e-06   
ref|XP_010506841.1|  PREDICTED: protease Do-like 2, chloroplastic     55.1    9e-06   
ref|NP_001174217.1|  Os05g0147500                                     54.3    9e-06   
ref|XP_007050778.1|  DEGP protease 2 isoform 3                        55.1    1e-05   
ref|XP_008451432.1|  PREDICTED: protease Do-like 2, chloroplastic     55.1    1e-05   
ref|WP_040504359.1|  hypothetical protein                             54.7    1e-05   
ref|WP_018060760.1|  hypothetical protein                             54.7    1e-05   
ref|XP_006295823.1|  hypothetical protein CARUB_v10024950mg           54.7    1e-05   
emb|CDI84136.1|  trypsin, putative                                    55.1    1e-05   
ref|NP_001118544.1|  DegP2 protease                                   54.7    1e-05   
pdb|4FLN|A  Chain A, Crystal Structure Of Plant Protease Deg2         54.7    1e-05   
ref|XP_006397989.1|  hypothetical protein EUTSA_v10001363mg           54.7    1e-05   
ref|XP_011402326.1|  Protease Do-like 9                               54.7    1e-05   
ref|NP_566115.1|  DegP2 protease                                      54.7    1e-05   
ref|WP_021745262.1|  trypsin                                          54.7    1e-05   
ref|XP_002862794.1|  hypothetical protein ARALYDRAFT_920262           54.3    1e-05   
ref|XP_005649879.1|  trypsin-like serine protease                     54.3    1e-05   
ref|XP_006654043.1|  PREDICTED: protease Do-like 2, chloroplastic...  54.7    1e-05   
dbj|BAJ90870.1|  predicted protein                                    54.3    2e-05   
gb|AAT93972.1|  putative DegP2 protease                               54.3    2e-05   
emb|CDI75093.1|  trypsin, putative                                    54.3    2e-05   
gb|KIY97425.1|  hypothetical protein MNEG_10537                       53.1    2e-05   
ref|XP_008800525.1|  PREDICTED: protease Do-like 2, chloroplastic     53.9    2e-05   
ref|WP_026746190.1|  serine protease                                  53.9    2e-05   
ref|XP_009038933.1|  hypothetical protein AURANDRAFT_29427            53.9    2e-05   
gb|EEX75459.1|  trypsin                                               53.5    2e-05   
ref|XP_006289341.1|  hypothetical protein CARUB_v10002825mg           53.9    2e-05   
ref|WP_027867302.1|  peptidase S1                                     53.9    2e-05   
ref|WP_015250627.1|  peptidase S1                                     53.9    2e-05   
ref|WP_036209062.1|  peptidase S1                                     53.9    2e-05   
ref|XP_005775140.1|  hypothetical protein EMIHUDRAFT_51803            53.5    2e-05   
ref|NP_001146551.1|  hypothetical protein                             53.1    3e-05   
gb|ACF84354.1|  unknown                                               53.1    3e-05   
gb|ADE54766.1|  peptidase S1 and S6 chymotrypsin/Hap                  53.1    3e-05   
ref|XP_009689126.1|  serine protease                                  53.1    4e-05   
ref|XP_004960292.1|  PREDICTED: protease Do-like 2, chloroplastic...  53.1    4e-05   
ref|WP_012861033.1|  serine protease                                  53.1    4e-05   
ref|XP_002439270.1|  hypothetical protein SORBIDRAFT_09g003540        53.1    4e-05   
gb|ABC24939.1|  plastid DegP protease                                 51.2    4e-05   
ref|WP_000125244.1|  hypothetical protein                             51.2    4e-05   
ref|WP_041745842.1|  peptidase S1 and S6 chymotrypsin/Hap             52.8    4e-05   
ref|XP_002958880.1|  serine protease                                  52.8    4e-05   
ref|XP_002945705.1|  trypsin family                                   52.8    5e-05   
ref|XP_001633828.1|  predicted protein                                52.8    5e-05   
ref|WP_000125229.1|  hypothetical protein                             50.4    5e-05   
ref|XP_009763031.1|  PREDICTED: protease Do-like 10, mitochondrial    50.4    5e-05   
ref|XP_010528270.1|  PREDICTED: protease Do-like 9                    52.8    5e-05   
ref|XP_002452567.1|  hypothetical protein SORBIDRAFT_04g028270        52.4    6e-05   
ref|XP_009609244.1|  PREDICTED: protease Do-like 9                    52.4    7e-05   
ref|XP_010272003.1|  PREDICTED: protease Do-like 9                    52.4    7e-05   
ref|WP_041125144.1|  hypothetical protein                             52.0    8e-05   
ref|WP_025181226.1|  serine protease                                  52.0    8e-05   
ref|XP_010554015.1|  PREDICTED: protease Do-like 9                    52.0    9e-05   



>ref|XP_006353238.1| PREDICTED: protease Do-like 10, mitochondrial-like [Solanum tuberosum]
Length=597

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = +1

Query  292  ENGLDDNNCGAAAD-GVQLINSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPS  468
            EN   + N   A D GV L   E  A  LS    I DAY AIELALDSVVKIFTVSSSP+
Sbjct  82   ENNSVEPNLSVAGDAGVALSEVERVAPRLS--DGILDAYLAIELALDSVVKIFTVSSSPN  139

Query  469  YFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            YFLPWQNKSQRE+TGSGFVIPG+RILTNAHVVADHTFV
Sbjct  140  YFLPWQNKSQRETTGSGFVIPGKRILTNAHVVADHTFV  177



>ref|XP_004250091.1| PREDICTED: protease Do-like 10, mitochondrial [Solanum lycopersicum]
Length=595

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = +1

Query  292  ENGLDDNNCGAAAD-GVQLINSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPS  468
            EN   ++N   A D GV L+  E  A  LS    I DAY AIELALDSVVKIFTVSSSP+
Sbjct  82   ENDNVESNLSVAGDAGVALLEVERVAPRLS--DGILDAYLAIELALDSVVKIFTVSSSPN  139

Query  469  YFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            YFLPWQNKSQRE+TGSGFVI G+RILTNAHVVADHTFV
Sbjct  140  YFLPWQNKSQRETTGSGFVIRGKRILTNAHVVADHTFV  177



>ref|XP_009803816.1| PREDICTED: protease Do-like 10, mitochondrial [Nicotiana sylvestris]
Length=593

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +1

Query  364  AESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRI  543
             E    +S + DAY AIELALDSVVKIFTVSSSP+YFLPWQNKSQRE+TGSGFVIPG+RI
Sbjct  101  VEEQRLSSGMVDAYLAIELALDSVVKIFTVSSSPNYFLPWQNKSQRETTGSGFVIPGKRI  160

Query  544  LTNAHVVADHTFV  582
            LTNAHVVADHTFV
Sbjct  161  LTNAHVVADHTFV  173



>gb|EYU39504.1| hypothetical protein MIMGU_mgv1a003194mg [Erythranthe guttata]
Length=601

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +1

Query  349  NSESPAESLST-TSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFV  525
            +SE+ A+S++    ++ +AYYAIELALDSVVKIFTV+SSPSYFLPWQNKSQRES GSGFV
Sbjct  103  DSEAVADSVAVRNGAMDEAYYAIELALDSVVKIFTVASSPSYFLPWQNKSQRESMGSGFV  162

Query  526  IPGRRILTNAHVVADHTFV  582
            I G+RILTNAHVVADHTFV
Sbjct  163  ISGKRILTNAHVVADHTFV  181



>gb|AFW57240.1| hypothetical protein ZEAMMB73_939751 [Zea mays]
Length=356

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHVVADH
Sbjct  102  TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVADH  161

Query  574  TFV  582
            TFV
Sbjct  162  TFV  164



>ref|XP_011077091.1| PREDICTED: protease Do-like 10, mitochondrial [Sesamum indicum]
Length=596

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  391  ISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVAD  570
            + DAYYAIELALDSVVKIFTV+SSPSYFLPWQNKSQRES GSGF+I GRRILTNAHVVAD
Sbjct  113  MDDAYYAIELALDSVVKIFTVASSPSYFLPWQNKSQRESMGSGFIISGRRILTNAHVVAD  172

Query  571  HTFV  582
            HTFV
Sbjct  173  HTFV  176



>ref|XP_008664017.1| PREDICTED: uncharacterized protein LOC103642539 [Zea mays]
Length=410

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHVVADH
Sbjct  102  TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVADH  161

Query  574  TFV  582
            TFV
Sbjct  162  TFV  164



>ref|XP_011011698.1| PREDICTED: protease Do-like 10, mitochondrial [Populus euphratica]
Length=580

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  376  STTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNA  555
            ++  ++SDAY AIELALDSVVKIFTVSSSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNA
Sbjct  92   ASQPNLSDAYSAIELALDSVVKIFTVSSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNA  151

Query  556  HVVADHTFV  582
            HVVADHTFV
Sbjct  152  HVVADHTFV  160



>ref|XP_004962074.1| PREDICTED: protease Do-like 10, mitochondrial-like [Setaria italica]
Length=586

 Score =   123 bits (308),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHVVADH
Sbjct  103  TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVADH  162

Query  574  TFV  582
            TFV
Sbjct  163  TFV  165



>ref|XP_007028417.1| DegP protease 10 isoform 4 [Theobroma cacao]
 gb|EOY08919.1| DegP protease 10 isoform 4 [Theobroma cacao]
Length=401

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY AIELALDSVVKIFTV+SSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVADH
Sbjct  124  TDAYLAIELALDSVVKIFTVTSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVADH  183

Query  574  TFV  582
            TFV
Sbjct  184  TFV  186



>ref|XP_008647597.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW78023.1| hypothetical protein ZEAMMB73_513869 [Zea mays]
Length=585

 Score =   123 bits (308),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHVVADH
Sbjct  102  TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVADH  161

Query  574  TFV  582
            TFV
Sbjct  162  TFV  164



>ref|XP_009611385.1| PREDICTED: protease Do-like 10, mitochondrial [Nicotiana tomentosiformis]
Length=593

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  382  TSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHV  561
            +S + DAY AIELALDSVVKIFTVSSSP+YFLPWQNKSQRE+TGSGFVI G+RILTNAHV
Sbjct  107  SSGMVDAYLAIELALDSVVKIFTVSSSPNYFLPWQNKSQRETTGSGFVIRGKRILTNAHV  166

Query  562  VADHTFV  582
            VADHTFV
Sbjct  167  VADHTFV  173



>ref|XP_007028418.1| DegP protease 10 isoform 5 [Theobroma cacao]
 gb|EOY08920.1| DegP protease 10 isoform 5 [Theobroma cacao]
Length=533

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY AIELALDSVVKIFTV+SSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVADH
Sbjct  124  TDAYLAIELALDSVVKIFTVTSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVADH  183

Query  574  TFV  582
            TFV
Sbjct  184  TFV  186



>ref|XP_010528621.1| PREDICTED: protease Do-like 10, mitochondrial [Tarenaya hassleriana]
Length=594

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +1

Query  337  VQLINSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGS  516
            V+L+ S   A   +   +   AY AIELALDSVVKIFTVSSSP+Y LPWQNKSQRES GS
Sbjct  93   VRLVKSRRKARRRTVVGAAETAYSAIELALDSVVKIFTVSSSPNYSLPWQNKSQRESMGS  152

Query  517  GFVIPGRRILTNAHVVADHTFV  582
            GFVIPGR+ILTNAHVVADHTFV
Sbjct  153  GFVIPGRKILTNAHVVADHTFV  174



>gb|KJB49012.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=483

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  388  SISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            +++D Y AIELALDSV+KIFTVSSSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVA
Sbjct  69   TVTDTYEAIELALDSVIKIFTVSSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVA  128

Query  568  DHTFV  582
            DHTFV
Sbjct  129  DHTFV  133



>emb|CDP04134.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  391  ISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVAD  570
            I DAY AIELALDSVVKIFTVSSSP+YFLPWQNKSQRE+ GSGFVIPGRRILTNAHVVAD
Sbjct  107  IGDAYSAIELALDSVVKIFTVSSSPNYFLPWQNKSQRETMGSGFVIPGRRILTNAHVVAD  166

Query  571  HTFV  582
            +TFV
Sbjct  167  YTFV  170



>ref|XP_007028414.1| DegP protease 10 isoform 1 [Theobroma cacao]
 gb|EOY08916.1| DegP protease 10 isoform 1 [Theobroma cacao]
Length=602

 Score =   122 bits (306),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY AIELALDSVVKIFTV+SSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVADH
Sbjct  124  TDAYLAIELALDSVVKIFTVTSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVADH  183

Query  574  TFV  582
            TFV
Sbjct  184  TFV  186



>ref|NP_001142088.1| hypothetical protein [Zea mays]
 gb|ACF87611.1| unknown [Zea mays]
 gb|AFW78022.1| hypothetical protein ZEAMMB73_513869 [Zea mays]
Length=556

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHVVADH
Sbjct  102  TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVADH  161

Query  574  TFV  582
            TFV
Sbjct  162  TFV  164



>gb|KDP32493.1| hypothetical protein JCGZ_13418 [Jatropha curcas]
Length=565

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            S ++DAY AIELALDSVVKIFTVSSSP+YFLPWQNK QRE+ GSGFVIPG++ILTNAHVV
Sbjct  83   SQLTDAYSAIELALDSVVKIFTVSSSPNYFLPWQNKPQRETMGSGFVIPGKKILTNAHVV  142

Query  565  ADHTFV  582
            ADHTFV
Sbjct  143  ADHTFV  148



>ref|XP_007028416.1| DegP protease 10 isoform 3 [Theobroma cacao]
 gb|EOY08918.1| DegP protease 10 isoform 3 [Theobroma cacao]
Length=514

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY AIELALDSVVKIFTV+SSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVADH
Sbjct  124  TDAYLAIELALDSVVKIFTVTSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVADH  183

Query  574  TFV  582
            TFV
Sbjct  184  TFV  186



>ref|XP_007028415.1| DegP protease 10 isoform 2 [Theobroma cacao]
 gb|EOY08917.1| DegP protease 10 isoform 2 [Theobroma cacao]
Length=537

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY AIELALDSVVKIFTV+SSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVADH
Sbjct  124  TDAYLAIELALDSVVKIFTVTSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVADH  183

Query  574  TFV  582
            TFV
Sbjct  184  TFV  186



>ref|XP_002514764.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF47318.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=527

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = +1

Query  385  SSISDAYY-AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHV  561
            S + DAYY AIELALDSVVKIFTVSSSP+YFLPWQNK QRES GSGFVIPG+RILTNAHV
Sbjct  65   SELRDAYYLAIELALDSVVKIFTVSSSPNYFLPWQNKPQRESMGSGFVIPGKRILTNAHV  124

Query  562  VADHTFV  582
            VADHTFV
Sbjct  125  VADHTFV  131



>gb|KHG11681.1| hypothetical protein F383_13103 [Gossypium arboreum]
Length=551

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  388  SISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            +++D Y AIELALDSVVKIFTVSSSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVA
Sbjct  69   TVTDTYEAIELALDSVVKIFTVSSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVA  128

Query  568  DHTFV  582
            DHTFV
Sbjct  129  DHTFV  133



>gb|EEE63742.1| hypothetical protein OsJ_18561 [Oryza sativa Japonica Group]
Length=563

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHV+ADH
Sbjct  73   TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIITNAHVIADH  132

Query  574  TFV  582
            TFV
Sbjct  133  TFV  135



>ref|XP_002441105.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
 gb|EES19535.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
Length=587

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHVVADH
Sbjct  104  TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVADH  163

Query  574  TFV  582
            TFV
Sbjct  164  TFV  166



>gb|KJB49011.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=487

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  388  SISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            +++D Y AIELALDSV+KIFTVSSSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVA
Sbjct  69   TVTDTYEAIELALDSVIKIFTVSSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVA  128

Query  568  DHTFV  582
            DHTFV
Sbjct  129  DHTFV  133



>gb|KJB49013.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=542

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  388  SISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            +++D Y AIELALDSV+KIFTVSSSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVA
Sbjct  69   TVTDTYEAIELALDSVIKIFTVSSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVA  128

Query  568  DHTFV  582
            DHTFV
Sbjct  129  DHTFV  133



>gb|KJB49010.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=551

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +1

Query  388  SISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            +++D Y AIELALDSV+KIFTVSSSP+YFLPWQNKSQRE+ GSGFVIPG++ILTNAHVVA
Sbjct  69   TVTDTYEAIELALDSVIKIFTVSSSPNYFLPWQNKSQRETMGSGFVIPGKKILTNAHVVA  128

Query  568  DHTFV  582
            DHTFV
Sbjct  129  DHTFV  133



>ref|XP_002463281.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor]
 gb|EER99802.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor]
Length=586

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHVVADH
Sbjct  103  TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVADH  162

Query  574  TFV  582
            TFV
Sbjct  163  TFV  165



>ref|NP_001055560.1| Os05g0417100 [Oryza sativa Japonica Group]
 gb|AAT77386.1| putative serine protease [Oryza sativa Japonica Group]
 gb|AAU10782.1| putative serine protease [Oryza sativa Japonica Group]
 dbj|BAF17474.1| Os05g0417100 [Oryza sativa Japonica Group]
 dbj|BAG93339.1| unnamed protein product [Oryza sativa Japonica Group]
Length=614

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHV+ADH
Sbjct  124  TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIITNAHVIADH  183

Query  574  TFV  582
            TFV
Sbjct  184  TFV  186



>ref|XP_009420477.1| PREDICTED: protease Do-like 10, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=564

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY AIELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHVV+DH
Sbjct  81   TDAYAAIELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVVSDH  140

Query  574  TFV  582
            TFV
Sbjct  141  TFV  143



>ref|XP_008776775.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Phoenix 
dactylifera]
Length=471

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +1

Query  352  SESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIP  531
            SE   E LS   +  DAY AIELALDSVVK+FTVSSSP+Y LPWQNKSQRES GSGFV+P
Sbjct  73   SEEDEEPLSYRHT--DAYAAIELALDSVVKVFTVSSSPNYSLPWQNKSQRESMGSGFVLP  130

Query  532  GRRILTNAHVVADHTFV  582
            GRRILTNAHVVADHTFV
Sbjct  131  GRRILTNAHVVADHTFV  147



>gb|EAY98063.1| hypothetical protein OsI_19981 [Oryza sativa Indica Group]
Length=614

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSSSP+YFLPWQNK+QRES GSGFVIPGRRI+TNAHV+ADH
Sbjct  124  TDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIVTNAHVIADH  183

Query  574  TFV  582
            TFV
Sbjct  184  TFV  186



>ref|XP_002265825.2| PREDICTED: protease Do-like 10, mitochondrial [Vitis vinifera]
 emb|CBI33040.3| unnamed protein product [Vitis vinifera]
Length=564

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  364  AESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRI  543
             E+   T+  ++AY AIELALDSVVKIFTVSSSP+Y LPWQNKSQRE+ GSGFVIPG+RI
Sbjct  72   GETHGITNRETNAYSAIELALDSVVKIFTVSSSPNYLLPWQNKSQRETMGSGFVIPGKRI  131

Query  544  LTNAHVVADHTFV  582
            LTNAHVVADHTFV
Sbjct  132  LTNAHVVADHTFV  144



>ref|XP_002311275.1| hypothetical protein POPTR_0008s07940g [Populus trichocarpa]
 gb|EEE88642.1| hypothetical protein POPTR_0008s07940g [Populus trichocarpa]
Length=587

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  376  STTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNA  555
            ++  ++SDAY AIELALDSVVKIFTVSSSP+YFLPWQNKSQRE+ GSGFVI G++ILTNA
Sbjct  92   ASQPNLSDAYSAIELALDSVVKIFTVSSSPNYFLPWQNKSQRETMGSGFVITGKKILTNA  151

Query  556  HVVADHTFV  582
            HVVADHTFV
Sbjct  152  HVVADHTFV  160



>ref|XP_008776774.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Phoenix 
dactylifera]
Length=568

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +1

Query  352  SESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIP  531
            SE   E LS   +  DAY AIELALDSVVK+FTVSSSP+Y LPWQNKSQRES GSGFV+P
Sbjct  73   SEEDEEPLSYRHT--DAYAAIELALDSVVKVFTVSSSPNYSLPWQNKSQRESMGSGFVLP  130

Query  532  GRRILTNAHVVADHTFV  582
            GRRILTNAHVVADHTFV
Sbjct  131  GRRILTNAHVVADHTFV  147



>ref|XP_006858733.1| hypothetical protein AMTR_s00066p00121670 [Amborella trichopoda]
 gb|ERN20200.1| hypothetical protein AMTR_s00066p00121670 [Amborella trichopoda]
Length=573

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY AI LA+D+VVK+FTVSSSP+YFLPWQNKSQRE+ GSGFVIPGRRILTNAHVVADH
Sbjct  91   TDAYAAIHLAIDAVVKVFTVSSSPNYFLPWQNKSQRETMGSGFVIPGRRILTNAHVVADH  150

Query  574  TFV  582
            TFV
Sbjct  151  TFV  153



>ref|XP_010927886.1| PREDICTED: protease Do-like 10, mitochondrial [Elaeis guineensis]
Length=568

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY AIELALDSVVK+FTVSSSP+Y LPWQNKSQRES GSGFV+PGRRILTNAHVVADH
Sbjct  85   TDAYAAIELALDSVVKVFTVSSSPNYSLPWQNKSQRESMGSGFVLPGRRILTNAHVVADH  144

Query  574  TFV  582
            TFV
Sbjct  145  TFV  147



>gb|EPS58030.1| hypothetical protein M569_16788, partial [Genlisea aurea]
Length=184

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTF  579
            AIELA+DSVVKIFTVSSSPSYFLPWQNKSQRE+ GSGFVI GRRILTNAHVVADHTF
Sbjct  1    AIELAMDSVVKIFTVSSSPSYFLPWQNKSQRETMGSGFVISGRRILTNAHVVADHTF  57



>ref|XP_003568444.1| PREDICTED: protease Do-like 10, mitochondrial [Brachypodium distachyon]
Length=585

 Score =   118 bits (295),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A+ELALDSVVK+FTVSS P+YFLPWQNK+QRES GSGFVI GRRI+TNAHVVADH
Sbjct  102  TDAYAAVELALDSVVKVFTVSSGPNYFLPWQNKAQRESMGSGFVISGRRIITNAHVVADH  161

Query  574  TFV  582
            TFV
Sbjct  162  TFV  164



>ref|XP_006468667.1| PREDICTED: protease Do-like 10, mitochondrial-like [Citrus sinensis]
 gb|KDO77070.1| hypothetical protein CISIN_1g007765mg [Citrus sinensis]
Length=590

 Score =   117 bits (294),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  379  TTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAH  558
            T    ++AY AIELALDSVVKIFTVSSSP+Y LPWQNKSQRE+TGSGFVIPG++ILTNAH
Sbjct  98   TCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAH  157

Query  559  VVADHTFV  582
            VVAD TFV
Sbjct  158  VVADSTFV  165



>gb|KDO77072.1| hypothetical protein CISIN_1g007765mg [Citrus sinensis]
Length=385

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  379  TTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAH  558
            T    ++AY AIELALDSVVKIFTVSSSP+Y LPWQNKSQRE+TGSGFVIPG++ILTNAH
Sbjct  98   TCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAH  157

Query  559  VVADHTFV  582
            VVAD TFV
Sbjct  158  VVADSTFV  165



>ref|XP_007211387.1| hypothetical protein PRUPE_ppa003181mg [Prunus persica]
 gb|EMJ12586.1| hypothetical protein PRUPE_ppa003181mg [Prunus persica]
Length=595

 Score =   117 bits (292),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 54/58 (93%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            AIELALDSVVKIFTVSSSP+YFLPWQNKSQRES GSGFVIPG++ILTNAHVVADHTFV
Sbjct  115  AIELALDSVVKIFTVSSSPNYFLPWQNKSQRESMGSGFVIPGKKILTNAHVVADHTFV  172



>ref|XP_010673840.1| PREDICTED: protease Do-like 10, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   117 bits (292),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  376  STTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNA  555
            S  S+++DAY AIELALDSVVKIFTV+SSP++ LPWQNKSQRE+ GSGFVI GRRILTNA
Sbjct  103  SCNSTVTDAYAAIELALDSVVKIFTVASSPNFILPWQNKSQRETNGSGFVISGRRILTNA  162

Query  556  HVVADHTFV  582
            HVVADH ++
Sbjct  163  HVVADHKYL  171



>ref|XP_006448510.1| hypothetical protein CICLE_v10014700mg [Citrus clementina]
 gb|ESR61750.1| hypothetical protein CICLE_v10014700mg [Citrus clementina]
Length=590

 Score =   116 bits (291),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  379  TTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAH  558
            T    ++AY AIELALDSVVKIFTVSSSP+Y LPWQNKSQRE+TGSGF+IPG++ILTNAH
Sbjct  98   TCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFIIPGKKILTNAH  157

Query  559  VVADHTFV  582
            VVAD TFV
Sbjct  158  VVADSTFV  165



>ref|XP_010277816.1| PREDICTED: protease Do-like 10, mitochondrial [Nelumbo nucifera]
Length=573

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +D Y AIEL LDSVVKIFTV+SSP+YFLPWQNKSQRE+ GSGFVI GRRILTNAHVVADH
Sbjct  90   TDPYSAIELVLDSVVKIFTVTSSPNYFLPWQNKSQRETMGSGFVISGRRILTNAHVVADH  149

Query  574  TFV  582
            TFV
Sbjct  150  TFV  152



>ref|XP_008224670.1| PREDICTED: protease Do-like 10, mitochondrial [Prunus mume]
Length=595

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            AIELALDSVVKIFTVSSSP+YFLPWQNKSQRES GSGFVIPG++ILTNAHVVADHTFV
Sbjct  115  AIELALDSVVKIFTVSSSPNYFLPWQNKSQRESMGSGFVIPGKKILTNAHVVADHTFV  172



>gb|KDO77071.1| hypothetical protein CISIN_1g007765mg [Citrus sinensis]
Length=490

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +1

Query  376  STTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNA  555
             T    ++AY AIELALDSVVKIFTVSSSP+Y LPWQNKSQRE+TGSGFVIPG++ILTNA
Sbjct  97   KTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNA  156

Query  556  HVVADHTFV  582
            HVVAD TFV
Sbjct  157  HVVADSTFV  165



>gb|EMS52153.1| Protease Do-like 10, mitochondrial [Triticum urartu]
Length=585

 Score =   114 bits (286),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DA+ A+ELALDSVVK+FTVSS P+YFLPWQNK+QRES GSGFVI G+RI+TNAHVVADH
Sbjct  102  TDAFAAVELALDSVVKVFTVSSGPNYFLPWQNKAQRESMGSGFVISGKRIVTNAHVVADH  161

Query  574  TFV  582
            TFV
Sbjct  162  TFV  164



>ref|XP_006858734.1| hypothetical protein AMTR_s00066p00122890 [Amborella trichopoda]
 gb|ERN20201.1| hypothetical protein AMTR_s00066p00122890 [Amborella trichopoda]
Length=524

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            +DAY A++LA+D+VVKIFTVSSSP+Y LPWQNKSQ E+ GSGFVIPGRRILTNAHVVADH
Sbjct  42   TDAYAALQLAIDAVVKIFTVSSSPNYVLPWQNKSQIETMGSGFVIPGRRILTNAHVVADH  101

Query  574  TFV  582
            TFV
Sbjct  102  TFV  104



>ref|NP_568543.1| protease Do-like 10 [Arabidopsis thaliana]
 sp|Q9FIV6.1|DGP10_ARATH RecName: Full=Protease Do-like 10, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11638.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAL47441.1| AT5g36950/MLF18_70 [Arabidopsis thaliana]
 gb|AAT85770.1| At5g36950 [Arabidopsis thaliana]
 gb|AED94131.1| protease Do-like 10 [Arabidopsis thaliana]
Length=586

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  388  SISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            SIS A  A++LALDSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GR+I+TNAHVVA
Sbjct  100  SISPAADAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRKIITNAHVVA  159

Query  568  DHTFV  582
            DH+FV
Sbjct  160  DHSFV  164



>ref|XP_002868484.1| DEGP10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44743.1| DEGP10 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  388  SISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            SIS A  A++LALDSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GR+I+TNAHVVA
Sbjct  100  SISPAADAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRKIITNAHVVA  159

Query  568  DHTFV  582
            DH+FV
Sbjct  160  DHSFV  164



>ref|XP_006283411.1| hypothetical protein CARUB_v10004459mg [Capsella rubella]
 gb|EOA16309.1| hypothetical protein CARUB_v10004459mg [Capsella rubella]
Length=577

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  382  TSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHV  561
            + S S A  A++LALDSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GRRI+TNAHV
Sbjct  89   SQSNSPAADAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRRIITNAHV  148

Query  562  VADHTFV  582
            VADH+FV
Sbjct  149  VADHSFV  155



>ref|XP_008377055.1| PREDICTED: protease Do-like 10, mitochondrial [Malus domestica]
Length=572

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            AIELALDSVVKIFTV+SSP+YFLPWQNKSQRE+ GSGFVI G++ILTNAHVVADHTFV
Sbjct  107  AIELALDSVVKIFTVTSSPNYFLPWQNKSQRETMGSGFVIRGKKILTNAHVVADHTFV  164



>ref|XP_010450457.1| PREDICTED: protease Do-like 10, mitochondrial [Camelina sativa]
Length=598

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  382  TSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHV  561
            ++S S A  A++LALDSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GRRI+TNAHV
Sbjct  109  SASNSPAADAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRRIVTNAHV  168

Query  562  VADHTFV  582
            VADH+FV
Sbjct  169  VADHSFV  175



>ref|XP_008441958.1| PREDICTED: protease Do-like 10, mitochondrial [Cucumis melo]
Length=586

 Score =   110 bits (276),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  370  SLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILT  549
            S+ + +  +D + AIELALDSVVK+FTVS SP+Y LPWQNKSQRE+ GSGF+I G++ILT
Sbjct  173  SIKSKTFTTDTFSAIELALDSVVKVFTVSCSPNYILPWQNKSQRETMGSGFIISGKKILT  232

Query  550  NAHVVADHTFV  582
            NAHV+ADHTFV
Sbjct  233  NAHVIADHTFV  243



>ref|XP_010435521.1| PREDICTED: protease Do-like 10, mitochondrial [Camelina sativa]
Length=598

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            S A  A++LALDSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GRRI+TNAHVVADH
Sbjct  113  SPAADAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRRIVTNAHVVADH  172

Query  574  TFV  582
            +FV
Sbjct  173  SFV  175



>ref|XP_010440803.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Camelina 
sativa]
Length=590

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            S A  A++LALDSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GRRI+TNAHVVADH
Sbjct  105  SPAADAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRRIVTNAHVVADH  164

Query  574  TFV  582
            +FV
Sbjct  165  SFV  167



>ref|XP_009139697.1| PREDICTED: protease Do-like 10, mitochondrial [Brassica rapa]
Length=573

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A++LA+DSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GRRI+TNAHVVADH+FV
Sbjct  91   AVDLAMDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRRIITNAHVVADHSFV  148



>emb|CDX74606.1| BnaA04g07830D [Brassica napus]
Length=573

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A++LA+DSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GRRI+TNAHVVADH+FV
Sbjct  91   AVDLAMDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRRIITNAHVVADHSFV  148



>ref|XP_004293434.2| PREDICTED: protease Do-like 10, mitochondrial [Fragaria vesca 
subsp. vesca]
 ref|XP_011460090.1| PREDICTED: protease Do-like 10, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=570

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            AIELALDSVVKIFTV+SSP+YFLPWQNKSQRE+ GSGFVI G +ILTNAHVVADHTFV
Sbjct  105  AIELALDSVVKIFTVASSPNYFLPWQNKSQRETMGSGFVIAGNKILTNAHVVADHTFV  162



>ref|XP_004152886.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cucumis sativus]
 gb|KGN61234.1| hypothetical protein Csa_2G072480 [Cucumis sativus]
Length=601

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  370  SLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILT  549
            S+ +    +D + AIELALDSVVK+FTVS SP+Y LPWQNKSQRE+ GSGF+I G++ILT
Sbjct  112  SIKSKRFTTDTFSAIELALDSVVKVFTVSCSPNYILPWQNKSQRETMGSGFIISGKKILT  171

Query  550  NAHVVADHTFV  582
            NAHV+ADHTFV
Sbjct  172  NAHVIADHTFV  182



>ref|XP_004155122.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cucumis sativus]
Length=601

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  370  SLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILT  549
            S+ +    +D + AIELALDSVVK+FTVS SP+Y LPWQNKSQRE+ GSGF+I G++ILT
Sbjct  112  SIKSKRFTTDTFSAIELALDSVVKVFTVSCSPNYILPWQNKSQRETMGSGFIISGKKILT  171

Query  550  NAHVVADHTFV  582
            NAHV+ADHTFV
Sbjct  172  NAHVIADHTFV  182



>ref|XP_006405960.1| hypothetical protein EUTSA_v10027701mg [Eutrema salsugineum]
 gb|ESQ47413.1| hypothetical protein EUTSA_v10027701mg [Eutrema salsugineum]
Length=578

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 2/65 (3%)
 Frame = +1

Query  394  SDAYY--AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            +DA Y  A++LALDSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GRRI+TNAHVVA
Sbjct  92   ADAAYSSAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRRIITNAHVVA  151

Query  568  DHTFV  582
            D++FV
Sbjct  152  DYSFV  156



>gb|KCW54014.1| hypothetical protein EUGRSUZ_I00006 [Eucalyptus grandis]
Length=417

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            S AY  IE ALDSVVKIFTVSSSP+Y LPWQNK  R++ GSGFVIPGRRI+TNAHVVADH
Sbjct  86   STAYSGIETALDSVVKIFTVSSSPNYLLPWQNKPPRDTWGSGFVIPGRRIVTNAHVVADH  145

Query  574  TFV  582
            TFV
Sbjct  146  TFV  148



>emb|CDY53528.1| BnaCnng25320D [Brassica napus]
Length=581

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++LA+DSVVKIFTVS+SPSYFLPWQNKSQRES GSGFVI GRRI+TNAHVVADH+FV
Sbjct  100  VDLAMDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRRIITNAHVVADHSFV  156



>ref|XP_007150859.1| hypothetical protein PHAVU_004G000300g [Phaseolus vulgaris]
 gb|ESW22853.1| hypothetical protein PHAVU_004G000300g [Phaseolus vulgaris]
Length=549

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+ELAL+SVVK+FTVS SP+Y LPWQNKSQRE+TGSGFVI GR+ILTNAHVVADHTFV
Sbjct  83   AVELALNSVVKVFTVSCSPNYLLPWQNKSQRETTGSGFVIFGRKILTNAHVVADHTFV  140



>ref|XP_010027457.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
 gb|KCW54013.1| hypothetical protein EUGRSUZ_I00006 [Eucalyptus grandis]
Length=567

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            S AY  IE ALDSVVKIFTVSSSP+Y LPWQNK  R++ GSGFVIPGRRI+TNAHVVADH
Sbjct  86   STAYSGIETALDSVVKIFTVSSSPNYLLPWQNKPPRDTWGSGFVIPGRRIVTNAHVVADH  145

Query  574  TFV  582
            TFV
Sbjct  146  TFV  148



>ref|XP_010110145.1| Protease Do-like 10 [Morus notabilis]
 gb|EXC25314.1| Protease Do-like 10 [Morus notabilis]
Length=542

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  397  DAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHT  576
            +A+   E  L+SVVKIFTVSSSP+YFLPWQNKSQR++TGSGFVI G+RI+TNAHVVADHT
Sbjct  66   EAHLGTEAVLESVVKIFTVSSSPNYFLPWQNKSQRDTTGSGFVIRGKRIVTNAHVVADHT  125

Query  577  FV  582
            FV
Sbjct  126  FV  127



>gb|KEH24728.1| DegP protease [Medicago truncatula]
Length=550

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+ELA +SVVKIFTVS SP+Y LPWQNKSQRES GSGFVI GR+ILTNAHVVADH+FV
Sbjct  75   AVELAFNSVVKIFTVSCSPNYLLPWQNKSQRESMGSGFVIHGRKILTNAHVVADHSFV  132



>ref|XP_003534464.1| PREDICTED: protease Do-like 10, mitochondrial-like [Glycine max]
Length=528

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+ELA +SVVKIFTVS SP+Y LPWQNKSQRE+ GSGFVI GR+ILTNAHVVADH+FV
Sbjct  62   AVELAFNSVVKIFTVSCSPNYLLPWQNKSQRETMGSGFVILGRKILTNAHVVADHSFV  119



>ref|XP_004489189.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cicer arietinum]
Length=550

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+ELA +SVVKIFTVS SP+Y LPWQNK+QRE+TGSGFVI G++ILTNAHVVADH+FV
Sbjct  72   AVELAFNSVVKIFTVSCSPNYLLPWQNKAQRETTGSGFVIMGKQILTNAHVVADHSFV  129



>ref|XP_006655329.1| PREDICTED: protease Do-like 10, mitochondrial-like [Oryza brachyantha]
Length=475

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  436  VKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +++FTVSSSPSYFLPWQNK+QRES GSGFVIPGRRI+TNAHVVADHTFV
Sbjct  1    MEVFTVSSSPSYFLPWQNKAQRESMGSGFVIPGRRIITNAHVVADHTFV  49



>gb|KCW54067.1| hypothetical protein EUGRSUZ_I00047 [Eucalyptus grandis]
Length=464

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            IE  LDSVVKIFTVSSSP Y LPWQNK  RE+ GSGFVI G RI+T+AHVVADHTF+
Sbjct  68   IETELDSVVKIFTVSSSPGYLLPWQNKPPREARGSGFVISGNRIITSAHVVADHTFI  124



>gb|KFK31613.1| hypothetical protein AALP_AA6G135800 [Arabis alpina]
Length=282

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  403  YYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            Y  I+LA++SVVK+FT SS PS   PWQN  Q ESTGSGFVI GR+ILTNAHVVADHTFV
Sbjct  10   YTPIDLAVNSVVKVFTASSKPSIVHPWQNWLQYESTGSGFVISGRKILTNAHVVADHTFV  69



>ref|XP_010027524.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
 gb|KCW54066.1| hypothetical protein EUGRSUZ_I00047 [Eucalyptus grandis]
Length=541

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            IE  LDSVVKIFTVSSSP Y LPWQNK  RE+ GSGFVI G RI+T+AHVVADHTF+
Sbjct  68   IETELDSVVKIFTVSSSPGYLLPWQNKPPREARGSGFVISGNRIITSAHVVADHTFI  124



>ref|XP_010027526.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Eucalyptus 
grandis]
 gb|KCW54070.1| hypothetical protein EUGRSUZ_I00050 [Eucalyptus grandis]
Length=534

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            IE ALDSVVKIFTV SSP Y LPWQNK  R++ GSGF IPG+RI+T+AHVVA+HTF+
Sbjct  69   IETALDSVVKIFTVFSSPDYVLPWQNKPPRQAWGSGFAIPGKRIITSAHVVAEHTFI  125



>ref|XP_010027525.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Eucalyptus 
grandis]
Length=554

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            IE ALDSVVKIFTV SSP Y LPWQNK  R++ GSGF IPG+RI+T+AHVVA+HTF+
Sbjct  69   IETALDSVVKIFTVFSSPDYVLPWQNKPPRQAWGSGFAIPGKRIITSAHVVAEHTFI  125



>gb|KCW54111.1| hypothetical protein EUGRSUZ_I000921, partial [Eucalyptus grandis]
Length=380

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            IE ALDSVVKIFTV SSP Y LPWQ K  R + GSGF IPGRRI+T+AHVVA+HTF+
Sbjct  69   IETALDSVVKIFTVFSSPDYVLPWQKKPPRRAWGSGFAIPGRRIITSAHVVAEHTFI  125



>gb|KCW54109.1| hypothetical protein EUGRSUZ_I00090, partial [Eucalyptus grandis]
Length=177

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +E ALDSVVKIFTVSSSP Y LPWQNK   E++GSGF  PG+RI+T AHVVAD  FV
Sbjct  1    METALDSVVKIFTVSSSPDYVLPWQNKPPSEASGSGFAFPGKRIITCAHVVADQAFV  57



>ref|XP_010027559.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
Length=533

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            IE ALDSVVKIFTV SSP Y LPWQ K  R + GSGF IPGRRI+T+AHVVA+HTF+
Sbjct  69   IETALDSVVKIFTVFSSPDYVLPWQKKPPRRAWGSGFAIPGRRIITSAHVVAEHTFI  125



>ref|XP_010042932.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Eucalyptus 
grandis]
Length=323

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +E ALDSVVKIFTVSSSP Y LPWQNK  R++ GSGF  PG+RI+T+AHVVAD  FV
Sbjct  1    METALDSVVKIFTVSSSPDYVLPWQNKLPRKAWGSGFAFPGKRIITSAHVVADQAFV  57



>ref|XP_010042933.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Eucalyptus 
grandis]
Length=314

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +E ALDSVVKIFTVSSSP Y LPWQNK  R++ GSGF  PG+RI+T+AHVVAD  FV
Sbjct  1    METALDSVVKIFTVSSSPDYVLPWQNKLPRKAWGSGFAFPGKRIITSAHVVADQAFV  57



>ref|XP_002963416.1| hypothetical protein SELMODRAFT_62730, partial [Selaginella moellendorffii]
 gb|EFJ35287.1| hypothetical protein SELMODRAFT_62730, partial [Selaginella moellendorffii]
Length=472

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  397  DAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHT  576
            D    ++ AL+SVVKIFTVSSSP+Y LPWQ K  RE TGSGF I  RRILTNAHVVADH+
Sbjct  6    DPQGGLDAALNSVVKIFTVSSSPNYVLPWQKKPLRELTGSGFAIADRRILTNAHVVADHS  65

Query  577  FV  582
            +V
Sbjct  66   YV  67



>ref|XP_002971553.1| hypothetical protein SELMODRAFT_62447, partial [Selaginella moellendorffii]
 gb|EFJ27302.1| hypothetical protein SELMODRAFT_62447, partial [Selaginella moellendorffii]
Length=463

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++ AL+SVVKIFTVSSSP+Y LPWQ K  RE TGSGF I  RRILTNAHVVADH++V
Sbjct  1    LDAALNSVVKIFTVSSSPNYVLPWQKKPLRELTGSGFAISDRRILTNAHVVADHSYV  57



>ref|XP_003288812.1| hypothetical protein DICPUDRAFT_153086 [Dictyostelium purpureum]
 gb|EGC34675.1| hypothetical protein DICPUDRAFT_153086 [Dictyostelium purpureum]
Length=607

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +1

Query  364  AESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRI  543
            +++ S T  +SD Y   +  LD +VK+F+V +SP++F+PWQ K QRE TGSGF+I GRRI
Sbjct  116  SQASSNTIELSDQYS--DPLLDPIVKVFSVLTSPNHFIPWQMKPQREVTGSGFIISGRRI  173

Query  544  LTNAHVVADHTFV  582
            LTNAHVVAD T V
Sbjct  174  LTNAHVVADQTLV  186



>ref|NP_564856.1| putativeDegP protease 3 [Arabidopsis thaliana]
 sp|Q9SHZ1.1|DEGP3_ARATH RecName: Full=Putative protease Do-like 3, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF23847.1|AC007234_19 F1E22.1 [Arabidopsis thaliana]
 gb|AEE34405.1| putativeDegP protease 3 [Arabidopsis thaliana]
Length=559

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 6/96 (6%)
 Frame = +1

Query  298  GLDDNNCGAAADGVQLINSESPAESLSTTSSISDAYY-AIELALDSVVKIFTVSSSPSYF  474
            G+++NN  +A     L N   P + +S+  +       AI+LAL+SVVK+FTVSS P  F
Sbjct  56   GVEENNSKSA-----LKNKLPPGKEVSSKDAKEKITTSAIDLALNSVVKVFTVSSKPRLF  110

Query  475  LPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
             PWQ   Q ESTGSGFVI G++ILTNAHVVA+ T V
Sbjct  111  QPWQITMQSESTGSGFVISGKKILTNAHVVANQTSV  146



>ref|XP_010030295.1| PREDICTED: uncharacterized protein LOC104420090 [Eucalyptus grandis]
Length=844

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  358  SPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGR  537
            SPA S  +    S     +E ALDSVVKIFTVSSSP Y LPWQNK   E++GSGF  PG+
Sbjct  424  SPALSSISRGDESPPNSEMETALDSVVKIFTVSSSPDYVLPWQNKPPSEASGSGFAFPGK  483

Query  538  RILTNAHVVADHTFV  582
            RI+T AHVVAD  FV
Sbjct  484  RIITCAHVVADQAFV  498



>ref|XP_002888435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64694.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=528

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +I+ A++SVVK+FTVSS PS   PWQN  Q+ES+GSGFVI G++ILTNAHVVADH F+
Sbjct  67   SIDFAVNSVVKVFTVSSVPSILQPWQNWQQQESSGSGFVISGKKILTNAHVVADHIFL  124



>ref|XP_640805.1| hypothetical protein DDB_G0281081 [Dictyostelium discoideum AX4]
 gb|EAL66837.1| hypothetical protein DDB_G0281081 [Dictyostelium discoideum AX4]
Length=647

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  346  INSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFV  525
            I+S   A   S+   +S+ Y   +  LD VVK+F+V +SP+YF+PWQ K QRE TGSGF+
Sbjct  123  ISSIQQATGGSSIMELSEQY--TDPLLDPVVKVFSVLTSPNYFIPWQMKPQREVTGSGFI  180

Query  526  IPGRRILTNAHVVADHTFV  582
            I G+RILTNAHVVAD T V
Sbjct  181  ISGKRILTNAHVVADQTLV  199



>emb|CDY35320.1| BnaA04g15270D [Brassica napus]
Length=540

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +1

Query  319  GAAADGVQLINSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQ  498
            G A D +  +  ES  +    T+  S    AI+LAL+SVVK+FTVSS P  F PWQ   Q
Sbjct  57   GTAKDKITPVKEESSVDEAKKTTPPS----AIDLALNSVVKVFTVSSKPRLFQPWQISMQ  112

Query  499  RESTGSGFVIPGRRILTNAHVVADHTFV  582
             E +GSGF+I G++I+TNAHVV +HT V
Sbjct  113  NECSGSGFLISGKKIITNAHVVDNHTSV  140



>ref|XP_005831529.1| hypothetical protein GUITHDRAFT_72154 [Guillardia theta CCMP2712]
 gb|EKX44549.1| hypothetical protein GUITHDRAFT_72154 [Guillardia theta CCMP2712]
Length=393

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  418  LALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +  +S++K++TV++SP++F+PWQ K QRESTGSGF+I GRRI+TNAH VAD   V
Sbjct  1    MTFNSIIKVYTVAASPNWFMPWQTKQQRESTGSGFIIEGRRIITNAHCVADQAHV  55



>ref|NP_564857.2| DegP protease 4 [Arabidopsis thaliana]
 gb|AEE34406.1| DegP protease 4 [Arabidopsis thaliana]
Length=436

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 11/121 (9%)
 Frame = +1

Query  220  FRPCSADGFKYsssvlfstastsaENGLDDNNCGAAADGVQLINSESPAESLSTTSSISD  399
            F   S  GF++S  +L        EN    N+  A A G    +++ P  + + TSS   
Sbjct  15   FLLISVLGFRFSPLLLLGYVKLQDEN--KHNSESALASGT---DAKQPEAAENVTSS---  66

Query  400  AYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTF  579
               +I+ A++SVVK+FTV S PS   PW+N  Q+ES GSGFVI G++ILTNAHVVADH F
Sbjct  67   ---SIDFAVNSVVKVFTVYSMPSVLQPWRNWPQQESGGSGFVISGKKILTNAHVVADHIF  123

Query  580  V  582
            +
Sbjct  124  L  124



>gb|ABE65743.1| DegP protease [Arabidopsis thaliana]
Length=436

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 11/121 (9%)
 Frame = +1

Query  220  FRPCSADGFKYsssvlfstastsaENGLDDNNCGAAADGVQLINSESPAESLSTTSSISD  399
            F   S  GF++S  +L        EN    N+  A A G    +++ P  + + TSS   
Sbjct  15   FLLISVLGFRFSPLLLLGYVKLQDEN--KHNSESALASGT---DAKQPEAAENVTSS---  66

Query  400  AYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTF  579
               +I+ A++SVVK+FTV S PS   PW+N  Q+ES GSGFVI G++ILTNAHVVADH F
Sbjct  67   ---SIDFAVNSVVKVFTVYSMPSVLQPWRNWPQQESGGSGFVISGKKILTNAHVVADHIF  123

Query  580  V  582
            +
Sbjct  124  L  124



>gb|AAB60913.1| F5I14.17 gene product [Arabidopsis thaliana]
Length=450

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 11/121 (9%)
 Frame = +1

Query  220  FRPCSADGFKYsssvlfstastsaENGLDDNNCGAAADGVQLINSESPAESLSTTSSISD  399
            F   S  GF++S  +L        EN    N+  A A G    +++ P  + + TSS   
Sbjct  15   FLLISVLGFRFSPLLLLGYVKLQDEN--KHNSESALASGT---DAKQPEAAENVTSS---  66

Query  400  AYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTF  579
               +I+ A++SVVK+FTV S PS   PW+N  Q+ES GSGFVI G++ILTNAHVVADH F
Sbjct  67   ---SIDFAVNSVVKVFTVYSMPSVLQPWRNWPQQESGGSGFVISGKKILTNAHVVADHIF  123

Query  580  V  582
            +
Sbjct  124  L  124



>sp|Q9SHZ0.1|DEGP4_ARATH RecName: Full=Protease Do-like 4, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF23846.1|AC007234_18 F1E22.2 [Arabidopsis thaliana]
Length=518

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 11/121 (9%)
 Frame = +1

Query  220  FRPCSADGFKYsssvlfstastsaENGLDDNNCGAAADGVQLINSESPAESLSTTSSISD  399
            F   S  GF++S  +L        EN    N+  A A G    +++ P  + + TSS   
Sbjct  15   FLLISVLGFRFSPLLLLGYVKLQDEN--KHNSESALASGT---DAKQPEAAENVTSS---  66

Query  400  AYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTF  579
               +I+ A++SVVK+FTV S PS   PW+N  Q+ES GSGFVI G++ILTNAHVVADH F
Sbjct  67   ---SIDFAVNSVVKVFTVYSMPSVLQPWRNWPQQESGGSGFVISGKKILTNAHVVADHIF  123

Query  580  V  582
            +
Sbjct  124  L  124



>ref|XP_004357429.1| hypothetical protein DFA_02707 [Dictyostelium fasciculatum]
 gb|EGG18967.1| hypothetical protein DFA_02707 [Dictyostelium fasciculatum]
Length=631

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  352  SESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIP  531
            SE PA   S+T     +    +  LD ++K+F+V +SP++F PWQ ++Q+E TGSGFVI 
Sbjct  151  SEQPAGGASSTPGYMVSPNESDPLLDPIIKVFSVLASPNHFTPWQMRTQKEVTGSGFVIK  210

Query  532  GRRILTNAHVVADHTFV  582
            G+RILTNAHVVAD T +
Sbjct  211  GKRILTNAHVVADQTSI  227



>ref|XP_002888434.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64693.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 8/82 (10%)
 Frame = +1

Query  337  VQLINSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGS  516
            V+ ++S+  AE+++T+        AI+LAL+SVVK+F VSS    F PWQ   Q E TGS
Sbjct  83   VKEVSSDDAAENMTTS--------AIDLALNSVVKVFIVSSKHRIFQPWQISMQSECTGS  134

Query  517  GFVIPGRRILTNAHVVADHTFV  582
            GFVI G+RILTNAHVVAD T V
Sbjct  135  GFVISGKRILTNAHVVADQTSV  156



>ref|XP_010511113.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=562

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            AI+LA +SVVK+FTV S P  F PWQ   Q E TGSGFVI G++ILTNAHVVADHT V
Sbjct  90   AIDLAFNSVVKVFTVFSKPRIFQPWQISMQSECTGSGFVISGKKILTNAHVVADHTSV  147



>ref|XP_010418975.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=572

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            AI+LA +SVVK+FTV S P  F PWQ   Q + TGSGFVI G++ILTNAHVVADHT V
Sbjct  100  AIDLAFNSVVKVFTVYSKPRIFQPWQISMQSQCTGSGFVISGKKILTNAHVVADHTSV  157



>gb|EFA82977.1| hypothetical protein PPL_03755 [Polysphondylium pallidum PN500]
Length=566

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHT  576
            LD VVK+F+V SSP+++ PWQ K QRE TGSGFVI G+RILTNAHVVAD T
Sbjct  107  LDPVVKVFSVLSSPNHYTPWQMKPQREVTGSGFVITGKRILTNAHVVADQT  157



>emb|CDY66494.1| BnaCnng51100D [Brassica napus]
Length=513

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            AI+LAL+SVVK+FTVSS P  F PWQ   Q E +GSGF+I G++I+TNAHVV +HT V
Sbjct  187  AIDLALNSVVKVFTVSSKPRLFQPWQISMQNECSGSGFLISGKKIITNAHVVDNHTSV  244



>ref|XP_002951860.1| trypsin family [Volvox carteri f. nagariensis]
 gb|EFJ46965.1| trypsin family [Volvox carteri f. nagariensis]
Length=571

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
             LDS++KI+TV S P+Y LPWQN  +RESTG+GFV+  R ILTNAHVVAD T+V
Sbjct  112  VLDSIIKIYTVHSRPNYTLPWQNHPKRESTGTGFVVHDRLILTNAHVVADATYV  165



>ref|XP_006286181.1| hypothetical protein CARUB_v10007745mg [Capsella rubella]
 gb|EOA19079.1| hypothetical protein CARUB_v10007745mg [Capsella rubella]
Length=482

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
             LDSVV I T SS P+   PWQN  QR+S+GSGFV+PGR+I+TNAHVVADH  V
Sbjct  63   VLDSVVMIHTCSSKPNICYPWQNMPQRKSSGSGFVVPGRKIITNAHVVADHILV  116



>ref|XP_010436835.1| PREDICTED: LOW QUALITY PROTEIN: putative protease Do-like 13 
[Camelina sativa]
Length=520

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  415  ELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            E  LDSVVKI T  S P+ F PWQN  QR S GSGFVI G+RI+TNAHVVADH  V
Sbjct  57   ESVLDSVVKIHTFYSKPNIFYPWQNNPQRYSKGSGFVISGKRIITNAHVVADHILV  112



>ref|XP_002886956.1| hypothetical protein ARALYDRAFT_315601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63215.1| hypothetical protein ARALYDRAFT_315601 [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            AI+LAL+SVVK+FTVS+    F PWQ   Q E TGSGFVI GR+ILTNAHVVA+HT V
Sbjct  81   AIDLALNSVVKVFTVSNKHRTFQPWQFCLQDEGTGSGFVIAGRKILTNAHVVANHTSV  138



>ref|XP_009140719.1| PREDICTED: putative protease Do-like 3, mitochondrial [Brassica 
rapa]
Length=634

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +1

Query  346  INSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFV  525
            +N +   ES    +  +    AI+LAL+SVVK+FTVSS P  F PWQ   Q E +GSGF+
Sbjct  143  VNHKEKEESSVDEAKKTTPPSAIDLALNSVVKVFTVSSKPRLFQPWQISMQNECSGSGFL  202

Query  526  IPGRRILTNAHVVADHTFV  582
            I G++I+TNAHVV +HT V
Sbjct  203  ISGKKIITNAHVVDNHTSV  221



>ref|XP_010513422.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=502

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  370  SLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILT  549
            S S+       Y  I+LAL+SVVK+F  S+  S   PWQ +  + STGSGFVI G ++LT
Sbjct  34   SFSSVLEEKTKYSVIDLALNSVVKVFCRSTKSSVLQPWQKRLPQRSTGSGFVISGNKVLT  93

Query  550  NAHVVADHTFV  582
            NAHVVADHTFV
Sbjct  94   NAHVVADHTFV  104



>gb|AAB60923.1| F5I14.16 [Arabidopsis thaliana]
Length=487

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 63/109 (58%), Gaps = 19/109 (17%)
 Frame = +1

Query  298  GLDDNNCGAAADGVQLINSESPAESLSTTSSISDAYY-AIELALDSVVKIFTVSSSPSYF  474
            G+++NN  +A     L N   P + +S+  +       AI+LAL+SVVK+FTVSS P  F
Sbjct  56   GVEENNSKSA-----LKNKLPPGKEVSSKDAKEKITTSAIDLALNSVVKVFTVSSKPRLF  110

Query  475  LPWQNKSQRESTGS-------------GFVIPGRRILTNAHVVADHTFV  582
             PWQ   Q ESTGS             GFVI G++ILTNAHVVA+ T V
Sbjct  111  QPWQITMQSESTGSGIDNFIHILGMVVGFVISGKKILTNAHVVANQTSV  159



>dbj|GAM25013.1| hypothetical protein SAMD00019534_081880 [Acytostelium subglobosum 
LB1]
Length=505

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHT  576
            LD +VK+F+V +SP++++PWQ K QRE TGSGFVI GR+ILTNAH VAD T
Sbjct  50   LDPIVKVFSVLASPNHYVPWQMKVQREITGSGFVIQGRKILTNAHCVADQT  100



>ref|XP_006301507.1| hypothetical protein CARUB_v10021933mg [Capsella rubella]
 gb|EOA34405.1| hypothetical protein CARUB_v10021933mg [Capsella rubella]
Length=566

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            I+LA ++VVK++TV S P  F PWQ   +RE TGSGFVI G++ILTNAHVVA+HT V
Sbjct  97   IDLAFNAVVKVYTVYSKPRIFQPWQISMERECTGSGFVISGKKILTNAHVVANHTSV  153



>sp|Q9FM41.1|DGP13_ARATH RecName: Full=Putative protease Do-like 13 [Arabidopsis thaliana]
 dbj|BAB08526.1| unnamed protein product [Arabidopsis thaliana]
Length=486

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A E  L+SVVKI T SS P+   PWQNK Q++S GSGFVIPG+ I+TNAHVVA+H  V
Sbjct  34   ATESVLNSVVKINTFSSKPNICYPWQNKPQKKSKGSGFVIPGKMIITNAHVVANHILV  91



>ref|XP_002499997.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61255.1| predicted protein, partial [Micromonas sp. RCC299]
Length=476

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 5/58 (9%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIP-----GRRILTNAHVVADHTFV  582
            L SVVK+FTV SSP+YF PWQNK QRE++GSG V+      G  ILTNAHVVAD TFV
Sbjct  1    LQSVVKVFTVHSSPNYFQPWQNKPQRETSGSGVVVAAPVPGGVGILTNAHVVADQTFV  58



>ref|XP_002886957.1| hypothetical protein ARALYDRAFT_894151 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63216.1| hypothetical protein ARALYDRAFT_894151 [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  388  SISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            S    Y   +LAL+SVVK+F  S+  S   PWQ +    STGSGFVI G +ILTNAHVVA
Sbjct  34   SFCSKYSVTDLALNSVVKVFCRSTKSSVLQPWQKRLPHRSTGSGFVISGNKILTNAHVVA  93

Query  568  DHTFV  582
            DHTFV
Sbjct  94   DHTFV  98



>ref|XP_006391531.1| hypothetical protein EUTSA_v10019570mg, partial [Eutrema salsugineum]
 gb|ESQ28817.1| hypothetical protein EUTSA_v10019570mg, partial [Eutrema salsugineum]
Length=489

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
             I+LAL+SVVK+F  SS PS   PWQ +  + + GSGFVI   +ILTNAHVVADHTFV
Sbjct  32   VIDLALNSVVKVFCRSSKPSVLQPWQKRLPQLNNGSGFVISRNKILTNAHVVADHTFV  89



>ref|XP_003055699.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60951.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=492

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 5/59 (8%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIP-----GRRILTNAHVVADHTFV  582
            AL SVV++FTV SSP+YF PW NK+QRES GSG V+      G  +LTNAHVVAD TFV
Sbjct  1    ALQSVVRVFTVHSSPNYFQPWANKTQRESFGSGVVVEAPVPGGVGVLTNAHVVADQTFV  59



>gb|EYU42546.1| hypothetical protein MIMGU_mgv1a0052331mg, partial [Erythranthe 
guttata]
Length=105

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = +1

Query  352  SESPAESLSTTSSISDAYYAIEL---ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGF  522
            S SP  S + ++++ +A  A+     A+D+VVK+F V + P++ LPWQ K Q  S+ SGF
Sbjct  2    SVSPIVSAAVSTALINAENAVARVLPAMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGF  61

Query  523  VIPGRRILTNAHVVADHTFV  582
            VI GRR+LTNAH V  +T V
Sbjct  62   VIKGRRVLTNAHSVEHYTQV  81



>ref|XP_006339987.1| PREDICTED: protease Do-like 9-like [Solanum tuberosum]
Length=581

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = +1

Query  340  QLINSESPAESL-STTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGS  516
            +LI+  +   SL S+ S+I++A   +  A+D+VVK+F V + P+Y LPWQ K Q  S+ S
Sbjct  88   RLIDKPNGVPSLISSESTITNAAARVVPAMDAVVKVFCVHTEPNYSLPWQRKRQYSSSSS  147

Query  517  GFVIPGRRILTNAHVVADHTFV  582
            GFVI GRR+LTNAH V  +T V
Sbjct  148  GFVIKGRRVLTNAHSVEHYTQV  169



>gb|KDD74963.1| hypothetical protein H632_c960p1 [Helicosporidium sp. ATCC 50920]
Length=538

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            + +S+    +E  +++VVK+F V S P++ LPWQ K Q  S+GSGFVI GRRILTNAH V
Sbjct  17   ADLSETRSGLESQMEAVVKVFCVHSEPNFSLPWQRKRQFSSSGSGFVISGRRILTNAHCV  76

Query  565  ADHTFV  582
              HT V
Sbjct  77   DHHTQV  82



>emb|CDY07457.1| BnaA07g25360D [Brassica napus]
Length=483

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
             I+LAL+SVVK+F  SS  +   PWQ    R+ +GSGFVI   +ILTNAHVVADHTFV
Sbjct  42   VIDLALNSVVKVFCSSSKSNVLQPWQKNLPRQCSGSGFVISNNKILTNAHVVADHTFV  99



>ref|XP_002502087.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63345.1| predicted protein [Micromonas sp. RCC299]
Length=463

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +D+VVK+F   + P+Y LPWQ K Q  ST SGFVIPGRR+LTNAH V  HT V
Sbjct  1    MDAVVKVFCTHTEPNYSLPWQRKRQSASTSSGFVIPGRRVLTNAHSVEHHTQV  53



>ref|XP_009105158.1| PREDICTED: putative protease Do-like 3, mitochondrial [Brassica 
rapa]
Length=483

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
             I+LAL+SVVK+F  SS  +   PWQ    R+ +GSGFVI   +ILTNAHVVADHTFV
Sbjct  42   VIDLALNSVVKVFCSSSKSNVLQPWQKNLPRQCSGSGFVISNNKILTNAHVVADHTFV  99



>gb|KIY96346.1| Protease Do-like 10 [Monoraphidium neglectum]
Length=263

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  415  ELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            E  LDS+VKI+ V S   + LPWQ   +RE TG+GFVI  R ILTNAHVVAD T++
Sbjct  42   EGVLDSIVKIYCVYSRSDWLLPWQAHPKREGTGTGFVIRDRLILTNAHVVADQTYI  97



>ref|XP_004344572.1| DegPtype protease [Acanthamoeba castellanii str. Neff]
 gb|ELR20829.1| DegPtype protease [Acanthamoeba castellanii str. Neff]
Length=561

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  418  LALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            L L+ V+K+++  +SP+Y +PWQ K+  E  GS F + GRRILTNAHVVADHT++
Sbjct  70   LPLEPVIKVYSHVTSPNYVMPWQMKATSEKVGSAFALSGRRILTNAHVVADHTYI  124



>gb|KFK41004.1| hypothetical protein AALP_AA2G073000 [Arabis alpina]
Length=444

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  403  YYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            Y  I+L L+SVVK+F  S+  S   PWQ +   +S+GSGFVI   RILTNAHVVADH F+
Sbjct  45   YSVIDLTLNSVVKVFCGSTKSSVLQPWQKRLPEQSSGSGFVIAKNRILTNAHVVADHKFL  104



>ref|XP_002985706.1| hypothetical protein SELMODRAFT_122577, partial [Selaginella 
moellendorffii]
 gb|EFJ13284.1| hypothetical protein SELMODRAFT_122577, partial [Selaginella 
moellendorffii]
Length=490

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  418  LALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            L LD VVK++   S P Y LPWQ + Q  STGSGFVI GRR+LTNAH V  HT V
Sbjct  7    LCLDGVVKVYCTHSEPDYSLPWQKQRQFMSTGSGFVISGRRLLTNAHCVEHHTQV  61



>ref|XP_005845738.1| hypothetical protein CHLNCDRAFT_58432 [Chlorella variabilis]
 gb|EFN53636.1| hypothetical protein CHLNCDRAFT_58432 [Chlorella variabilis]
Length=941

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +++VVK+FTV S P++ LPWQ K Q  S+GSGFVI GRR+LTNAH V  HT V
Sbjct  110  MEAVVKVFTVHSEPNFSLPWQRKRQFSSSGSGFVIAGRRLLTNAHCVDHHTQV  162



>ref|NP_680437.1| degradation of periplasmic protein 16 [Arabidopsis thaliana]
 sp|Q3E8B4.1|DGP15_ARATH RecName: Full=Putative Do-like 15 protein [Arabidopsis thaliana]
 gb|AED96533.1| degradation of periplasmic protein 16 [Arabidopsis thaliana]
Length=198

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            I+LA DSVVKIF+ S  P+   PWQ  +++E + SGF I GRRILTNAHVV DH+++
Sbjct  39   IDLAQDSVVKIFSFSREPNVVQPWQT-TEKEYSSSGFAISGRRILTNAHVVGDHSYL  94



>ref|XP_011399889.1| Protease Do-like 9 [Auxenochlorella protothecoides]
 gb|KFM26933.1| Protease Do-like 9 [Auxenochlorella protothecoides]
Length=465

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +++VVK+F V S P++ LPWQ K Q  S+GSGFV+ GRRILTNAH V  HT V
Sbjct  1    MEAVVKVFAVHSEPNFSLPWQRKRQFSSSGSGFVVAGRRILTNAHCVDHHTQV  53



>ref|XP_002866058.1| hypothetical protein ARALYDRAFT_357728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42317.1| hypothetical protein ARALYDRAFT_357728 [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            AI+ ALDSVVKIF  SS P    PW+N     +TGSGF I GRRILTNAHVV DH+++
Sbjct  71   AIDSALDSVVKIFCFSSEPDVAEPWKNSWVGLATGSGFAIFGRRILTNAHVVEDHSYL  128



>ref|XP_004252189.1| PREDICTED: protease Do-like 9 [Solanum lycopersicum]
Length=584

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = +1

Query  340  QLINSESPAESL--STTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTG  513
            +LI+  +   SL  S T+ I+ +   +  A+D+VVK+F V + P+Y LPWQ K Q  S+ 
Sbjct  90   RLIDKPNGVPSLISSETTIINASVARVMPAMDAVVKVFCVHTEPNYSLPWQRKRQYSSSS  149

Query  514  SGFVIPGRRILTNAHVVADHTFV  582
            SGFVI GRR+LTNAH V  +T V
Sbjct  150  SGFVIKGRRVLTNAHSVEHYTQV  172



>ref|XP_001748733.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ86343.1| predicted protein [Monosiga brevicollis MX1]
Length=664

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  415  ELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +L + SVVKIFTV+S P+Y LPWQ       +GSGF++ GRRI+TNAHVV+++T V
Sbjct  176  KLPVGSVVKIFTVTSKPNYLLPWQMGGPDACSGSGFLVAGRRIITNAHVVSNYTQV  231



>ref|XP_010440805.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Camelina 
sativa]
Length=567

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGS  516
            S A  A++LALDSVVKIFTVS+SPSYFLPWQNKSQRES GS
Sbjct  105  SPAADAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGS  145



>ref|XP_008353481.1| PREDICTED: protease Do-like 9, partial [Malus domestica]
Length=395

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  91   AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHHTQV  144



>ref|XP_008341480.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=580

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  116  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHHTQV  169



>ref|XP_009349862.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=562

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V ++P++ LPWQ K Q  S+ SGFVI GRRILTNAH V  HT V
Sbjct  72   SMDAVVKVFCVHTAPNFSLPWQRKKQHSSSSSGFVIGGRRILTNAHSVDHHTQV  125



>ref|XP_004306333.2| PREDICTED: protease Do-like 9 [Fragaria vesca subsp. vesca]
Length=560

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+DSVVK+F V + P++ LPWQ K Q  S+ SGFVI G+R+LTNAH V  HT V
Sbjct  96   AMDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGKRVLTNAHSVEHHTQV  149



>ref|XP_003057446.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59091.1| predicted protein [Micromonas pusilla CCMP1545]
Length=463

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +D+VVK+F   + P+Y LPWQ K Q  ST SGF+I GRRILTNAH V  HT V
Sbjct  1    MDAVVKVFCTHTEPNYSLPWQRKRQSASTSSGFIIRGRRILTNAHSVEHHTSV  53



>gb|AAG50541.1|AC079828_12 hypothetical protein [Arabidopsis thaliana]
Length=257

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            SS+SD    +++A D+VVKIF+ S  P+   PWQ  +++E + SGF I GRRILTNAHVV
Sbjct  47   SSVSD----VDVARDAVVKIFSFSREPNVVQPWQT-TEKEYSSSGFAISGRRILTNAHVV  101

Query  565  ADHTFV  582
             DH ++
Sbjct  102  GDHLYL  107



>ref|XP_006405537.1| hypothetical protein EUTSA_v10027697mg [Eutrema salsugineum]
 gb|ESQ46990.1| hypothetical protein EUTSA_v10027697mg [Eutrema salsugineum]
Length=589

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = +1

Query  307  DNNCGAAADGVQLINSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQ  486
            D   G  ++G+ ++++ + AES+    S  +    +  ++D+VVK+F V + P++ LPWQ
Sbjct  89   DQKNGDCSNGI-IVSTTTIAESIPAPPSW-ETVVKVAPSMDAVVKVFCVHTEPNFSLPWQ  146

Query  487  NKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
             K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  147  RKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  178



>ref|NP_175527.2| DegP protease 6 [Arabidopsis thaliana]
 sp|Q9C691.2|DEGP6_ARATH RecName: Full=Putative protease Do-like 6, chloroplastic; Short=DEGP 
protease 6; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32627.1| DegP protease 6 [Arabidopsis thaliana]
Length=219

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            SS+SD    +++A D+VVKIF+ S  P+   PWQ  +++E + SGF I GRRILTNAHVV
Sbjct  47   SSVSD----VDVARDAVVKIFSFSREPNVVQPWQT-TEKEYSSSGFAISGRRILTNAHVV  101

Query  565  ADHTFV  582
             DH ++
Sbjct  102  GDHLYL  107



>ref|XP_010678715.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=487

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHT  576
            +DSVVK+F V + P++FLPWQ K Q  S+ +GFVI GRRILTNA  V  HT
Sbjct  22   MDSVVKVFCVHTMPNFFLPWQRKRQHSSSSTGFVIAGRRILTNAKSVEYHT  72



>ref|XP_004306334.1| PREDICTED: protease Do-like 9 [Fragaria vesca subsp. vesca]
Length=530

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  ++ SGFVI GRR+LTNAH V  HT V
Sbjct  66   AMDAVVKVFCVHTEPNFSLPWQRKKQYSTSSSGFVIKGRRVLTNAHSVDHHTQV  119



>ref|XP_009348028.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=563

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V ++P++ LPWQ K Q  S+ SGFVI GRRILTNAH V  HT V
Sbjct  73   SMDAVVKVFCVHTAPNFSLPWQRKKQYSSSSSGFVIGGRRILTNAHSVDHHTQV  126



>ref|XP_009609751.1| PREDICTED: protease Do-like 9 [Nicotiana tomentosiformis]
Length=577

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P+Y LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  112  AMDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFVIKGRRVLTNAHSVEHYTQV  165



>ref|XP_009794183.1| PREDICTED: protease Do-like 9 [Nicotiana sylvestris]
Length=575

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P+Y LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  110  AMDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFVIKGRRVLTNAHSVEHYTQV  163



>ref|XP_010254385.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=577

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  418  LALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            L++D+VV++F V + P++ LPWQ K Q  S+ SGFVI GRRILTNAH V  HT V
Sbjct  112  LSMDAVVRVFCVHTKPNFSLPWQRKRQFSSSSSGFVIAGRRILTNAHSVDYHTQV  166



>ref|XP_010272002.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=551

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +1

Query  292  ENGLDDNNCGAAADGVQLINSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSY  471
            + G+  +  G A+  +Q     +P  SL   S   D       ++D+VV++F V + P++
Sbjct  44   DTGVLASPVGKASHTLQNNGERAPIPSLGVDSVARDNGVKAVSSMDAVVRVFCVHTKPNF  103

Query  472  FLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
             LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  104  SLPWQRKRQFSSSSSGFVIDGRRVLTNAHSVDYHTQV  140



>ref|XP_007216372.1| hypothetical protein PRUPE_ppa021785mg, partial [Prunus persica]
 gb|EMJ17571.1| hypothetical protein PRUPE_ppa021785mg, partial [Prunus persica]
Length=535

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V ++P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  66   SMDAVVKVFCVHTAPNFSLPWQRKKQYSSSSSGFVIGGRRVLTNAHSVDHHTQV  119



>ref|XP_001693806.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09060.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=185

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +D+VVK+F +   P++ LPWQ K Q  S  SGF++PGRRILTNAH V  +T V
Sbjct  1    MDAVVKVFCMHVEPNFSLPWQRKRQYSSNSSGFLLPGRRILTNAHCVDHYTQV  53



>ref|XP_008230647.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=560

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V ++P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  66   SMDAVVKVFCVHTAPNFSLPWQRKKQYSSSSSGFVIGGRRVLTNAHSVDHHTQV  119



>emb|CBI34956.3| unnamed protein product [Vitis vinifera]
Length=464

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +D+VVK+F V + P++ LPWQ K Q  S+ SGF+I GRR+LTNAH V  HT V
Sbjct  1    MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIEGRRVLTNAHSVEHHTQV  53



>ref|XP_002275131.1| PREDICTED: protease Do-like 9 [Vitis vinifera]
 ref|XP_010660947.1| PREDICTED: protease Do-like 9 [Vitis vinifera]
 ref|XP_010660948.1| PREDICTED: protease Do-like 9 [Vitis vinifera]
Length=579

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGF+I GRR+LTNAH V  HT V
Sbjct  115  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIEGRRVLTNAHSVEHHTQV  168



>emb|CAN62736.1| hypothetical protein VITISV_027750 [Vitis vinifera]
Length=558

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGF+I GRR+LTNAH V  HT V
Sbjct  115  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIEGRRVLTNAHSVEHHTQV  168



>ref|XP_008348037.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=557

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  72   SMDAVVKVFCVHTEPNFSLPWQRKKQYSSSSSGFVIRGRRVLTNAHSVDHHTQV  125



>ref|XP_009344540.1| PREDICTED: protease Do-like 9 isoform X2 [Pyrus x bretschneideri]
Length=552

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  67   SMDAVVKVFCVHTEPNFSLPWQRKKQYSSSSSGFVIRGRRVLTNAHSVDHHTQV  120



>ref|XP_009344539.1| PREDICTED: protease Do-like 9 isoform X1 [Pyrus x bretschneideri]
Length=558

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  67   SMDAVVKVFCVHTEPNFSLPWQRKKQYSSSSSGFVIRGRRVLTNAHSVDHHTQV  120



>ref|XP_003525265.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=584

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+DSVVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  120  AMDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  173



>ref|XP_005644766.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
 gb|EIE20222.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
Length=473

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +++VVK+F + S P+Y LPWQ K Q  ST SGF+I G+RILTNAH V  HT V
Sbjct  1    METVVKVFCMHSEPNYSLPWQRKRQFSSTSSGFIISGKRILTNAHSVDHHTQV  53



>ref|XP_003550747.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=576

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+DSVVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  112  AMDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  165



>ref|XP_001774430.1| predicted protein [Physcomitrella patens]
 gb|EDQ60793.1| predicted protein [Physcomitrella patens]
Length=467

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  1    MDAVVKVFCVHTEPNFSLPWQRKRQFSSNSSGFIIKGRRVLTNAHSVEHHTQV  53



>gb|EYU29924.1| hypothetical protein MIMGU_mgv1a005009mg [Erythranthe guttata]
Length=501

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++DSVVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  101  SMDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIKGRRVLTNAHSVEHYTQV  154



>ref|XP_011071819.1| PREDICTED: protease Do-like 9 isoform X2 [Sesamum indicum]
Length=492

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  28   AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIKGRRVLTNAHSVEHYTQV  81



>ref|XP_008348203.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=536

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHT  576
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT
Sbjct  72   SMDAVVKVFCVHTEPNFSLPWQRKKQYSSSSSGFVIRGRRVLTNAHSVDHHT  123



>ref|XP_009140230.1| PREDICTED: protease Do-like 9 [Brassica rapa]
Length=584

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 48/93 (52%), Gaps = 7/93 (8%)
 Frame = +1

Query  304  DDNNCGAAADGVQLINSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPW  483
            D NN G          S   A S  T   +  +       +D+VVK+F V + P++ LPW
Sbjct  88   DCNNNGTTVSAAATAESTPAAPSWETVVKVVPS-------MDAVVKVFCVHTDPNFSLPW  140

Query  484  QNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            Q K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  141  QMKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  173



>ref|XP_006282154.1| hypothetical protein CARUB_v10028411mg [Capsella rubella]
 gb|EOA15052.1| hypothetical protein CARUB_v10028411mg [Capsella rubella]
Length=508

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 48/79 (61%), Gaps = 8/79 (10%)
 Frame = +1

Query  346  INSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFV  525
            +NS+S  ES  T  S      AI+ ALDSVVKIF   S P    PW N  +  + GSGF 
Sbjct  64   VNSQS--ESTHTEKS------AIDTALDSVVKIFCFCSEPDDDKPWTNSYEGLAEGSGFA  115

Query  526  IPGRRILTNAHVVADHTFV  582
            I GRRILTNAHVV DH ++
Sbjct  116  ILGRRILTNAHVVEDHLYL  134



>ref|XP_002280249.1| PREDICTED: protease Do-like 9 [Vitis vinifera]
Length=575

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +1

Query  322  AAADGVQLINSESPAESLSTTS-SISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQ  498
            AA +   +++   P + LS    S  +A   +  A+D+VVK+F V + P++ LPWQ K Q
Sbjct  77   AAENADFVVSMSVPGDGLSAEQPSRIEAVARVVPAMDAVVKVFCVHTEPNFSLPWQRKRQ  136

Query  499  RESTGSGFVIPGRRILTNAHVVADHTFV  582
              S+ SGFVI GRR+LTNAH V  +T V
Sbjct  137  YSSSSSGFVIGGRRVLTNAHSVEHYTQV  164



>ref|XP_006283387.1| hypothetical protein CARUB_v10004432mg [Capsella rubella]
 gb|EOA16285.1| hypothetical protein CARUB_v10004432mg [Capsella rubella]
Length=590

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  122  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  175



>ref|XP_002868670.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44929.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  124  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  177



>ref|NP_568577.1| DegP protease 9 [Arabidopsis thaliana]
 sp|Q9FL12.1|DEGP9_ARATH RecName: Full=Protease Do-like 9 [Arabidopsis thaliana]
 dbj|BAB10901.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAK76697.1| putative DegP protease [Arabidopsis thaliana]
 gb|AAN13177.1| putative DegP protease [Arabidopsis thaliana]
 gb|AED94519.1| DegP protease 9 [Arabidopsis thaliana]
Length=592

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  124  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  177



>emb|CAX68967.1| periplasmic serine endoprotease of the DegP/Htr family [uncultured 
bacterium]
Length=486

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  427  DSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            DSVV++F   ++ +++LPWQ K   E +G+GF+I G RILTNAHVV D TF+
Sbjct  29   DSVVRVFVTHNTVNHYLPWQYKGSEELSGTGFIISGNRILTNAHVVNDATFI  80



>ref|XP_008341479.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=564

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 55/95 (58%), Gaps = 6/95 (6%)
 Frame = +1

Query  298  GLDDNNCGAAADGVQLINSESPAESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFL  477
            GL D N G   D + +++   P  S+     +      +  ++D+VVK+F V ++P++ L
Sbjct  38   GLADQNGGCGNDLLSVVSE--PPMSVPRWQRVG----RVVPSMDAVVKVFCVHTAPNFSL  91

Query  478  PWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            PWQ K Q  S+ SGFVI GR ILTNAH V  HT V
Sbjct  92   PWQRKKQYSSSSSGFVIGGRMILTNAHSVDHHTQV  126



>ref|XP_006446449.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
 gb|ESR59689.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
Length=586

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGF++ GRR+LTNAH V  HT V
Sbjct  122  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQV  175



>ref|XP_010450719.1| PREDICTED: protease Do-like 9 [Camelina sativa]
Length=588

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  120  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  173



>ref|XP_006470390.1| PREDICTED: protease Do-like 9-like [Citrus sinensis]
Length=587

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGF++ GRR+LTNAH V  HT V
Sbjct  123  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQV  176



>gb|KDO66274.1| hypothetical protein CISIN_1g036586mg [Citrus sinensis]
Length=568

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGF++ GRR+LTNAH V  HT V
Sbjct  122  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIVGGRRVLTNAHSVEHHTQV  175



>gb|EPS65237.1| hypothetical protein M569_09541, partial [Genlisea aurea]
Length=413

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF+I GRR+LTNAH V  +T V
Sbjct  13   AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIKGRRVLTNAHSVEHYTQV  66



>ref|NP_566551.1| DegP protease 11 [Arabidopsis thaliana]
 gb|AEE75833.1| DegP protease 11 [Arabidopsis thaliana]
Length=555

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +1

Query  367  ESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRIL  546
            + L     I +++   EL LDSVVK+F+ S+  S   PW+   Q+ S G+GF I GR+IL
Sbjct  87   KKLERWKKIEESHPLDELVLDSVVKVFSNSTEYSKSKPWKTLDQKSSRGTGFAIAGRKIL  146

Query  547  TNAHVVA---DHTFV  582
            TNAHVV    DHTFV
Sbjct  147  TNAHVVMAMNDHTFV  161



>ref|XP_002511438.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF52040.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=569

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P+Y LPWQ K Q  S+ SGFVI G+R+LTNAH V  +T V
Sbjct  105  AMDAVVKVFCVHTEPNYSLPWQRKRQYSSSSSGFVIGGKRVLTNAHSVEHYTQV  158



>sp|Q9LK71.2|DGP11_ARATH RecName: Full=Putative protease Do-like 11, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
Length=560

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +1

Query  367  ESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRIL  546
            + L     I +++   EL LDSVVK+F+ S+  S   PW+   Q+ S G+GF I GR+IL
Sbjct  87   KKLERWKKIEESHPLDELVLDSVVKVFSNSTEYSKSKPWKTLDQKSSRGTGFAIAGRKIL  146

Query  547  TNAHVVA---DHTFV  582
            TNAHVV    DHTFV
Sbjct  147  TNAHVVMAMNDHTFV  161



>ref|XP_009349861.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=580

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  116  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIRGRRVLTNAHSVEHYTQV  169



>emb|CAN74170.1| hypothetical protein VITISV_013882 [Vitis vinifera]
Length=576

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  112  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  165



>ref|XP_010446115.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=529

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  409  AIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHT  576
            AI+ ALDSVVKIF   S      PW+N  +  +TG+GFVI GRR+LTNAH+V DHT
Sbjct  75   AIDTALDSVVKIFCFRSDTDVDKPWKNSWEGFATGTGFVIFGRRVLTNAHIVKDHT  130



>ref|XP_009139975.1| PREDICTED: protease Do-like 9 [Brassica rapa]
Length=581

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  117  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  170



>dbj|BAB01153.1| unnamed protein product [Arabidopsis thaliana]
Length=565

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = +1

Query  367  ESLSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRIL  546
            + L     I +++   EL LDSVVK+F+ S+  S   PW+   Q+ S G+GF I GR+IL
Sbjct  87   KKLERWKKIEESHPLDELVLDSVVKVFSNSTEYSKSKPWKTLDQKSSRGTGFAIAGRKIL  146

Query  547  TNAHVVA---DHTFV  582
            TNAHVV    DHTFV
Sbjct  147  TNAHVVMAMNDHTFV  161



>emb|CDY44585.1| BnaA04g10050D [Brassica napus]
Length=581

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  117  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  170



>emb|CDY53116.1| BnaCnng24440D [Brassica napus]
Length=581

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  117  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  170



>ref|XP_002154609.2| PREDICTED: protease Do-like 10, mitochondrial-like [Hydra vulgaris]
Length=577

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVA  567
            + SV+K+F   S+P+Y +PWQ K Q++S GSGFVI  RRILTNAHVVA
Sbjct  21   MRSVLKLFVQMSTPNYSMPWQMKRQQQSKGSGFVISNRRILTNAHVVA  68



>ref|XP_008438126.1| PREDICTED: protease Do-like 9 [Cucumis melo]
Length=586

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  122  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  175



>ref|XP_008230646.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=579

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+++VVK+F V + P+  LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  115  AMEAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHHTQV  168



>ref|XP_007217173.1| hypothetical protein PRUPE_ppa003383mg [Prunus persica]
 gb|EMJ18372.1| hypothetical protein PRUPE_ppa003383mg [Prunus persica]
Length=579

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+++VVK+F V + P+  LPWQ K Q  S+ SGFVI GRR+LTNAH V  HT V
Sbjct  115  AMEAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHHTQV  168



>ref|XP_004152460.1| PREDICTED: protease Do-like 9-like [Cucumis sativus]
 ref|XP_004157795.1| PREDICTED: protease Do-like 9-like [Cucumis sativus]
 gb|KGN64293.1| hypothetical protein Csa_1G045910 [Cucumis sativus]
Length=586

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  122  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  175



>gb|KFK33145.1| hypothetical protein AALP_AA6G336800 [Arabis alpina]
Length=581

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  117  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  170



>ref|XP_007036141.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036142.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036143.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036144.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036145.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036146.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20642.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20643.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20644.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20645.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20646.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20647.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
Length=589

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  125  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  178



>ref|XP_010678716.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010678717.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +DSVVK+F V + P++ LPWQ K Q  S+ +GFVI GRRILTNAH V  +T V
Sbjct  22   MDSVVKVFCVHTKPNFSLPWQRKRQHRSSSTGFVIAGRRILTNAHSVEYYTQV  74



>ref|XP_010678718.1| PREDICTED: protease Do-like 9 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +DSVVK+F V + P++ LPWQ K Q  S+ +GFVI GRRILTNAH V  +T V
Sbjct  22   MDSVVKVFCVHTKPNFSLPWQRKRQHRSSSTGFVIAGRRILTNAHSVEYYTQV  74



>ref|XP_008239730.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=587

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  123  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  176



>ref|XP_002866059.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42318.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=517

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +1

Query  412  IELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            I++A DSVVKIF+ S  P+   PWQ  +++E + SGFVI GRRILTN+HV  DH +V
Sbjct  54   IDVARDSVVKIFSFSREPNVVQPWQT-TEKEYSSSGFVISGRRILTNSHVAGDHPYV  109



>ref|XP_007140930.1| hypothetical protein PHAVU_008G153200g [Phaseolus vulgaris]
 gb|ESW12924.1| hypothetical protein PHAVU_008G153200g [Phaseolus vulgaris]
Length=568

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGF++ GRR+LTNAH V  HT V
Sbjct  104  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFLVGGRRVLTNAHSVEHHTQV  157



>ref|XP_010111534.1| Protease Do-like 9 [Morus notabilis]
 gb|EXC31167.1| Protease Do-like 9 [Morus notabilis]
Length=581

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  117  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  170



>ref|XP_011028602.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=556

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  92   AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIRGRRVLTNAHSVEHYTQV  145



>ref|XP_002321577.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
 gb|EEF05704.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
Length=556

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  92   AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIRGRRVLTNAHSVEHYTQV  145



>ref|XP_007209088.1| hypothetical protein PRUPE_ppa003679mg [Prunus persica]
 gb|EMJ10287.1| hypothetical protein PRUPE_ppa003679mg [Prunus persica]
Length=557

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  123  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  176



>emb|CDY15934.1| BnaA04g11770D [Brassica napus]
Length=583

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query  328  ADGVQLINSESPAESLSTTSSIS-DAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRE  504
            +D     N  + A + ST ++ S +    +  ++D+VVK+F V + P++ LPWQ K Q  
Sbjct  87   SDCYNATNVSAAATAESTPAAPSWETVVKVVPSMDAVVKVFCVHTDPNFSLPWQMKRQYS  146

Query  505  STGSGFVIPGRRILTNAHVVADHTFV  582
            S  SGF+I GRR+LTNAH V  HT V
Sbjct  147  SGSSGFIIGGRRVLTNAHSVEHHTQV  172



>gb|KHN18478.1| Protease Do-like 9 [Glycine soja]
Length=464

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +DSVVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  1    MDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  53



>gb|KDP31134.1| hypothetical protein JCGZ_11510 [Jatropha curcas]
Length=572

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  108  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  161



>emb|CDX99642.1| BnaC04g33990D [Brassica napus]
Length=560

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S  SGF+I GRR+LTNAH V  HT V
Sbjct  119  SMDAVVKVFCVHTDPNFSLPWQMKRQYSSGSSGFIIGGRRVLTNAHSVEHHTQV  172



>ref|XP_007155398.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
 gb|ESW27392.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
Length=588

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++DSVVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  124  SMDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  177



>ref|XP_004508846.1| PREDICTED: protease Do-like 9-like [Cicer arietinum]
Length=582

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++DSVVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  118  SMDSVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  171



>ref|XP_005717037.1| unnamed protein product [Chondrus crispus]
 emb|CDF37218.1| unnamed protein product [Chondrus crispus]
Length=290

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  415  ELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            E  LD V+K+F     P+Y LPW   SQR+ST S FVI GRRILTNAH V  +T V
Sbjct  86   EDVLDCVLKVFCTHCEPNYELPWAMTSQRQSTSSAFVIQGRRILTNAHSVEHYTSV  141



>emb|CEF97941.1| Serine endopeptidase DegP2 [Ostreococcus tauri]
Length=545

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            SD   A +  +D+V+K+F   + P+Y LPWQ K Q  ST +GFVI G R+LTNAH V  H
Sbjct  73   SDDDDAPQYPIDAVIKVFCTHTEPNYSLPWQRKRQSSSTSTGFVIDGNRVLTNAHSVEHH  132

Query  574  TFV  582
            T V
Sbjct  133  TQV  135



>ref|XP_003079294.1| putative DegP2 protease (ISS) [Ostreococcus tauri]
Length=737

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  394  SDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADH  573
            SD   A +  +D+V+K+F   + P+Y LPWQ K Q  ST +GFVI G R+LTNAH V  H
Sbjct  265  SDDDDAPQYPIDAVIKVFCTHTEPNYSLPWQRKRQSSSTSTGFVIDGNRVLTNAHSVEHH  324

Query  574  TFV  582
            T V
Sbjct  325  TQV  327



>ref|XP_005827715.1| hypothetical protein GUITHDRAFT_164606 [Guillardia theta CCMP2712]
 gb|EKX40735.1| hypothetical protein GUITHDRAFT_164606 [Guillardia theta CCMP2712]
Length=579

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +1

Query  373  LSTTSSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTN  552
            L+ T+  +    A++    SVVK+F  ++ P +  PWQ + QR+ TGSGF+I G RILTN
Sbjct  112  LAETAKHATPTAALQTGFASVVKVFAWTTEPHFSQPWQMRRQRQGTGSGFIISGHRILTN  171

Query  553  AHVVADHTFV  582
            AH VA+  +V
Sbjct  172  AHNVANQNWV  181



>ref|XP_008882829.1| trypsin domain-containing protein [Hammondia hammondi]
 gb|KEP66121.1| trypsin domain-containing protein [Hammondia hammondi]
Length=974

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +   L SVVKIF   + P YF PWQ +S ++++GSGFV+ G+RILTN HVV
Sbjct  152  TTAKDRHALLTSTLSSVVKIFVDITMPDYFSPWQMQSPKDASGSGFVVEGKRILTNGHVV  211

Query  565  ADHTFV  582
             + T V
Sbjct  212  GETTRV  217



>ref|XP_002511437.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF52039.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=524

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +D+VVK+F V + P+Y LPWQ K Q  ST SG VI G+RILTNAH V  +T V
Sbjct  64   MDAVVKVFCVHTEPNYSLPWQRKRQYSSTSSGLVIGGKRILTNAHSVQHYTQV  116



>ref|XP_002981859.1| hypothetical protein SELMODRAFT_154815 [Selaginella moellendorffii]
 gb|EFJ16952.1| hypothetical protein SELMODRAFT_154815 [Selaginella moellendorffii]
Length=466

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +D+VVK+F V + P++ LPWQ K Q  ++ SGFVI G+R+LTNAH V  HT V
Sbjct  1    MDNVVKVFCVHTEPNFSLPWQRKRQFSTSSSGFVIEGKRLLTNAHSVEHHTQV  53



>ref|XP_002982828.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
 gb|EFJ16073.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
Length=494

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +D+VVK+F V + P++ LPWQ K Q  ++ SGFVI G+R+LTNAH V  HT V
Sbjct  28   MDNVVKVFCVHTEPNFSLPWQRKRQFSTSSSGFVIEGKRLLTNAHSVEHHTQV  80



>emb|CBI15070.3| unnamed protein product [Vitis vinifera]
Length=464

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            +D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  1    MDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  53



>gb|KCW56073.1| hypothetical protein EUGRSUZ_I01831 [Eucalyptus grandis]
Length=552

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF+I GRR+LTNAH V  HT V
Sbjct  125  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQV  178



>ref|XP_010678720.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=566

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LTNAH V   T V
Sbjct  102  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHFTQV  155



>ref|XP_003882743.1| hypothetical protein NCLIV_025000 [Neospora caninum Liverpool]
 emb|CBZ52711.1| hypothetical protein NCLIV_025000 [Neospora caninum Liverpool]
Length=1045

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  424  LDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            L SVVKIF   + P Y+ PWQ ++ +E++GSGFV+ G+RILTN HVVA+ T V
Sbjct  273  LSSVVKIFVDFTLPDYYSPWQMQAPKEASGSGFVVEGKRILTNGHVVAETTRV  325



>ref|XP_005537155.1| DegP protease [Cyanidioschyzon merolae strain 10D]
 dbj|BAM81119.1| DegP protease [Cyanidioschyzon merolae strain 10D]
Length=596

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
             LDS++K+F+   +P+Y LPWQ + Q  ST SGF+I G RILTNAH V + T V
Sbjct  54   VLDSILKVFSTHCTPNYSLPWQMRKQEYSTSSGFIIDGNRILTNAHSVENFTVV  107



>ref|XP_006376843.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 ref|XP_002318029.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|ERP54640.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|EEE96249.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
Length=559

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P+  LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  95   AMDAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  148



>ref|XP_011044336.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P+  LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  95   AMDAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIRGRRVLTNAHSVEHYTQV  148



>ref|XP_011015595.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015596.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015597.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P+  LPWQ K Q  S+ SGFVI GRR+LTNAH V  +T V
Sbjct  95   AMDAVVKVFCVHTEPNLSLPWQRKRQYSSSSSGFVIGGRRVLTNAHSVEHYTQV  148



>gb|KCW49312.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
 gb|KCW49313.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
Length=474

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+++VVK+F V + P++ LPWQ K Q  S  SGFVI GRR+LTNAH V  +T V
Sbjct  12   AMEAVVKVFCVHTEPNFSLPWQMKRQYSSNSSGFVIKGRRVLTNAHSVEHYTQV  65



>gb|KDP45394.1| hypothetical protein JCGZ_09643 [Jatropha curcas]
Length=585

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF+I GRR+LTNAH V  HT V
Sbjct  121  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQV  174



>ref|XP_011087156.1| PREDICTED: protease Do-like 9 [Sesamum indicum]
Length=573

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+DSVVK+F V + P++ LPWQ K Q  S+ SGFVI GRR+LT+AH V  +T +
Sbjct  109  AMDSVVKVFCVHTDPNFSLPWQRKRQYSSSSSGFVIQGRRVLTSAHSVEHYTQI  162



>ref|XP_010037587.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=579

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+++VVK+F V + P++ LPWQ K Q  S  SGFVI GRR+LTNAH V  +T V
Sbjct  117  AMEAVVKVFCVHTEPNFSLPWQMKRQYSSNSSGFVIKGRRVLTNAHSVEHYTQV  170



>ref|XP_006439769.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
 gb|ESR53009.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
Length=578

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF I GRR+LTNAH V  +T V
Sbjct  121  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQV  174



>gb|KDO69729.1| hypothetical protein CISIN_1g007213mg [Citrus sinensis]
Length=578

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF I GRR+LTNAH V  +T V
Sbjct  121  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQV  174



>ref|XP_006476739.1| PREDICTED: protease Do-like 9-like isoform X1 [Citrus sinensis]
Length=585

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF I GRR+LTNAH V  +T V
Sbjct  121  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQV  174



>gb|KFG65537.1| trypsin domain-containing protein [Toxoplasma gondii RUB]
Length=972

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +  +L SVVKIF   + P YF PWQ ++ ++++GSGFV+ G+RILTN HVV
Sbjct  152  TTTKDRHALLTSSLSSVVKIFVDITMPDYFSPWQMQAPKDASGSGFVVEGKRILTNGHVV  211

Query  565  ADHTFV  582
             + T V
Sbjct  212  GETTRV  217



>gb|KFG52622.1| trypsin domain-containing protein [Toxoplasma gondii FOU]
Length=972

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +  +L SVVKIF   + P YF PWQ ++ ++++GSGFV+ G+RILTN HVV
Sbjct  152  TTTKDRHALLTSSLSSVVKIFVDITMPDYFSPWQMQAPKDASGSGFVVEGKRILTNGHVV  211

Query  565  ADHTFV  582
             + T V
Sbjct  212  GETTRV  217



>gb|KFG35062.1| trypsin domain-containing protein [Toxoplasma gondii p89]
Length=972

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +  +L SVVKIF   + P YF PWQ ++ ++++GSGFV+ G+RILTN HVV
Sbjct  152  TTTKDRHALLTSSLSSVVKIFVDITMPDYFSPWQMQAPKDASGSGFVVEGKRILTNGHVV  211

Query  565  ADHTFV  582
             + T V
Sbjct  212  GETTRV  217



>ref|XP_006439767.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
 gb|ESR53007.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
Length=526

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF I GRR+LTNAH V  +T V
Sbjct  121  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQV  174



>emb|CDP02144.1| unnamed protein product [Coffea canephora]
Length=392

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGF+I GRR+LTNAH V  HT V
Sbjct  121  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQV  174



>gb|KDO69730.1| hypothetical protein CISIN_1g007213mg [Citrus sinensis]
Length=612

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF I GRR+LTNAH V  +T V
Sbjct  121  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQV  174



>gb|KDO69731.1| hypothetical protein CISIN_1g007213mg [Citrus sinensis]
Length=526

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF I GRR+LTNAH V  +T V
Sbjct  121  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQV  174



>ref|XP_006439771.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
 gb|ESR53011.1| hypothetical protein CICLE_v10019344mg [Citrus clementina]
Length=612

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF I GRR+LTNAH V  +T V
Sbjct  121  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFAIGGRRVLTNAHSVEHYTQV  174



>ref|XP_007514393.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15830.1| predicted protein [Bathycoccus prasinos]
Length=555

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  427  DSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            D+VVK++ V + P+Y LPWQ K Q  ST +GFV+ G+RILTNAH V   T V
Sbjct  92   DAVVKVYAVHTEPNYSLPWQRKRQMPSTSTGFVVEGKRILTNAHSVEHSTQV  143



>gb|KFH10349.1| trypsin domain-containing protein [Toxoplasma gondii VAND]
Length=972

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +  +L SVVKIF   + P YF PWQ ++ ++++GSGFV+ G+RILTN HVV
Sbjct  152  TTAKDRHALLTSSLSSVVKIFVDITMPDYFSPWQMQAPKDASGSGFVVEGKRILTNGHVV  211

Query  565  ADHTFV  582
             + T V
Sbjct  212  GETTRV  217



>gb|ESS31919.1| trypsin domain-containing protein [Toxoplasma gondii VEG]
 gb|KFG49668.1| trypsin domain-containing protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=972

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +  +L SVVKIF   + P YF PWQ ++ ++++GSGFV+ G+RILTN HVV
Sbjct  152  TTAKDRHALLTSSLSSVVKIFVDITMPDYFSPWQMQAPKDASGSGFVVEGKRILTNGHVV  211

Query  565  ADHTFV  582
             + T V
Sbjct  212  GETTRV  217



>gb|EPR62641.1| trypsin domain-containing protein [Toxoplasma gondii GT1]
Length=972

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +  +L SVVKIF   + P YF PWQ ++ ++++GSGFV+ G+RILTN HVV
Sbjct  152  TTAKDRHALLTSSLSSVVKIFVDITMPDYFSPWQMQAPKDASGSGFVVEGKRILTNGHVV  211

Query  565  ADHTFV  582
             + T V
Sbjct  212  GETTRV  217



>ref|XP_002365392.1| trypsin, putative [Toxoplasma gondii ME49]
Length=956

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +  +L SVVKIF   + P YF PWQ ++ ++++GSGFV+ G+RILTN HVV
Sbjct  136  TTAKDRHALLTSSLSSVVKIFVDITMPDYFSPWQMQAPKDASGSGFVVEGKRILTNGHVV  195

Query  565  ADHTFV  582
             + T V
Sbjct  196  GETTRV  201



>gb|EPT29682.1| trypsin domain-containing protein [Toxoplasma gondii ME49]
Length=972

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +  +L SVVKIF   + P YF PWQ ++ ++++GSGFV+ G+RILTN HVV
Sbjct  152  TTAKDRHALLTSSLSSVVKIFVDITMPDYFSPWQMQAPKDASGSGFVVEGKRILTNGHVV  211

Query  565  ADHTFV  582
             + T V
Sbjct  212  GETTRV  217



>gb|KFH07698.1| trypsin domain-containing protein [Toxoplasma gondii MAS]
Length=972

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  385  SSISDAYYAIELALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVV  564
            ++  D +  +  +L SVVKIF   + P YF PWQ ++ ++++GSGFV+ G+RILTN HVV
Sbjct  152  TTAKDRHALLTSSLSSVVKIFVDITMPDYFSPWQMQAPKDASGSGFVVEGKRILTNGHVV  211

Query  565  ADHTFV  582
             + T V
Sbjct  212  GETTRV  217



>ref|XP_006363999.1| PREDICTED: protease Do-like 9-like [Solanum tuberosum]
Length=582

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++D+VVK+F V + P++ LPWQ K Q  S+ SGF+I GRR+LTNAH V  HT V
Sbjct  118  SMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQV  171



>ref|XP_010029214.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=589

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            A+D+VVK+F V + P++ LPWQ K Q  S+ SGF+I GRR+LTNAH V  HT V
Sbjct  125  AMDAVVKVFCVHTEPNFSLPWQRKRQYSSSSSGFIIGGRRVLTNAHSVEHHTQV  178



>ref|XP_003608950.1| hypothetical protein MTR_4g106730 [Medicago truncatula]
 gb|AES91147.1| serine endopeptidase degp2 protein, putative [Medicago truncatula]
Length=590

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  421  ALDSVVKIFTVSSSPSYFLPWQNKSQRESTGSGFVIPGRRILTNAHVVADHTFV  582
            ++DSVVK+F V + P++ LPWQ K Q  S+ +GFVI G+R+LTNAH V  +T V
Sbjct  126  SMDSVVKVFCVHTEPNFSLPWQRKRQYSSSSTGFVISGKRVLTNAHSVEHYTQV  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455