BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003O04

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP25573.1|  hypothetical protein JCGZ_20729                         204   2e-62   Jatropha curcas
ref|XP_010661683.1|  PREDICTED: uncharacterized protein ycf49 iso...    203   3e-62   Vitis vinifera
ref|XP_010055562.1|  PREDICTED: uncharacterized protein LOC104443746    204   6e-62   Eucalyptus grandis [rose gum]
emb|CBI34804.3|  unnamed protein product                                201   1e-61   Vitis vinifera
ref|XP_002298086.1|  hypothetical protein POPTR_0001s08230g             201   2e-61   Populus trichocarpa [western balsam poplar]
gb|AFK35560.1|  unknown                                                 200   3e-61   Lotus japonicus
ref|XP_006440447.1|  hypothetical protein CICLE_v10024430mg             201   4e-61   Citrus clementina [clementine]
ref|XP_006477318.1|  PREDICTED: uncharacterized protein ycf49-lik...    200   4e-61   Citrus sinensis [apfelsine]
gb|KHN34980.1|  Ycf49-like protein                                      200   5e-61   Glycine soja [wild soybean]
ref|NP_001236611.1|  uncharacterized protein LOC100306551               200   5e-61   
ref|XP_003516679.1|  PREDICTED: uncharacterized protein ycf49-lik...    199   7e-61   Glycine max [soybeans]
ref|XP_004245694.1|  PREDICTED: uncharacterized protein ycf49           199   1e-60   Solanum lycopersicum
ref|XP_003611209.1|  Ycf49-like protein                                 199   1e-60   Medicago truncatula
ref|XP_008238675.1|  PREDICTED: uncharacterized protein ycf49           199   2e-60   Prunus mume [ume]
ref|XP_007209016.1|  hypothetical protein PRUPE_ppa023449mg             197   2e-60   
ref|XP_008448929.1|  PREDICTED: uncharacterized protein ycf49           199   2e-60   Cucumis melo [Oriental melon]
ref|XP_004147956.1|  PREDICTED: ycf49-like protein-like                 199   3e-60   Cucumis sativus [cucumbers]
ref|XP_011070056.1|  PREDICTED: uncharacterized protein ycf49           198   4e-60   Sesamum indicum [beniseed]
ref|XP_009800180.1|  PREDICTED: uncharacterized protein LOC104246119    199   4e-60   Nicotiana sylvestris
ref|XP_010277420.1|  PREDICTED: uncharacterized protein LOC104611...    198   4e-60   Nelumbo nucifera [Indian lotus]
ref|XP_006363715.1|  PREDICTED: uncharacterized protein ycf49-like      198   5e-60   Solanum tuberosum [potatoes]
ref|XP_004298713.1|  PREDICTED: uncharacterized protein LOC101306...    197   6e-60   Fragaria vesca subsp. vesca
ref|XP_004511637.1|  PREDICTED: ycf49-like protein-like                 197   6e-60   Cicer arietinum [garbanzo]
ref|XP_009342525.1|  PREDICTED: uncharacterized protein ycf49-like      196   7e-60   
ref|XP_011029114.1|  PREDICTED: uncharacterized protein LOC105128953    197   1e-59   Populus euphratica
ref|XP_009588359.1|  PREDICTED: uncharacterized protein LOC104085...    197   1e-59   Nicotiana tomentosiformis
ref|XP_009347551.1|  PREDICTED: uncharacterized protein ycf49-lik...    196   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_008372230.1|  PREDICTED: uncharacterized protein ycf49 iso...    194   7e-59   
ref|XP_006358369.1|  PREDICTED: uncharacterized protein LOC102579570    195   1e-58   Solanum tuberosum [potatoes]
ref|XP_009623052.1|  PREDICTED: uncharacterized protein LOC104114...    194   2e-58   
emb|CDP09859.1|  unnamed protein product                                194   2e-58   Coffea canephora [robusta coffee]
ref|XP_004244585.1|  PREDICTED: uncharacterized protein LOC101244306    192   9e-58   Solanum lycopersicum
gb|KHG12522.1|  Ycf49-like protein                                      192   1e-57   Gossypium arboreum [tree cotton]
ref|XP_009761028.1|  PREDICTED: uncharacterized protein LOC104213...    192   2e-57   Nicotiana sylvestris
gb|KHN42730.1|  Ycf49-like protein                                      191   2e-57   Glycine soja [wild soybean]
gb|KJB51973.1|  hypothetical protein B456_008G241100                    191   2e-57   Gossypium raimondii
ref|XP_009412511.1|  PREDICTED: uncharacterized protein LOC103993984    191   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006661450.1|  PREDICTED: uncharacterized protein ycf49-like      188   4e-57   
ref|XP_007040024.1|  Uncharacterized protein isoform 1                  191   4e-57   
ref|XP_007158422.1|  hypothetical protein PHAVU_002G151800g             190   4e-57   Phaseolus vulgaris [French bean]
ref|XP_010107146.1|  hypothetical protein L484_019628                   192   7e-57   Morus notabilis
ref|XP_010676628.1|  PREDICTED: uncharacterized protein LOC104892...    189   1e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010540176.1|  PREDICTED: uncharacterized protein LOC104814025    189   1e-56   
ref|XP_009136225.1|  PREDICTED: uncharacterized protein LOC103860381    189   1e-56   Brassica rapa
emb|CDY41288.1|  BnaA01g12510D                                          189   1e-56   Brassica napus [oilseed rape]
ref|XP_008776047.1|  PREDICTED: uncharacterized protein LOC103696...    189   2e-56   Phoenix dactylifera
ref|XP_010908780.1|  PREDICTED: uncharacterized protein LOC105035...    189   2e-56   Elaeis guineensis
ref|XP_010448829.1|  PREDICTED: uncharacterized protein LOC104731212    189   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010242164.1|  PREDICTED: uncharacterized protein ycf49-like      187   3e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010439272.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    188   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006413613.1|  hypothetical protein EUTSA_v10026321mg             188   3e-56   Eutrema salsugineum [saltwater cress]
ref|XP_002867747.1|  hypothetical protein ARALYDRAFT_914324             188   4e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_006851799.1|  hypothetical protein AMTR_s00041p00009900          187   8e-56   Amborella trichopoda
emb|CDY69954.1|  BnaCnng66080D                                          187   1e-55   Brassica napus [oilseed rape]
ref|NP_194014.2|  uncharacterized protein                               186   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433985.1|  PREDICTED: uncharacterized protein LOC104718024    186   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006282724.1|  hypothetical protein CARUB_v10005758mg             186   2e-55   
ref|XP_010439276.1|  PREDICTED: uncharacterized protein LOC104722752    186   3e-55   Camelina sativa [gold-of-pleasure]
ref|NP_001190803.1|  uncharacterized protein                            186   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006573743.1|  PREDICTED: uncharacterized protein ycf49-lik...    182   2e-54   Glycine max [soybeans]
ref|XP_008670329.1|  PREDICTED: uncharacterized protein ycf49           182   4e-54   Zea mays [maize]
ref|XP_010448827.1|  PREDICTED: uncharacterized protein LOC104731...    183   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004957389.1|  PREDICTED: uncharacterized protein ycf49-lik...    182   4e-54   
gb|EEC77149.1|  hypothetical protein OsI_15596                          189   1e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_002462684.1|  hypothetical protein SORBIDRAFT_02g030190          181   1e-53   Sorghum bicolor [broomcorn]
ref|NP_001052589.1|  Os04g0379400                                       175   2e-51   
gb|KDO63712.1|  hypothetical protein CISIN_1g030334mg                   175   3e-51   Citrus sinensis [apfelsine]
gb|EYU40546.1|  hypothetical protein MIMGU_mgv1a021621mg                175   4e-51   Erythranthe guttata [common monkey flower]
ref|XP_006477319.1|  PREDICTED: uncharacterized protein ycf49-lik...    175   4e-51   Citrus sinensis [apfelsine]
gb|ABK25760.1|  unknown                                                 174   3e-50   Picea sitchensis
dbj|BAJ92465.1|  predicted protein                                      172   4e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAE03987.1|  OSJNBb0089B03.1                                        177   5e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002961806.1|  hypothetical protein SELMODRAFT_76519              164   9e-48   
ref|XP_001770014.1|  predicted protein                                  165   3e-45   
ref|XP_002964881.1|  hypothetical protein SELMODRAFT_406462             164   3e-44   
ref|XP_009347554.1|  PREDICTED: uncharacterized protein LOC103939...    154   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_008372234.1|  PREDICTED: uncharacterized protein LOC103435...    152   2e-43   
ref|XP_011463785.1|  PREDICTED: uncharacterized protein LOC101306...    150   9e-43   Fragaria vesca subsp. vesca
ref|XP_010676629.1|  PREDICTED: uncharacterized protein ycf49 iso...    147   1e-41   
ref|XP_010661687.1|  PREDICTED: uncharacterized protein LOC100254...    150   2e-41   Vitis vinifera
ref|XP_003576744.2|  PREDICTED: probable sodium/metabolite cotran...    155   1e-40   
gb|KJB51970.1|  hypothetical protein B456_008G241100                    146   3e-40   Gossypium raimondii
gb|EMS66927.1|  putative sodium-dependent transporter yocS              154   6e-40   Triticum urartu
gb|EMT03651.1|  hypothetical protein F775_13980                         142   1e-39   
ref|XP_001694043.1|  predicted protein                                  145   1e-39   Chlamydomonas reinhardtii
gb|EPS69478.1|  hypothetical protein M569_05288                         141   6e-39   Genlisea aurea
ref|XP_002955488.1|  hypothetical protein VOLCADRAFT_65897              143   9e-39   Volvox carteri f. nagariensis
ref|XP_008776049.1|  PREDICTED: uncharacterized protein LOC103696...    139   2e-37   
ref|XP_005850999.1|  hypothetical protein CHLNCDRAFT_19867              136   4e-37   Chlorella variabilis
ref|XP_010908784.1|  PREDICTED: uncharacterized protein LOC105035...    136   1e-36   Elaeis guineensis
ref|XP_005650703.1|  hypothetical protein COCSUDRAFT_12723              134   2e-36   Coccomyxa subellipsoidea C-169
ref|XP_010277421.1|  PREDICTED: uncharacterized protein LOC104611...    136   3e-36   Nelumbo nucifera [Indian lotus]
gb|KJB51971.1|  hypothetical protein B456_008G241100                    136   5e-36   Gossypium raimondii
ref|XP_009347553.1|  PREDICTED: uncharacterized protein LOC103939...    134   9e-36   Pyrus x bretschneideri [bai li]
ref|XP_008372232.1|  PREDICTED: uncharacterized protein LOC103435...    134   1e-35   
ref|XP_005714398.1|  unnamed protein product                            139   3e-35   Chondrus crispus [carageen]
ref|XP_004957388.1|  PREDICTED: uncharacterized protein ycf49-lik...    132   3e-34   
ref|WP_010873588.1|  hypothetical protein                               128   5e-34   Synechocystis
ref|WP_026222330.1|  hypothetical protein                               128   5e-34   filamentous cyanobacterium ESFC-1
ref|WP_002766813.1|  hypothetical protein                               126   3e-33   Microcystis aeruginosa
ref|WP_002790576.1|  hypothetical protein                               126   4e-33   Microcystis
ref|WP_015143187.1|  hypothetical protein                               126   4e-33   Pleurocapsa minor
ref|WP_006527841.1|  Protein of unknown function (DUF2499)              125   5e-33   Gloeocapsa sp. PCC 73106
gb|KJB51972.1|  hypothetical protein B456_008G241100                    127   6e-33   Gossypium raimondii
ref|WP_008277234.1|  hypothetical protein                               125   6e-33   Cyanothece sp. CCY0110
ref|WP_015147285.1|  hypothetical protein                               125   8e-33   Oscillatoria acuminata
ref|WP_002803528.1|  hypothetical protein                               125   9e-33   Microcystis aeruginosa
ref|WP_002734463.1|  MULTISPECIES: hypothetical protein                 125   9e-33   Microcystis
ref|WP_015159623.1|  Protein of unknown function (DUF2499)              124   2e-32   Chamaesiphon minutus
ref|XP_002509640.1|  conserved hypothetical protein                     124   2e-32   
ref|WP_012597204.1|  MULTISPECIES: hypothetical protein                 124   3e-32   Cyanothece
ref|WP_036484272.1|  hypothetical protein                               123   4e-32   Myxosarcina sp. GI1
ref|WP_002741768.1|  hypothetical protein                               123   6e-32   Microcystis aeruginosa
ref|WP_016925663.1|  hypothetical protein                               122   1e-31   Prochlorothrix hollandica
ref|WP_017719931.1|  hypothetical protein                               122   1e-31   Oscillatoria sp. PCC 10802
ref|WP_009625962.1|  Protein of unknown function DUF2499                122   1e-31   Pseudanabaena biceps
gb|AIE75459.1|  putative conserved membrane protein Ycf49, BioY f...    122   1e-31   Synechocystis sp. PCC 6714
ref|WP_015181131.1|  hypothetical protein                               122   2e-31   Microcoleus sp. PCC 7113
ref|XP_007514713.1|  predicted protein                                  129   2e-31   Bathycoccus prasinos
ref|WP_009545091.1|  MULTISPECIES: hypothetical protein                 121   2e-31   Cyanothece
ref|WP_015117311.1|  hypothetical protein                               121   3e-31   Rivularia sp. PCC 7116
ref|WP_019507574.1|  hypothetical protein                               121   3e-31   Pleurocapsa sp. PCC 7319
ref|WP_015134836.1|  hypothetical protein                               121   3e-31   Leptolyngbya sp. PCC 7376
ref|WP_028947176.1|  hypothetical protein                               121   3e-31   Synechocystis sp. PCC 6714
ref|WP_015204093.1|  hypothetical protein                               120   5e-31   Crinalium epipsammum
emb|CCQ61555.1|  hypothetical protein CWATWH0401_4266                   120   6e-31   Crocosphaera watsonii WH 0401
ref|WP_012598193.1|  hypothetical protein                               120   6e-31   Cyanothece sp. PCC 7424
ref|WP_007305080.1|  hypothetical protein                               120   6e-31   Crocosphaera watsonii
gb|ACJ84934.1|  unknown                                                 120   7e-31   Medicago truncatula
ref|WP_016950118.1|  hypothetical protein                               120   7e-31   Anabaena sp. PCC 7108
ref|WP_015138354.1|  hypothetical protein                               120   9e-31   Nostoc sp. PCC 7524
ref|WP_015223995.1|  hypothetical protein                               120   9e-31   
ref|WP_015230306.1|  hypothetical protein                               120   1e-30   Dactylococcopsis salina
ref|WP_017285987.1|  hypothetical protein                               119   1e-30   Leptolyngbya boryana
ref|XP_005818625.1|  hypothetical protein GUITHDRAFT_56967              119   2e-30   Guillardia theta CCMP2712
ref|WP_017311954.1|  MULTISPECIES: hypothetical protein                 119   2e-30   Hapalosiphonaceae
ref|WP_026097440.1|  hypothetical protein                               119   2e-30   Cyanobacteria [blue-green bacteria]
ref|WP_038016156.1|  hypothetical protein                               119   2e-30   Synechococcus sp. PCC 7335
ref|WP_041040154.1|  hypothetical protein                               119   2e-30   Tolypothrix campylonemoides
gb|EKD07238.1|  hypothetical protein SPLC1_S480060                      119   2e-30   Arthrospira platensis C1
ref|WP_035759411.1|  hypothetical protein                               119   3e-30   Arthrospira platensis
gb|ABI75121.1|  unknown                                                 119   3e-30   Cylindrospermopsis raciborskii T3
ref|WP_013322828.1|  hypothetical protein                               118   3e-30   Cyanothece sp. PCC 7822
ref|XP_002292481.1|  predicted protein                                  118   4e-30   Thalassiosira pseudonana CCMP1335
ref|WP_015219196.1|  hypothetical protein                               118   4e-30   Cyanobacterium aponinum
ref|WP_015194946.1|  Protein of unknown function DUF2499                118   4e-30   Stanieria cyanosphaera
ref|WP_006098050.1|  hypothetical protein                               119   4e-30   Coleofasciculus chthonoplastes
ref|WP_006668179.1|  MULTISPECIES: hypothetical protein                 118   4e-30   Arthrospira
emb|CBN78627.1|  conserved unknown protein                              121   4e-30   Ectocarpus siliculosus
gb|AFZ32651.1|  Protein of unknown function DUF2499                     118   5e-30   Gloeocapsa sp. PCC 7428
ref|WP_016876590.1|  hypothetical protein                               118   5e-30   Chlorogloeopsis fritschii
ref|WP_026723608.1|  hypothetical protein                               118   5e-30   Fischerella sp. PCC 9431
ref|XP_002178947.1|  predicted protein                                  117   5e-30   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_035155938.1|  hypothetical protein                               118   5e-30   Calothrix sp. 336/3
ref|WP_041919403.1|  hypothetical protein                               117   5e-30   
ref|WP_039743302.1|  hypothetical protein                               118   6e-30   
ref|WP_006194744.1|  hypothetical protein                               118   7e-30   Nodularia spumigena
ref|WP_011320098.1|  hypothetical protein                               117   8e-30   Trichormus variabilis
ref|WP_015213775.1|  Protein of unknown function DUF2499                117   9e-30   Anabaena cylindrica
ref|WP_010998641.1|  hypothetical protein                               117   9e-30   Nostocaceae
emb|CEF98693.1|  Uncharacterised protein family Ycf49                   124   1e-29   Ostreococcus tauri
ref|WP_030007198.1|  hypothetical protein                               117   1e-29   Synechococcus
ref|XP_003080291.1|  Nuclear pore complex component (sc Seh1) (ISS)     124   1e-29   
ref|WP_012406884.1|  hypothetical protein                               117   1e-29   Nostoc
ref|WP_015083349.1|  MULTISPECIES: hypothetical protein                 117   1e-29   Nostocales
ref|WP_026787189.1|  MULTISPECIES: hypothetical protein                 117   1e-29   Planktothrix
ref|WP_006515723.1|  Protein of unknown function (DUF2499)              116   2e-29   Leptolyngbya sp. PCC 7375
ref|WP_023073811.1|  hypothetical protein                               116   2e-29   Leptolyngbya sp. Heron Island J
ref|WP_012307040.1|  hypothetical protein                               116   2e-29   Synechococcus
ref|WP_006617978.1|  hypothetical protein                               116   2e-29   Arthrospira platensis
ref|WP_016859353.1|  hypothetical protein                               117   2e-29   Fischerella muscicola
ref|WP_024547105.1|  hypothetical protein                               116   2e-29   Synechococcus sp. NKBG15041c
ref|WP_029637726.1|  hypothetical protein [                             116   3e-29   [Scytonema hofmanni] UTEX B 1581
ref|WP_042151144.1|  hypothetical protein                               116   3e-29   Planktothrix agardhii
ref|WP_015170426.1|  hypothetical protein                               116   3e-29   Geitlerinema sp. PCC 7407
ref|XP_003060626.1|  predicted protein                                  115   3e-29   Micromonas pusilla CCMP1545
gb|KIE11074.1|  hypothetical protein DA73_0221920                       116   3e-29   Tolypothrix bouteillei VB521301
ref|WP_008184715.1|  hypothetical protein                               115   3e-29   Moorea
ref|WP_040553261.1|  hypothetical protein                               116   3e-29   Aphanizomenonaceae
ref|WP_033334577.1|  hypothetical protein                               116   3e-29   Scytonema hofmannii
ref|WP_011429044.1|  hypothetical protein                               116   4e-29   Synechococcus
ref|WP_040933950.1|  hypothetical protein                               115   4e-29   
ref|WP_015127947.1|  hypothetical protein                               115   4e-29   Calothrix sp. PCC 7507
ref|WP_027844409.1|  hypothetical protein                               115   4e-29   Mastigocoleus testarum
gb|KIJ83175.1|  hypothetical protein SD80_16405                         115   4e-29   Scytonema tolypothrichoides VB-61278
ref|WP_011434313.1|  hypothetical protein                               115   5e-29   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_017321733.1|  hypothetical protein                               115   6e-29   cyanobacterium PCC 7702
ref|WP_017654829.1|  hypothetical protein                               115   6e-29   Fortiea contorta
ref|WP_013191627.1|  hypothetical protein                               115   7e-29   Trichormus azollae
ref|WP_027254858.1|  hypothetical protein                               115   7e-29   Planktothrix agardhii
ref|WP_015114395.1|  hypothetical protein                               115   8e-29   Nostoc sp. PCC 7107
gb|EFA70731.1|  conserved hypothetical protein                          115   8e-29   Cylindrospermopsis raciborskii CS-505
ref|WP_036004879.1|  hypothetical protein                               114   1e-28   [Leptolyngbya] sp. JSC-1
ref|WP_027403771.1|  hypothetical protein                               115   1e-28   Aphanizomenonaceae
ref|WP_017294734.1|  hypothetical protein                               114   1e-28   Geminocystis herdmanii
ref|WP_040483484.1|  hypothetical protein                               114   1e-28   Lyngbya aestuarii
ref|WP_015208941.1|  Protein of unknown function (DUF2499)              114   1e-28   Cylindrospermum stagnale
ref|WP_009454032.1|  MULTISPECIES: hypothetical protein                 114   1e-28   Fischerella thermalis
ref|WP_016867562.1|  hypothetical protein                               114   2e-28   Fischerella muscicola
ref|WP_009787179.1|  hypothetical protein                               114   2e-28   Lyngbya sp. PCC 8106
ref|WP_011141874.1|  hypothetical protein                               114   2e-28   Gloeobacter violaceus
ref|WP_009634070.1|  Protein of unknown function (DUF2499)              114   2e-28   Synechocystis sp. PCC 7509
ref|XP_003056237.1|  hypothetical protein MICPUCDRAFT_71043             122   2e-28   Micromonas pusilla CCMP1545
ref|XP_002504984.1|  predicted protein                                  120   2e-28   Micromonas commoda
ref|WP_028085489.1|  hypothetical protein                               114   2e-28   Dolichospermum circinale
ref|WP_039727288.1|  MULTISPECIES: hypothetical protein                 113   3e-28   Lyngbya confervoides
ref|WP_028091019.1|  hypothetical protein                               114   3e-28   Dolichospermum circinale
ref|WP_017315121.1|  hypothetical protein                               113   4e-28   Mastigocladopsis repens
ref|WP_041462416.1|  hypothetical protein                               112   6e-28   Chroococcidiopsis
ref|WP_019487416.1|  MULTISPECIES: hypothetical protein                 112   7e-28   Kamptonema formosum
ref|WP_017327899.1|  hypothetical protein                               112   7e-28   Synechococcus sp. PCC 7336
ref|WP_026732434.1|  hypothetical protein                               112   7e-28   Fischerella sp. PCC 9605
ref|XP_002507924.1|  predicted protein                                  112   8e-28   Micromonas commoda
ref|WP_015200012.1|  hypothetical protein                               112   1e-27   Calothrix parietina
ref|WP_040008386.1|  hypothetical protein                               112   1e-27   Cylindrospermopsis raciborskii
ref|XP_001418680.1|  predicted protein                                  111   1e-27   Ostreococcus lucimarinus CCE9901
gb|AFY87383.1|  Protein of unknown function DUF2499                     113   1e-27   Chroococcidiopsis thermalis PCC 7203
ref|WP_037220436.1|  hypothetical protein                               112   1e-27   
ref|WP_039715707.1|  hypothetical protein                               112   1e-27   
ref|WP_006632397.1|  hypothetical protein                               111   2e-27   Microcoleus vaginatus
ref|WP_040654637.1|  hypothetical protein                               111   2e-27   
ref|WP_019493343.1|  hypothetical protein                               111   2e-27   Calothrix sp. PCC 7103
ref|WP_009556121.1|  Protein of unknown function (DUF2499)              111   2e-27   Oscillatoriales cyanobacterium JSC-12
ref|WP_006511613.1|  Protein of unknown function (DUF2499)              111   2e-27   Xenococcus sp. PCC 7305
ref|WP_012954329.1|  hypothetical protein                               111   3e-27   Candidatus Atelocyanobacterium thalassa
gb|ERN43101.1|  protein of unknown function (DUF2499)                   111   3e-27   Rubidibacter lacunae KORDI 51-2
ref|XP_009032125.1|  hypothetical protein AURANDRAFT_7066               110   3e-27   Aureococcus anophagefferens
ref|WP_015224239.1|  hypothetical protein                               110   5e-27   Halothece sp. PCC 7418
ref|WP_015176609.1|  Protein of unknown function DUF2499                109   9e-27   Oscillatoria nigro-viridis
ref|WP_012162283.1|  hypothetical protein                               109   1e-26   Acaryochloris marina
ref|WP_010477841.1|  hypothetical protein                               109   1e-26   Acaryochloris sp. CCMEE 5410
ref|WP_015169586.1|  hypothetical protein                               109   1e-26   Synechococcus sp. PCC 7502
ref|WP_027268723.1|  hypothetical protein                               108   2e-26   Leptolyngbya sp. PCC 6406
ref|WP_040054846.1|  hypothetical protein                               108   3e-26   
gb|EJK71733.1|  hypothetical protein THAOC_06800                        115   3e-26   Thalassiosira oceanica
ref|WP_008234855.1|  hypothetical protein                               108   3e-26   Richelia intracellularis
ref|WP_015164015.1|  hypothetical protein                               108   3e-26   Pseudanabaena sp. PCC 7367
ref|WP_019502955.1|  hypothetical protein                               107   5e-26   Pseudanabaena sp. PCC 6802
ref|WP_008224796.1|  hypothetical protein                               107   5e-26   Richelia intracellularis
ref|XP_011463784.1|  PREDICTED: uncharacterized protein LOC101306...    107   6e-26   Fragaria vesca subsp. vesca
ref|XP_005833130.1|  hypothetical protein GUITHDRAFT_70958              106   9e-26   Guillardia theta CCMP2712
ref|WP_012629834.1|  hypothetical protein                               107   9e-26   Cyanothece sp. PCC 7425
ref|XP_002508130.1|  predicted protein                                  112   6e-25   Micromonas commoda
ref|WP_015124353.1|  hypothetical protein                               104   7e-25   Synechococcus sp. PCC 6312
dbj|BAD46676.1|  hypothetical protein                                   106   7e-25   Oryza sativa Japonica Group [Japonica rice]
ref|WP_017300317.1|  hypothetical protein                               104   9e-25   Nodosilinea nodulosa
ref|XP_009041602.1|  hypothetical protein AURANDRAFT_67808              109   3e-24   Aureococcus anophagefferens
ref|XP_003080005.1|  unnamed protein product                            109   3e-24   Ostreococcus tauri
ref|XP_010908778.1|  PREDICTED: uncharacterized protein LOC105035...    105   3e-24   Elaeis guineensis
ref|WP_025782100.1|  hypothetical protein                               102   8e-24   Candidatus Synechococcus spongiarum
ref|XP_005784718.1|  hypothetical protein EMIHUDRAFT_72099              100   1e-23   Emiliania huxleyi CCMP1516
ref|XP_001416825.1|  predicted protein                                  100   2e-23   Ostreococcus lucimarinus CCE9901
ref|XP_003077919.1|  Nuclear pore complex component (sc Seh1) (ISS)     107   2e-23   Ostreococcus tauri
ref|WP_035986525.1|  hypothetical protein                               100   3e-23   Leptolyngbya sp. KIOST-1
ref|WP_011611391.1|  hypothetical protein                               100   3e-23   Trichodesmium erythraeum
ref|WP_011244824.1|  MULTISPECIES: hypothetical protein                 100   4e-23   Synechococcus
gb|KCW72050.1|  hypothetical protein EUGRSUZ_E00492                   99.4    2e-22   Eucalyptus grandis [rose gum]
ref|XP_007509236.1|  predicted protein                                  104   2e-22   Bathycoccus prasinos
ref|XP_005756951.1|  hypothetical protein EMIHUDRAFT_59791            97.1    4e-22   Emiliania huxleyi CCMP1516
ref|XP_007040025.1|  Uncharacterized protein isoform 2                99.0    6e-22   
ref|WP_011057277.1|  hypothetical protein                             96.3    9e-22   Thermosynechococcus elongatus
ref|XP_001418538.1|  predicted protein                                95.9    1e-21   Ostreococcus lucimarinus CCE9901
ref|WP_041429011.1|  hypothetical protein                             95.9    1e-21   Thermosynechococcus sp. NK55a
ref|XP_009588360.1|  PREDICTED: uncharacterized protein LOC104085...  97.4    2e-21   Nicotiana tomentosiformis
ref|WP_015108265.1|  hypothetical protein                             95.5    3e-21   Cyanobium gracile
ref|WP_011935803.1|  hypothetical protein                             95.1    3e-21   Synechococcus sp. RCC307
ref|WP_023175317.1|  hypothetical protein                             94.7    4e-21   Gloeobacter kilaueensis
ref|WP_029626326.1|  hypothetical protein                             94.0    7e-21   Synechococcus sp. CB0205
ref|XP_009761029.1|  PREDICTED: uncharacterized protein LOC104213...  94.7    2e-20   Nicotiana sylvestris
ref|XP_009623056.1|  PREDICTED: uncharacterized protein LOC104114...  94.0    4e-20   Nicotiana tomentosiformis
ref|WP_011619330.1|  hypothetical protein                             91.7    5e-20   Synechococcus sp. CC9311
ref|WP_010308816.1|  hypothetical protein                             89.4    4e-19   Synechococcus sp. CB0101
ref|XP_005776884.1|  hypothetical protein EMIHUDRAFT_115906           94.0    4e-19   Emiliania huxleyi CCMP1516
ref|XP_005778064.1|  hypothetical protein EMIHUDRAFT_115369           94.0    4e-19   Emiliania huxleyi CCMP1516
ref|XP_008356522.1|  PREDICTED: uncharacterized protein LOC103420238  92.8    5e-19   
ref|WP_006171520.1|  hypothetical protein                             88.6    8e-19   Synechococcus sp. WH 5701
ref|XP_010908783.1|  PREDICTED: uncharacterized protein LOC105035...  89.7    9e-19   Elaeis guineensis
ref|WP_006909606.1|  hypothetical protein                             88.6    9e-19   Cyanobium sp. PCC 7001
ref|XP_010908782.1|  PREDICTED: uncharacterized protein LOC105035...  89.4    1e-18   
ref|XP_008346597.1|  PREDICTED: uncharacterized protein LOC103409559  89.7    2e-18   
ref|WP_006852621.1|  hypothetical protein                             87.4    2e-18   
gb|AHF63618.1|  hypothetical protein Syncc8109_1250                   87.4    2e-18   
ref|XP_001767215.1|  predicted protein                                90.9    3e-18   
ref|WP_012007690.1|  hypothetical protein                             86.7    3e-18   
ref|WP_011820295.1|  hypothetical protein                             86.7    4e-18   
ref|WP_025933511.1|  MULTISPECIES: hypothetical protein               86.3    5e-18   
ref|WP_038554735.1|  hypothetical protein                             85.9    7e-18   
gb|ERT09313.1|  hypothetical protein M595_0657                        85.1    9e-18   
ref|WP_032526175.1|  hypothetical protein                             85.1    1e-17   
ref|XP_011398123.1|  Ycf49-like protein                               84.3    2e-17   
ref|WP_025956696.1|  hypothetical protein                             85.1    2e-17   
ref|WP_025930314.1|  hypothetical protein                             85.1    2e-17   
ref|WP_025980940.1|  hypothetical protein                             84.7    2e-17   
ref|WP_038544772.1|  hypothetical protein                             84.3    3e-17   
ref|WP_025941633.1|  hypothetical protein                             84.3    3e-17   
ref|WP_025939440.1|  hypothetical protein                             84.3    3e-17   
ref|WP_025974624.1|  hypothetical protein                             84.3    3e-17   
ref|WP_036921022.1|  hypothetical protein                             84.0    3e-17   
ref|WP_025960464.1|  MULTISPECIES: hypothetical protein               84.0    3e-17   
ref|WP_025890777.1|  MULTISPECIES: hypothetical protein               84.0    4e-17   
ref|WP_032524425.1|  hypothetical protein                             84.0    4e-17   
ref|WP_025954617.1|  hypothetical protein                             84.0    4e-17   
ref|WP_042850350.1|  hypothetical protein                             84.0    4e-17   
ref|WP_028952091.1|  hypothetical protein                             83.6    4e-17   
ref|WP_025894496.1|  MULTISPECIES: hypothetical protein               84.0    4e-17   
ref|WP_025958933.1|  hypothetical protein                             84.0    4e-17   
ref|WP_025931875.1|  MULTISPECIES: hypothetical protein               84.0    4e-17   
ref|WP_025926479.1|  hypothetical protein                             83.6    5e-17   
ref|WP_025923156.1|  hypothetical protein                             83.6    5e-17   
ref|WP_025964266.1|  hypothetical protein                             83.6    5e-17   
ref|WP_025940320.1|  hypothetical protein                             83.6    6e-17   
ref|WP_032517086.1|  hypothetical protein                             83.2    6e-17   
ref|WP_025944038.1|  hypothetical protein                             83.2    7e-17   
ref|WP_025921499.1|  hypothetical protein                             83.2    7e-17   
ref|WP_011818396.1|  hypothetical protein                             83.2    7e-17   
gb|AHB87884.1|  protein of unknown function DUF2499                   82.8    8e-17   
ref|WP_025888276.1|  hypothetical protein                             82.8    8e-17   
ref|WP_025928399.1|  hypothetical protein                             83.2    8e-17   
ref|WP_032514360.1|  hypothetical protein                             83.2    8e-17   
ref|WP_011862926.1|  hypothetical protein                             82.8    9e-17   
ref|WP_043691035.1|  hypothetical protein                             82.4    1e-16   
ref|WP_025952770.1|  hypothetical protein                             82.8    1e-16   
ref|WP_007102438.1|  hypothetical protein                             82.4    1e-16   
ref|WP_025955701.1|  MULTISPECIES: hypothetical protein               82.4    1e-16   
ref|WP_011364395.1|  hypothetical protein                             82.0    2e-16   
ref|WP_025938349.1|  hypothetical protein                             82.0    2e-16   
ref|WP_032515444.1|  hypothetical protein                             81.6    2e-16   
ref|WP_011132537.1|  hypothetical protein                             81.6    3e-16   
ref|WP_011128152.1|  hypothetical protein                             81.3    3e-16   
ref|WP_025945956.1|  MULTISPECIES: hypothetical protein               80.9    6e-16   
ref|WP_036897853.1|  hypothetical protein                             80.5    7e-16   
ref|WP_036903070.1|  hypothetical protein                             80.5    8e-16   
ref|WP_012195409.1|  hypothetical protein                             80.1    9e-16   
ref|WP_025881434.1|  MULTISPECIES: hypothetical protein               80.1    1e-15   
ref|WP_032521438.1|  hypothetical protein                             79.3    2e-15   
ref|WP_019475131.1|  hypothetical protein                             79.0    2e-15   
ref|WP_011376450.1|  hypothetical protein                             79.0    3e-15   
ref|WP_009789725.1|  MULTISPECIES: hypothetical protein               77.8    5e-15   
ref|WP_007097892.1|  hypothetical protein                             77.8    8e-15   
ref|WP_032518890.1|  hypothetical protein                             77.4    9e-15   
ref|WP_011130067.1|  hypothetical protein                             77.4    1e-14   
ref|WP_035830009.1|  hypothetical protein                             77.4    1e-14   
ref|WP_036915213.1|  MULTISPECIES: hypothetical protein               77.0    1e-14   
ref|WP_011826169.1|  hypothetical protein                             76.6    1e-14   
dbj|GAL91335.1|  hypothetical protein N44_00704                       75.1    3e-14   
ref|YP_002048831.1|  hypothetical protein PCC_0171                    75.1    5e-14   
ref|WP_006041383.1|  hypothetical protein                             69.7    7e-12   
ref|XP_006371507.1|  hypothetical protein POPTR_0019s12520g           70.9    1e-11   
gb|EJK60591.1|  hypothetical protein THAOC_19021                      71.6    2e-11   
gb|EDX84317.1|  hypothetical protein S7335_2014                       66.6    3e-11   
gb|KGG12488.1|  hypothetical protein EV05_1700                        66.6    5e-11   
ref|WP_011933133.1|  hypothetical protein                             66.2    1e-10   
ref|WP_038652520.1|  hypothetical protein                             65.1    2e-10   
ref|YP_009051131.1|  hypothetical protein                             64.7    3e-10   
ref|WP_011823660.1|  hypothetical protein                             64.7    3e-10   
ref|YP_007317053.1|  hypothetical protein Naga_1Chloroplast89         63.9    5e-10   
ref|WP_036917642.1|  MULTISPECIES: hypothetical protein               63.9    5e-10   
ref|WP_011293837.1|  hypothetical protein                             63.9    6e-10   
ref|XP_008372231.1|  PREDICTED: uncharacterized protein LOC103435...  49.7    9e-10   
gb|ABZ83896.1|  conserved hypothetical protein                        64.3    1e-09   
ref|XP_002326050.2|  hypothetical protein POPTR_0019s12510g           65.9    1e-09   
ref|YP_008519859.1|  hypothetical protein                             62.4    2e-09   
ref|YP_008519983.1|  hypothetical protein                             62.0    2e-09   
ref|XP_003611210.1|  60S ribosomal export protein NMD3                65.5    5e-09   
ref|YP_008520109.1|  hypothetical protein                             60.8    6e-09   
ref|XP_010448826.1|  PREDICTED: uncharacterized protein LOC104731...  48.5    9e-09   
ref|XP_003062000.1|  predicted protein                                62.8    1e-08   
gb|AIQ95007.1|  hypothetical protein EW14_0988                        58.9    1e-08   
gb|AHX25381.1|  hypothetical protein Naoc00068 (chloroplast)          59.7    2e-08   
ref|YP_008519610.1|  hypothetical protein                             59.3    2e-08   
ref|WP_014099933.1|  hypothetical protein                             61.6    2e-08   
ref|WP_041314862.1|  hypothetical protein                             58.9    3e-08   
gb|ABE11462.1|  conserved hypothetical protein                        58.2    3e-08   
ref|WP_011125083.1|  MULTISPECIES: hypothetical protein               58.9    4e-08   
gb|KGF87893.1|  hypothetical protein EU91_0928                        57.4    5e-08   
gb|KGG04372.1|  hypothetical protein EV00_1401                        57.0    7e-08   
gb|KGF89589.1|  hypothetical protein EU92_1377                        57.0    7e-08   
ref|XP_009347552.1|  PREDICTED: uncharacterized protein LOC103939...  42.7    1e-07   
gb|EEE39968.1|  conserved hypothetical protein                        56.2    1e-07   
gb|KGF87532.1|  hypothetical protein PROCH_0476                       56.2    2e-07   
ref|YP_008519736.1|  hypothetical protein                             56.6    2e-07   
ref|WP_011361088.1|  hypothetical protein                             58.9    2e-07   
gb|KGG25919.1|  hypothetical protein EV13_2693                        55.8    3e-07   
ref|NP_043201.1|  hypothetical protein CypaCp064                      56.2    3e-07   
ref|WP_012465010.1|  hypothetical protein                             58.2    5e-07   
gb|KEH27449.1|  transmembrane protein, putative                       55.1    5e-07   
gb|AIU44606.1|  hypothetical protein                                  55.5    6e-07   
gb|KGF97731.1|  hypothetical protein EU95_0198                        54.3    8e-07   
gb|EEC84896.1|  hypothetical protein OsI_32073                        56.2    2e-06   
gb|ABL64113.1|  conserved hypothetical protein                        55.1    6e-06   
ref|WP_041467439.1|  hypothetical protein                             55.1    6e-06   
ref|WP_012506883.1|  hypothetical protein                             54.3    1e-05   
ref|NP_045049.1|  hypothetical protein CycaCp032                      51.6    2e-05   
ref|WP_012499160.1|  hypothetical protein                             52.4    4e-05   
ref|XP_010448825.1|  PREDICTED: uncharacterized protein LOC104731...  48.9    5e-05   
ref|WP_012473502.1|  hypothetical protein                             52.0    7e-05   
ref|XP_002509641.1|  conserved hypothetical protein                   47.0    8e-04   
gb|ABP36048.1|  conserved hypothetical protein                        48.9    0.001   



>gb|KDP25573.1| hypothetical protein JCGZ_20729 [Jatropha curcas]
Length=188

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            Q  EPANALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFCA
Sbjct  81   QLTEPANALSLPTWAIHVSSVVEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFCA  140

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CTWHFFYNSESLEVLVALQAALTVIGNATMCIAA+RIYKS++E
Sbjct  141  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAYRIYKSTKE  183



>ref|XP_010661683.1| PREDICTED: uncharacterized protein ycf49 isoform X1 [Vitis vinifera]
Length=181

 Score =   203 bits (517),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +QF+EPANALSLPTW IHVSSV+EW+IAM LVW+YGE+ G+ESWKGLSWGMVPLLGGAFC
Sbjct  73   LQFSEPANALSLPTWAIHVSSVVEWIIAMILVWKYGEQPGFESWKGLSWGMVPLLGGAFC  132

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQAALTV+GNATMCIAAFRIY+SSQE
Sbjct  133  ACTWHFFYNSESLEVLVALQAALTVLGNATMCIAAFRIYQSSQE  176



>ref|XP_010055562.1| PREDICTED: uncharacterized protein LOC104443746 [Eucalyptus grandis]
Length=207

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q AEPANALSLPTW +HVSSV+EW+ AMALVWQYGE SGYESWKGLSWGMVPLLGGAFC
Sbjct  99   LQLAEPANALSLPTWVVHVSSVVEWITAMALVWQYGEVSGYESWKGLSWGMVPLLGGAFC  158

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQAALTVIGNATMC AAFRIY++S+E
Sbjct  159  ACTWHFFYNSESLEVLVALQAALTVIGNATMCFAAFRIYRASEE  202



>emb|CBI34804.3| unnamed protein product [Vitis vinifera]
Length=137

 Score =   201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +QF+EPANALSLPTW IHVSSV+EW+IAM LVW+YGE+ G+ESWKGLSWGMVPLLGGAFC
Sbjct  29   LQFSEPANALSLPTWAIHVSSVVEWIIAMILVWKYGEQPGFESWKGLSWGMVPLLGGAFC  88

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQAALTV+GNATMCIAAFRIY+SSQE
Sbjct  89   ACTWHFFYNSESLEVLVALQAALTVLGNATMCIAAFRIYQSSQE  132



>ref|XP_002298086.1| hypothetical protein POPTR_0001s08230g [Populus trichocarpa]
 gb|EEE82891.1| hypothetical protein POPTR_0001s08230g [Populus trichocarpa]
Length=188

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            Q +EPANALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGL+WGMVPLLGGAFCA
Sbjct  81   QLSEPANALSLPTWAIHVSSVVEWIAAMALVWQYGEKSGFESWKGLAWGMVPLLGGAFCA  140

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRI+ SS+E
Sbjct  141  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIHMSSEE  183



>gb|AFK35560.1| unknown [Lotus japonicus]
Length=168

 Score =   200 bits (509),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q  EP+NALSLPTW +HVSSV+EW+IAMALVWQYGEKSGYE+WKGLSWGMVPLLGGAFC
Sbjct  63   LQLHEPSNALSLPTWAVHVSSVVEWIIAMALVWQYGEKSGYEAWKGLSWGMVPLLGGAFC  122

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQAALT++GNATMCIAA+RIYKSS+E
Sbjct  123  ACTWHFFYNDESLEVLVALQAALTLVGNATMCIAAYRIYKSSRE  166



>ref|XP_006440447.1| hypothetical protein CICLE_v10024430mg [Citrus clementina]
 gb|ESR53687.1| hypothetical protein CICLE_v10024430mg [Citrus clementina]
 gb|KDO63713.1| hypothetical protein CISIN_1g030334mg [Citrus sinensis]
 gb|KDO63714.1| hypothetical protein CISIN_1g030334mg [Citrus sinensis]
Length=179

 Score =   201 bits (510),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW IHVSSV EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFC
Sbjct  71   LQLSEPANALSLPTWAIHVSSVAEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFC  130

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQ ALTVIGNATMC AA+RIYKSS+E
Sbjct  131  ACTWHFFYNSESLEVLVALQGALTVIGNATMCYAAYRIYKSSEE  174



>ref|XP_006477318.1| PREDICTED: uncharacterized protein ycf49-like isoform X1 [Citrus 
sinensis]
Length=179

 Score =   200 bits (509),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW IHVSSV EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFC
Sbjct  71   LQLSEPANALSLPTWAIHVSSVAEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFC  130

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQ ALTVIGNATMC AA+RIYKSS+E
Sbjct  131  ACTWHFFYNSESLEVLVALQGALTVIGNATMCYAAYRIYKSSEE  174



>gb|KHN34980.1| Ycf49-like protein [Glycine soja]
Length=170

 Score =   200 bits (508),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +QF EP NALSLPTW IHVSSV EW+IAMALVWQYGEKSGY +WKGLSWGMVPLLGGAFC
Sbjct  66   LQFHEPPNALSLPTWAIHVSSVAEWIIAMALVWQYGEKSGYPAWKGLSWGMVPLLGGAFC  125

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAA+RIYKSSQ
Sbjct  126  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAYRIYKSSQ  168



>ref|NP_001236611.1| uncharacterized protein LOC100306551 [Glycine max]
 gb|ACU14774.1| unknown [Glycine max]
Length=170

 Score =   200 bits (508),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +QF EP NALSLPTW IHVSSV EW+IAMALVWQYGEKSGY +WKGLSWGMVPLLGGAFC
Sbjct  66   LQFHEPPNALSLPTWAIHVSSVAEWIIAMALVWQYGEKSGYPAWKGLSWGMVPLLGGAFC  125

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAA+RIYKSSQ
Sbjct  126  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAYRIYKSSQ  168



>ref|XP_003516679.1| PREDICTED: uncharacterized protein ycf49-like isoform X1 [Glycine 
max]
Length=167

 Score =   199 bits (507),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +QF EP NALSLPTW IHVSSV EW+IAMALVWQYGEKSGY +WKGLSWGMVPLLGGAFC
Sbjct  63   LQFHEPPNALSLPTWAIHVSSVAEWIIAMALVWQYGEKSGYPAWKGLSWGMVPLLGGAFC  122

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNS+SLEVLVALQAALT+IGNATMCIAA+RIYKSSQ+
Sbjct  123  ACTWHFFYNSDSLEVLVALQAALTIIGNATMCIAAYRIYKSSQD  166



>ref|XP_004245694.1| PREDICTED: uncharacterized protein ycf49 [Solanum lycopersicum]
Length=184

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            QF EP+NALSLPTW IHVSSV+EWV AMALVWQYGEKSG +SWKGLSWGMVPLLGGAFCA
Sbjct  82   QFNEPSNALSLPTWAIHVSSVVEWVTAMALVWQYGEKSGNDSWKGLSWGMVPLLGGAFCA  141

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CTWHFFYNSESLEVLVALQAALTV+GNATMCIAAFRIY+S ++
Sbjct  142  CTWHFFYNSESLEVLVALQAALTVLGNATMCIAAFRIYRSQEQ  184



>ref|XP_003611209.1| Ycf49-like protein [Medicago truncatula]
 gb|AES94167.1| ycf49-like protein [Medicago truncatula]
Length=172

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            ++  EP+NALSLPTW +HVSSV+EW+IAMALVWQYGEKSGYE+WKGLSWGMVPLLGGAFC
Sbjct  64   LELQEPSNALSLPTWAVHVSSVVEWIIAMALVWQYGEKSGYEAWKGLSWGMVPLLGGAFC  123

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNS+SLEVLVALQAALTVIGN TMCIAA+RIYKSS+E
Sbjct  124  ACTWHFFYNSDSLEVLVALQAALTVIGNFTMCIAAYRIYKSSRE  167



>ref|XP_008238675.1| PREDICTED: uncharacterized protein ycf49 [Prunus mume]
Length=180

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            Q +EP+NALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGA CA
Sbjct  73   QLSEPSNALSLPTWAIHVSSVVEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGALCA  132

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CTWHFFYNSESLEVLVALQAALTVIGNATMC AAFRIY+SS+E
Sbjct  133  CTWHFFYNSESLEVLVALQAALTVIGNATMCFAAFRIYRSSEE  175



>ref|XP_007209016.1| hypothetical protein PRUPE_ppa023449mg, partial [Prunus persica]
 gb|EMJ10215.1| hypothetical protein PRUPE_ppa023449mg, partial [Prunus persica]
Length=146

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EP+NALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGA C
Sbjct  38   LQLSEPSNALSLPTWAIHVSSVVEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGALC  97

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQAALTVIGNATMC AAFRIY+SS+E
Sbjct  98   ACTWHFFYNSESLEVLVALQAALTVIGNATMCFAAFRIYRSSEE  141



>ref|XP_008448929.1| PREDICTED: uncharacterized protein ycf49 [Cucumis melo]
Length=186

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  FAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCAC  471
            F EP NALSLPTW IHVSSV+EW+ AMALVWQYGEKSG ESWKGLSWGMVPLLGGAFCAC
Sbjct  80   FNEPQNALSLPTWAIHVSSVVEWITAMALVWQYGEKSGNESWKGLSWGMVPLLGGAFCAC  139

Query  472  TWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            TWHFFYNSESLEVLVA+QA LT IGNATMCIAAFRIYKSSQE
Sbjct  140  TWHFFYNSESLEVLVAIQAMLTAIGNATMCIAAFRIYKSSQE  181



>ref|XP_004147956.1| PREDICTED: ycf49-like protein-like [Cucumis sativus]
 ref|XP_004159501.1| PREDICTED: ycf49-like protein-like [Cucumis sativus]
 gb|KGN55929.1| hypothetical protein Csa_3G036550 [Cucumis sativus]
Length=186

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  FAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCAC  471
            F EP NALSLPTW IHVSSV+EW+ AMALVWQYGEKSG ESWKGLSWGMVPLLGGAFCAC
Sbjct  80   FNEPQNALSLPTWAIHVSSVVEWITAMALVWQYGEKSGNESWKGLSWGMVPLLGGAFCAC  139

Query  472  TWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            TWHFFYNSESLEVLVA+QA LT IGNATMCIAAFRIYKSSQE
Sbjct  140  TWHFFYNSESLEVLVAIQAMLTAIGNATMCIAAFRIYKSSQE  181



>ref|XP_011070056.1| PREDICTED: uncharacterized protein ycf49 [Sesamum indicum]
Length=191

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  FAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCAC  471
            F+EP+NALSLPTW IH+SSV EWV AMALVWQYGEKSGYESWKGLSWGMVPLLGGA CAC
Sbjct  85   FSEPSNALSLPTWAIHISSVSEWVTAMALVWQYGEKSGYESWKGLSWGMVPLLGGALCAC  144

Query  472  TWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            TWHFFYNSESLEVLVALQAALTVIGNATMC AA+RIY SSQE
Sbjct  145  TWHFFYNSESLEVLVALQAALTVIGNATMCFAAYRIYTSSQE  186



>ref|XP_009800180.1| PREDICTED: uncharacterized protein LOC104246119 [Nicotiana sylvestris]
Length=198

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            QF EP NALSLPTW IHVSSV+EWV AMALVWQYGEKSG  SWKGLSWGMVPLLGGAFCA
Sbjct  92   QFNEPTNALSLPTWAIHVSSVVEWVTAMALVWQYGEKSGNASWKGLSWGMVPLLGGAFCA  151

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CTWHFFYNSESLEVLVALQAALTV+GNATMC+AAFRIY+S ++
Sbjct  152  CTWHFFYNSESLEVLVALQAALTVLGNATMCVAAFRIYRSQEQ  194



>ref|XP_010277420.1| PREDICTED: uncharacterized protein LOC104611867 isoform X1 [Nelumbo 
nucifera]
Length=194

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q  EPANALSLPTW +HVSSVIEWV AMALVWQYGEKSGYESWKGLSWGMVPLLGGA C
Sbjct  86   LQLNEPANALSLPTWAVHVSSVIEWVTAMALVWQYGEKSGYESWKGLSWGMVPLLGGALC  145

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVA+QAALTVIGN TMCIAAFRIY+S Q+
Sbjct  146  ACTWHFFYNSESLEVLVAIQAALTVIGNLTMCIAAFRIYRSFQK  189



>ref|XP_006363715.1| PREDICTED: uncharacterized protein ycf49-like [Solanum tuberosum]
Length=184

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +QF EP+NALSLPTW IHVSSV+EWV AMALVWQY EKSG +SWKGLSWGMVPLLGGAFC
Sbjct  81   LQFNEPSNALSLPTWAIHVSSVVEWVTAMALVWQYAEKSGNDSWKGLSWGMVPLLGGAFC  140

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQAALTV+GNATMCIAAFRIY+S ++
Sbjct  141  ACTWHFFYNSESLEVLVALQAALTVLGNATMCIAAFRIYRSQEQ  184



>ref|XP_004298713.1| PREDICTED: uncharacterized protein LOC101306233 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   197 bits (502),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW IHVSSV+EW+ AM LVWQYGEKSG+ESWKGL+WGMVPLLGGAFC
Sbjct  73   LQLSEPANALSLPTWAIHVSSVVEWITAMVLVWQYGEKSGFESWKGLAWGMVPLLGGAFC  132

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQAALTV+GNATMC AA+RIY+S++E
Sbjct  133  ACTWHFFYNSESLEVLVALQAALTVMGNATMCFAAYRIYRSTEE  176



>ref|XP_004511637.1| PREDICTED: ycf49-like protein-like [Cicer arietinum]
Length=170

 Score =   197 bits (501),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            ++  EP+NALSLPTW +HVSSV+EW+IAMALVWQYGEKSGY++WKGLSWGMVPLLGGAFC
Sbjct  62   LELHEPSNALSLPTWAVHVSSVVEWIIAMALVWQYGEKSGYQAWKGLSWGMVPLLGGAFC  121

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNS+SLEVLVALQAALTVIGN TMCIAA+RIYKSS+E
Sbjct  122  ACTWHFFYNSDSLEVLVALQAALTVIGNVTMCIAAYRIYKSSRE  165



>ref|XP_009342525.1| PREDICTED: uncharacterized protein ycf49-like [Pyrus x bretschneideri]
Length=155

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP+NALSLPTW IHVSSV+EWV AMALVWQYGEKSG+ESWKGLSWGMVPLLGGA CACTW
Sbjct  51   EPSNALSLPTWAIHVSSVVEWVTAMALVWQYGEKSGFESWKGLSWGMVPLLGGALCACTW  110

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNSESLEVLVALQAALTVIGNATMC AA+RIY+SS+E
Sbjct  111  HFFYNSESLEVLVALQAALTVIGNATMCFAAYRIYRSSEE  150



>ref|XP_011029114.1| PREDICTED: uncharacterized protein LOC105128953 [Populus euphratica]
Length=188

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            Q +EPANALSLPTW IHVSSV EW+ AMALVWQYGEKSG ESWKGL+WGMVPLLGGAFCA
Sbjct  81   QLSEPANALSLPTWAIHVSSVAEWIAAMALVWQYGEKSGLESWKGLAWGMVPLLGGAFCA  140

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRI+ SS+E
Sbjct  141  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIHMSSEE  183



>ref|XP_009588359.1| PREDICTED: uncharacterized protein LOC104085943 isoform X1 [Nicotiana 
tomentosiformis]
Length=198

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            QF EP NALSLPTW IHVSSV+EWV AMALVWQYGEKSG  SWKGLSWGMVPLLGGAFCA
Sbjct  92   QFNEPTNALSLPTWAIHVSSVVEWVTAMALVWQYGEKSGNASWKGLSWGMVPLLGGAFCA  151

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CTWHFFYNSESLEVLVALQAALT +GNATMC+AAFRIY+S ++
Sbjct  152  CTWHFFYNSESLEVLVALQAALTFVGNATMCVAAFRIYRSQEQ  194



>ref|XP_009347551.1| PREDICTED: uncharacterized protein ycf49-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009347555.1| PREDICTED: uncharacterized protein ycf49-like isoform X1 [Pyrus 
x bretschneideri]
Length=167

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP+NALSLPTW IHVSSV+EWV AMALVWQYGEKSG+ESWKGLSWGMVPLLGGA CACTW
Sbjct  63   EPSNALSLPTWAIHVSSVVEWVTAMALVWQYGEKSGFESWKGLSWGMVPLLGGALCACTW  122

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNSESLEVLVALQAALTVIGNATMC AA+RIY+SS+E
Sbjct  123  HFFYNSESLEVLVALQAALTVIGNATMCFAAYRIYRSSEE  162



>ref|XP_008372230.1| PREDICTED: uncharacterized protein ycf49 isoform X1 [Malus domestica]
Length=170

 Score =   194 bits (494),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP+NALSLPTW IHVSSV+EWV AMALVWQYGEKSG+ESWKGLSWGMVPLLGGA CACTW
Sbjct  66   EPSNALSLPTWAIHVSSVVEWVTAMALVWQYGEKSGFESWKGLSWGMVPLLGGALCACTW  125

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNS+SLEVLVALQAALTVIGNATMC AA+RIY+SS+E
Sbjct  126  HFFYNSDSLEVLVALQAALTVIGNATMCFAAYRIYRSSEE  165



>ref|XP_006358369.1| PREDICTED: uncharacterized protein LOC102579570 [Solanum tuberosum]
Length=193

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            QF EP+NALSL TW  HVS+V+EWV AMALVWQYGEKSGYESWKGLSWGMVPLLGGA CA
Sbjct  86   QFNEPSNALSLHTWASHVSTVVEWVTAMALVWQYGEKSGYESWKGLSWGMVPLLGGALCA  145

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CTWHFFYNSESLEV+VALQAALTVIGNATMC AAFRIY+SSQ 
Sbjct  146  CTWHFFYNSESLEVVVALQAALTVIGNATMCFAAFRIYRSSQN  188



>ref|XP_009623052.1| PREDICTED: uncharacterized protein LOC104114332 isoform X1 [Nicotiana 
tomentosiformis]
Length=197

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 137/193 (71%), Gaps = 9/193 (5%)
 Frame = +1

Query  43   MAVLTllspskflpfpkpkQTQLSSVTKSPTFL-----SAVFHPIPPIDFNNQKtlatvl  207
            MAV T LS SK    PK KQTQL+  TK+P FL      A F P P I   +Q       
Sbjct  1    MAVATSLSLSKLHLLPKQKQTQLTLSTKAPNFLFFSRKRAQF-PAPIISIPSQNLKYNAA  59

Query  208  gvaglalIS---IsgpasaaeqaamasssVQFAEPANALSLPTWTIHVSSVIEWVIAMAL  378
             V G+  ++   ++   ++  + A+  SS QF EP+NALSL TW  HVSSV+EWV AMAL
Sbjct  60   IVLGVTGLAFTVLNVGPASGSELALMGSSFQFNEPSNALSLHTWASHVSSVVEWVTAMAL  119

Query  379  VWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIGNATM  558
            VWQYGEKSGYESWKGLSW MVPLLGGA CACTWHFFYNSESLEV+VALQAALTVIGNATM
Sbjct  120  VWQYGEKSGYESWKGLSWAMVPLLGGALCACTWHFFYNSESLEVVVALQAALTVIGNATM  179

Query  559  CIAAFRIYKSSQE  597
            C AAFRIYK SQ+
Sbjct  180  CFAAFRIYKLSQK  192



>emb|CDP09859.1| unnamed protein product [Coffea canephora]
Length=194

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  FAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCAC  471
            FAEP+NALSLPTW +HVSSV+EW+ AMALVWQYGEKSG ESWKGLSWGMVPLLGGAFCAC
Sbjct  88   FAEPSNALSLPTWAVHVSSVVEWITAMALVWQYGEKSGNESWKGLSWGMVPLLGGAFCAC  147

Query  472  TWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            TWHFFYN+ESLEVLVA+QAALTVIGN T+ IAAFRI+KSS+E
Sbjct  148  TWHFFYNAESLEVLVAIQAALTVIGNVTIFIAAFRIFKSSEE  189



>ref|XP_004244585.1| PREDICTED: uncharacterized protein LOC101244306 [Solanum lycopersicum]
Length=193

 Score =   192 bits (488),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            QF EP+NALSL TW  HVS+++EWV AMALVWQYGEKSGYESWKGLSWGMVPLLGGA CA
Sbjct  86   QFNEPSNALSLHTWASHVSTIVEWVTAMALVWQYGEKSGYESWKGLSWGMVPLLGGALCA  145

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CTWHFFYNSESLEV+VALQAALTVIGNATMC AAFRIY+S+Q 
Sbjct  146  CTWHFFYNSESLEVVVALQAALTVIGNATMCFAAFRIYRSTQN  188



>gb|KHG12522.1| Ycf49-like protein [Gossypium arboreum]
Length=188

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +  +EPANALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFC
Sbjct  80   LPLSEPANALSLPTWAIHVSSVVEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFC  139

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQAALTVIGNATMC AAFRI K + +
Sbjct  140  ACTWHFFYNSESLEVLVALQAALTVIGNATMCYAAFRICKVTDK  183



>ref|XP_009761028.1| PREDICTED: uncharacterized protein LOC104213262 isoform X1 [Nicotiana 
sylvestris]
Length=197

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 134/193 (69%), Gaps = 9/193 (5%)
 Frame = +1

Query  43   MAVLTllspskflpfpkpkQTQLSSVTKSPTFL-----SAVFHPIPPIDFNNQKtlatvl  207
            MAV T  S SK    PK KQTQ +  TK+P FL      A F P P I   +Q       
Sbjct  1    MAVSTSFSLSKLHFLPKQKQTQFTLSTKAPNFLFFSRKRAQF-PAPIISIPSQNLKYNAA  59

Query  208  gvaglalIS---IsgpasaaeqaamasssVQFAEPANALSLPTWTIHVSSVIEWVIAMAL  378
             V G+  +    ++   ++  + A+  SS QF EP+NALSL TW  HVSSV+EWV AMAL
Sbjct  60   IVLGVTGLGFTLLNVGPASGSELALMGSSFQFNEPSNALSLHTWASHVSSVVEWVTAMAL  119

Query  379  VWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIGNATM  558
            VWQYGEKSGYESWKGLSW MVPLLGGA CACTWHFFYNSESLEV+VALQAALTVIGNATM
Sbjct  120  VWQYGEKSGYESWKGLSWAMVPLLGGALCACTWHFFYNSESLEVVVALQAALTVIGNATM  179

Query  559  CIAAFRIYKSSQE  597
            C AAFRIY+ SQ+
Sbjct  180  CFAAFRIYRLSQQ  192



>gb|KHN42730.1| Ycf49-like protein [Glycine soja]
Length=179

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 99/116 (85%), Gaps = 12/116 (10%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +QF EP NALSLPTW IHVSSV EW+IAMALVWQYGEKSGY +WKGLSWGMVPLLGGAFC
Sbjct  63   LQFHEPPNALSLPTWAIHVSSVAEWIIAMALVWQYGEKSGYPAWKGLSWGMVPLLGGAFC  122

Query  466  ACTWHFFYNSESLE------------VLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNS+SLE            VLVALQAALT+IGNATMCIAA+RIYKSSQ+
Sbjct  123  ACTWHFFYNSDSLEARLLTMPLHPSYVLVALQAALTIIGNATMCIAAYRIYKSSQD  178



>gb|KJB51973.1| hypothetical protein B456_008G241100 [Gossypium raimondii]
Length=188

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +  +EPANALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFC
Sbjct  80   LPLSEPANALSLPTWAIHVSSVVEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFC  139

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQAALTVIGNATMC AAFRI K + +
Sbjct  140  ACTWHFFYNSESLEVLVALQAALTVIGNATMCYAAFRICKVTDK  183



>ref|XP_009412511.1| PREDICTED: uncharacterized protein LOC103993984 [Musa acuminata 
subsp. malaccensis]
Length=195

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP NALSLPTW IHVSSVIEWVIAM LVWQYGEKSG+++WKGL+WGMVPLLGGA CACTW
Sbjct  91   EPENALSLPTWAIHVSSVIEWVIAMVLVWQYGEKSGFQTWKGLTWGMVPLLGGALCACTW  150

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYN+ESLE+LVALQAALTV+GN TMC AAFRIYK+SQE
Sbjct  151  HFFYNAESLEILVALQAALTVLGNMTMCFAAFRIYKASQE  190



>ref|XP_006661450.1| PREDICTED: uncharacterized protein ycf49-like, partial [Oryza 
brachyantha]
Length=108

 Score =   188 bits (477),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  FAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCAC  471
             AEPANALSLPTWT+HVSSV EWV AMALVW YGE++G + WKGLSWGMVPLLGGA CAC
Sbjct  2    LAEPANALSLPTWTVHVSSVAEWVAAMALVWDYGERTGIKGWKGLSWGMVPLLGGAMCAC  61

Query  472  TWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            TWHFFYNSESLEVLVALQ ALTVIGN TMCIAAFRI+K+SQE
Sbjct  62   TWHFFYNSESLEVLVALQGALTVIGNITMCIAAFRIFKASQE  103



>ref|XP_007040024.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24525.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=189

 Score =   191 bits (484),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFCACTW
Sbjct  85   EPANALSLPTWAIHVSSVVEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFCACTW  144

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNSESLEVLVALQAALTVIGNATMC AAFRI   S +
Sbjct  145  HFFYNSESLEVLVALQAALTVIGNATMCFAAFRICNLSDK  184



>ref|XP_007158422.1| hypothetical protein PHAVU_002G151800g [Phaseolus vulgaris]
 gb|ESW30416.1| hypothetical protein PHAVU_002G151800g [Phaseolus vulgaris]
Length=168

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW IHVSSV EW+IAMALVW+YG KS Y +WKGLSWGMVPLLGGAFCACTW
Sbjct  68   EPANALSLPTWAIHVSSVAEWIIAMALVWEYGHKSRYPAWKGLSWGMVPLLGGAFCACTW  127

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            HFFYNSESLEVLVALQAALTVIGN TMCIAA+RIYKSSQ
Sbjct  128  HFFYNSESLEVLVALQAALTVIGNVTMCIAAYRIYKSSQ  166



>ref|XP_010107146.1| hypothetical protein L484_019628 [Morus notabilis]
 gb|EXC13667.1| hypothetical protein L484_019628 [Morus notabilis]
Length=250

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EP+NALSLPTW +HVSSVIEW+ AM LVWQYGEKSG ESWKGLSWGMVPLLGGAFC
Sbjct  141  LQLSEPSNALSLPTWAVHVSSVIEWITAMVLVWQYGEKSGNESWKGLSWGMVPLLGGAFC  200

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNSESLEVLVALQAALT IGNAT+C AAFRI K+S+E
Sbjct  201  ACTWHFFYNSESLEVLVALQAALTAIGNATLCYAAFRICKASEE  244



>ref|XP_010676628.1| PREDICTED: uncharacterized protein LOC104892403 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=193

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            ++  EP NALSLPTW IHVSSV+EWVIAMALVWQYGEK G ESWKGL+WGMVPLLGGA C
Sbjct  86   IELHEPENALSLPTWAIHVSSVVEWVIAMALVWQYGEKPGKESWKGLTWGMVPLLGGAMC  145

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKS  588
            ACTWHFFYN+ESLEVLVALQAALT  GNATMCIAAFRIYKS
Sbjct  146  ACTWHFFYNAESLEVLVALQAALTTFGNATMCIAAFRIYKS  186



>ref|XP_010540176.1| PREDICTED: uncharacterized protein LOC104814025 [Tarenaya hassleriana]
Length=198

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW +HVSSV+EW  AM LVW+YGE+ GYE+WKGLSWGMVPLLGGA C
Sbjct  90   LQLSEPANALSLPTWAVHVSSVVEWATAMVLVWRYGERKGYEAWKGLSWGMVPLLGGALC  149

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN+ESLEVLVALQAALTVIGN TMCIAAFRI KS+ E
Sbjct  150  ACTWHFFYNAESLEVLVALQAALTVIGNMTMCIAAFRINKSTTE  193



>ref|XP_009136225.1| PREDICTED: uncharacterized protein LOC103860381 [Brassica rapa]
Length=187

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  77   LQLSEPANALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  136

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN+ESLEVLVALQ ALTVIGN T+CIAAFRI KS+ +
Sbjct  137  ACTWHFFYNAESLEVLVALQGALTVIGNITLCIAAFRINKSASK  180



>emb|CDY41288.1| BnaA01g12510D [Brassica napus]
Length=187

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  77   LQLSEPANALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  136

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN+ESLEVLVALQ ALTVIGN T+CIAAFRI KS+ +
Sbjct  137  ACTWHFFYNAESLEVLVALQGALTVIGNITLCIAAFRINKSASK  180



>ref|XP_008776047.1| PREDICTED: uncharacterized protein LOC103696264 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776048.1| PREDICTED: uncharacterized protein LOC103696264 isoform X1 [Phoenix 
dactylifera]
Length=186

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW IHVSSVIEW+ AMALVW+YGEKSG+ +WKGLSWGMVPLLGGA CACTW
Sbjct  82   EPANALSLPTWVIHVSSVIEWITAMALVWEYGEKSGFGTWKGLSWGMVPLLGGALCACTW  141

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNS SLE+LVALQAALTVIGN TMCIAAFRI+K+SQE
Sbjct  142  HFFYNSPSLEILVALQAALTVIGNITMCIAAFRIFKASQE  181



>ref|XP_010908780.1| PREDICTED: uncharacterized protein LOC105035078 isoform X2 [Elaeis 
guineensis]
 ref|XP_010908781.1| PREDICTED: uncharacterized protein LOC105035078 isoform X2 [Elaeis 
guineensis]
Length=186

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW IHVSSVIEW+ AMAL+W+YGEKS + +WKGLSWGMVPLLGGA CACTW
Sbjct  82   EPANALSLPTWAIHVSSVIEWITAMALIWEYGEKSSFRTWKGLSWGMVPLLGGALCACTW  141

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNSESLE+LVALQAALTVIGN TMCIAAFRI+K+SQE
Sbjct  142  HFFYNSESLEILVALQAALTVIGNITMCIAAFRIFKASQE  181



>ref|XP_010448829.1| PREDICTED: uncharacterized protein LOC104731212 [Camelina sativa]
Length=190

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q  EPANALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  80   LQLNEPANALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  139

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQAALTVIGN T+CIAAFRI K S +
Sbjct  140  ACTWHFFYNDESLEVLVALQAALTVIGNITLCIAAFRINKLSSK  183



>ref|XP_010242164.1| PREDICTED: uncharacterized protein ycf49-like [Nelumbo nucifera]
Length=147

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q  EPANALSLPTW IHVSSV+EW+ AMALVWQYGEKS YESWKG SWGMVPLLGG FC
Sbjct  39   LQLNEPANALSLPTWAIHVSSVVEWITAMALVWQYGEKSEYESWKGFSWGMVPLLGGVFC  98

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             CTWHFFY+SESLEVLVALQAALTV+GN TMCIAAF IY SSQ
Sbjct  99   VCTWHFFYHSESLEVLVALQAALTVVGNFTMCIAAFHIYNSSQ  141



>ref|XP_010439272.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein ycf49-like 
[Camelina sativa]
Length=189

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q  EPANALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  81   LQLNEPANALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  140

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQAALTVIGN T+CIAAFRI K S +
Sbjct  141  ACTWHFFYNDESLEVLVALQAALTVIGNITLCIAAFRINKLSSK  184



>ref|XP_006413613.1| hypothetical protein EUTSA_v10026321mg [Eutrema salsugineum]
 gb|ESQ55066.1| hypothetical protein EUTSA_v10026321mg [Eutrema salsugineum]
Length=190

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSW MVPLLGGA C
Sbjct  80   LQLSEPANALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWAMVPLLGGALC  139

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQ ALTVIGN T+CIAAFRI KSS +
Sbjct  140  ACTWHFFYNDESLEVLVALQGALTVIGNITLCIAAFRINKSSSK  183



>ref|XP_002867747.1| hypothetical protein ARALYDRAFT_914324 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44006.1| hypothetical protein ARALYDRAFT_914324 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score =   188 bits (477),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW IHVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  80   LQLSEPANALSLPTWAIHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  139

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQAALTV GN T+CIAAFRI K S +
Sbjct  140  ACTWHFFYNDESLEVLVALQAALTVFGNITLCIAAFRINKLSSK  183



>ref|XP_006851799.1| hypothetical protein AMTR_s00041p00009900 [Amborella trichopoda]
 gb|ERN13266.1| hypothetical protein AMTR_s00041p00009900 [Amborella trichopoda]
Length=183

 Score =   187 bits (475),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP NALSLPTW IHVSSV EWV AM LVWQYGEK GYE+WKGLSW MVPLLGGAFCACTW
Sbjct  74   EPKNALSLPTWAIHVSSVAEWVSAMILVWQYGEKPGYETWKGLSWAMVPLLGGAFCACTW  133

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            HFFYNSESL+VLVALQAALTVIGN TMCIAAFRI+KS+Q
Sbjct  134  HFFYNSESLDVLVALQAALTVIGNTTMCIAAFRIFKSTQ  172



>emb|CDY69954.1| BnaCnng66080D [Brassica napus]
Length=190

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW +HVSSV+EW+ AM LVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  80   LQLSEPANALSLPTWAVHVSSVVEWITAMVLVWKYGEREGYESWKGLSWGMVPLLGGALC  139

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN+ESLEVLVALQ ALTVIGN T+CIAAFRI KS+ +
Sbjct  140  ACTWHFFYNAESLEVLVALQGALTVIGNITLCIAAFRINKSASK  183



>ref|NP_194014.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC43411.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64038.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84663.1| uncharacterized protein AT4G22830 [Arabidopsis thaliana]
Length=193

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EP+NALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  83   LQLSEPSNALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  142

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQAALTV GN T+CIAAFRI K S +
Sbjct  143  ACTWHFFYNDESLEVLVALQAALTVFGNITLCIAAFRINKLSSK  186



>ref|XP_010433985.1| PREDICTED: uncharacterized protein LOC104718024 [Camelina sativa]
Length=190

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q  EPANALSLPTW +H SSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  80   LQLNEPANALSLPTWAVHFSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  139

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQAALTVIGN T+CIAAFRI K S +
Sbjct  140  ACTWHFFYNDESLEVLVALQAALTVIGNITLCIAAFRINKLSSK  183



>ref|XP_006282724.1| hypothetical protein CARUB_v10005758mg, partial [Capsella rubella]
 gb|EOA15622.1| hypothetical protein CARUB_v10005758mg, partial [Capsella rubella]
Length=203

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EP NALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  93   LQLSEPENALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  152

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQ ALTVIGN T+CIAAFRI K S +
Sbjct  153  ACTWHFFYNDESLEVLVALQGALTVIGNITLCIAAFRINKLSSK  196



>ref|XP_010439276.1| PREDICTED: uncharacterized protein LOC104722752 [Camelina sativa]
Length=192

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMV LLGGA C
Sbjct  82   LQLSEPANALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVHLLGGALC  141

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQAALTVIGN T+CIAAFRI K S +
Sbjct  142  ACTWHFFYNDESLEVLVALQAALTVIGNITLCIAAFRINKLSSK  185



>ref|NP_001190803.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84664.1| uncharacterized protein AT4G22830 [Arabidopsis thaliana]
Length=201

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EP+NALSLPTW +HVSSV+EW+ AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  91   LQLSEPSNALSLPTWAVHVSSVVEWITAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  150

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQAALTV GN T+CIAAFRI K S +
Sbjct  151  ACTWHFFYNDESLEVLVALQAALTVFGNITLCIAAFRINKLSSK  194



>ref|XP_006573743.1| PREDICTED: uncharacterized protein ycf49-like isoform X2 [Glycine 
max]
Length=161

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 6/104 (6%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +QF EP NALSLPTW IHVSSV EW+IAMALVWQYGEKSGY +WKGLSWGMVPLLGGAFC
Sbjct  63   LQFHEPPNALSLPTWAIHVSSVAEWIIAMALVWQYGEKSGYPAWKGLSWGMVPLLGGAFC  122

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYNS+SLE      AALT+IGNATMCIAA+RIYKSSQ+
Sbjct  123  ACTWHFFYNSDSLE------AALTIIGNATMCIAAYRIYKSSQD  160



>ref|XP_008670329.1| PREDICTED: uncharacterized protein ycf49 [Zea mays]
 tpg|DAA40573.1| TPA: hypothetical protein ZEAMMB73_629385 [Zea mays]
 tpg|DAA40574.1| TPA: hypothetical protein ZEAMMB73_629385 [Zea mays]
Length=164

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW +HVSSV EWV AM LVW YGEK+G + WKGLSWGMVPLLGGA CACTW
Sbjct  60   EPANALSLPTWAVHVSSVAEWVTAMWLVWDYGEKTGLKGWKGLSWGMVPLLGGAMCACTW  119

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNSESLEVLVALQ ALTV+GN TMCIAA+RI+K+SQE
Sbjct  120  HFFYNSESLEVLVALQGALTVVGNITMCIAAYRIFKASQE  159



>ref|XP_010448827.1| PREDICTED: uncharacterized protein LOC104731211 isoform X3 [Camelina 
sativa]
Length=190

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW +HVSSV+EW  AMALVW+YGE+ GYESWKGLSWGMVPLLGGA C
Sbjct  80   LQLSEPANALSLPTWAVHVSSVVEWFTAMALVWKYGERKGYESWKGLSWGMVPLLGGALC  139

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ACTWHFFYN ESLEVLVALQAALTV GN  +CIAAFRI K S +
Sbjct  140  ACTWHFFYNDESLEVLVALQAALTVTGNIPLCIAAFRINKLSSK  183



>ref|XP_004957389.1| PREDICTED: uncharacterized protein ycf49-like isoform X2 [Setaria 
italica]
Length=165

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW +HVSSV EWV AM LVW YGE++G + WKGLSWGMVPLLGGA CACTW
Sbjct  61   EPANALSLPTWAVHVSSVAEWVTAMWLVWDYGERTGIKGWKGLSWGMVPLLGGAMCACTW  120

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNSESLEVLVALQ ALTVIGN TMCIAA+RI+K+SQE
Sbjct  121  HFFYNSESLEVLVALQGALTVIGNMTMCIAAYRIFKASQE  160



>gb|EEC77149.1| hypothetical protein OsI_15596 [Oryza sativa Indica Group]
Length=444

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +1

Query  295  AEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACT  474
            AEPANALSLPTW +H+SSV EWV AMALVW YGE++G + WKGLSWGMVPLLGGA CACT
Sbjct  58   AEPANALSLPTWAVHISSVAEWVTAMALVWDYGERTGLQGWKGLSWGMVPLLGGAMCACT  117

Query  475  WHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            WHFFYNSESLEVLVALQ ALTVIGN TMCIAAFRI+K+SQE
Sbjct  118  WHFFYNSESLEVLVALQGALTVIGNITMCIAAFRIFKASQE  158



>ref|XP_002462684.1| hypothetical protein SORBIDRAFT_02g030190 [Sorghum bicolor]
 gb|EER99205.1| hypothetical protein SORBIDRAFT_02g030190 [Sorghum bicolor]
Length=167

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW +HVSSV EWV AM LVW YGE++G + WKGLSWGMVPLLGGA CACTW
Sbjct  63   EPANALSLPTWAVHVSSVAEWVTAMWLVWDYGERTGLKGWKGLSWGMVPLLGGAMCACTW  122

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNSESLEVLVALQ ALTVIGN TMCIAA+RI+K+SQE
Sbjct  123  HFFYNSESLEVLVALQGALTVIGNITMCIAAYRIFKASQE  162



>ref|NP_001052589.1| Os04g0379400 [Oryza sativa Japonica Group]
 dbj|BAF14503.1| Os04g0379400 [Oryza sativa Japonica Group]
 dbj|BAG89325.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97000.1| unnamed protein product [Oryza sativa Japonica Group]
Length=163

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  313  LSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYN  492
            LSLPTW +HVSSV EWV AMALVW YGE++G + WKGLSWGMVPLLGGA CACTWHFFYN
Sbjct  64   LSLPTWAVHVSSVAEWVTAMALVWDYGERTGLKGWKGLSWGMVPLLGGAMCACTWHFFYN  123

Query  493  SESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            SESLEVLVALQ ALTVIGN TMCIAAFRI+K+SQE
Sbjct  124  SESLEVLVALQGALTVIGNITMCIAAFRIFKASQE  158



>gb|KDO63712.1| hypothetical protein CISIN_1g030334mg [Citrus sinensis]
Length=176

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW IHVSSV EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFC
Sbjct  71   LQLSEPANALSLPTWAIHVSSVAEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFC  130

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAF  573
            ACTWHFFYNSESLEVLVALQ ALTVIGN T    +F
Sbjct  131  ACTWHFFYNSESLEVLVALQGALTVIGNKTRHAGSF  166



>gb|EYU40546.1| hypothetical protein MIMGU_mgv1a021621mg [Erythranthe guttata]
Length=189

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 6/100 (6%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP+NALSLPTW +HVSSV+EW  AM LVWQYGEKSGYESWKGLSWGMVPLLGGA CACTW
Sbjct  91   EPSNALSLPTWAVHVSSVVEWATAMGLVWQYGEKSGYESWKGLSWGMVPLLGGALCACTW  150

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            HFFYNSESLEV       LT+IGNATMCIAA+RIY SSQ+
Sbjct  151  HFFYNSESLEV------PLTLIGNATMCIAAYRIYVSSQK  184



>ref|XP_006477319.1| PREDICTED: uncharacterized protein ycf49-like isoform X2 [Citrus 
sinensis]
Length=176

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q +EPANALSLPTW IHVSSV EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFC
Sbjct  71   LQLSEPANALSLPTWAIHVSSVAEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFC  130

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAF  573
            ACTWHFFYNSESLEVLVALQ ALTVIGN T    +F
Sbjct  131  ACTWHFFYNSESLEVLVALQGALTVIGNKTRHAGSF  166



>gb|ABK25760.1| unknown [Picea sitchensis]
Length=216

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP NALSLPTW IHVSSV+EW++AMALVWQYG+K G ++WKGLSWGMVPL GGA CACTW
Sbjct  113  EPKNALSLPTWVIHVSSVVEWMVAMALVWQYGDKPGCQAWKGLSWGMVPLFGGALCACTW  172

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            HFFYN+ESLE+LVA+QAALT++GN TM +AAFRIY S++
Sbjct  173  HFFYNAESLEILVAMQAALTLVGNFTMLVAAFRIYDSTK  211



>dbj|BAJ92465.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=166

 Score =   172 bits (435),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  316  SLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNS  495
            SLPTW +HVSSV EWV AMALVW YGE++G + WKGLSWGMVPLLGGA CACTWHFFYNS
Sbjct  66   SLPTWAVHVSSVAEWVTAMALVWDYGERTGLKGWKGLSWGMVPLLGGAMCACTWHFFYNS  125

Query  496  ESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            ESLEVLVA+Q ALTVIGN TMCIAA+RIYK SQE
Sbjct  126  ESLEVLVAIQGALTVIGNITMCIAAYRIYKGSQE  159



>emb|CAE03987.1| OSJNBb0089B03.1 [Oryza sativa Japonica Group]
 emb|CAE05700.1| OSJNBa0083D01.22 [Oryza sativa Japonica Group]
Length=363

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  313  LSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYN  492
            LSLPTW +HVSSV EWV AMALVW YGE++G + WKGLSWGMVPLLGGA CACTWHFFYN
Sbjct  64   LSLPTWAVHVSSVAEWVTAMALVWDYGERTGLKGWKGLSWGMVPLLGGAMCACTWHFFYN  123

Query  493  SESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            SESLEVLVALQ ALTVIGN TMCIAAFRI+K+SQE
Sbjct  124  SESLEVLVALQGALTVIGNITMCIAAFRIFKASQE  158



>ref|XP_002961806.1| hypothetical protein SELMODRAFT_76519 [Selaginella moellendorffii]
 gb|EFJ37066.1| hypothetical protein SELMODRAFT_76519 [Selaginella moellendorffii]
Length=129

 Score =   164 bits (416),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTWTIHV+SV+EWV+AM LVWQYG+     +WKGLSWGMVPLLGGA CACTW
Sbjct  26   EPANALSLPTWTIHVASVVEWVVAMILVWQYGDTKNNAAWKGLSWGMVPLLGGALCACTW  85

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKS  588
            HFFYN+ESLEVLV +Q ALT++GN T+ IAA+RIY++
Sbjct  86   HFFYNAESLEVLVVMQGALTLVGNITLWIAAYRIYQN  122



>ref|XP_001770014.1| predicted protein [Physcomitrella patens]
 gb|EDQ65190.1| predicted protein [Physcomitrella patens]
Length=367

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            E  NALSLPTW IHV+SV+EW+ AMALVWQYG+  G  SWKGLSWGMVPLLGGA CACTW
Sbjct  263  ELTNALSLPTWFIHVASVVEWITAMALVWQYGDTPGNSSWKGLSWGMVPLLGGAMCACTW  322

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            HFFYN+ +LE+LV LQAALTVIGN TM  AAFRIY+SSQ
Sbjct  323  HFFYNAPALEILVVLQAALTVIGNFTMWAAAFRIYQSSQ  361



>ref|XP_002964881.1| hypothetical protein SELMODRAFT_406462 [Selaginella moellendorffii]
 gb|EFJ33719.1| hypothetical protein SELMODRAFT_406462 [Selaginella moellendorffii]
Length=426

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTWTIHV+SV+EWV+AM LVWQYG+     +WK LSWGMVPLLGGA CACTW
Sbjct  36   EPANALSLPTWTIHVASVVEWVVAMILVWQYGDTKNNAAWKSLSWGMVPLLGGALCACTW  95

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKS  588
            HFFYN+ESLEVLV +Q ALT++GN T+ IAA+RIY++
Sbjct  96   HFFYNAESLEVLVVMQGALTLVGNITLWIAAYRIYQN  132



>ref|XP_009347554.1| PREDICTED: uncharacterized protein LOC103939217 isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009347559.1| PREDICTED: uncharacterized protein LOC103939218 isoform X4 [Pyrus 
x bretschneideri]
Length=103

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  367  AMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIG  546
            AMALVWQYGEKSG+ESWKGLSWGMVPLLGGA CACTWHFFYNSESLEVLVALQAALTVIG
Sbjct  22   AMALVWQYGEKSGFESWKGLSWGMVPLLGGALCACTWHFFYNSESLEVLVALQAALTVIG  81

Query  547  NATMCIAAFRIYKSSQE  597
            NATMC AA+RIY+SS+E
Sbjct  82   NATMCFAAYRIYRSSEE  98



>ref|XP_008372234.1| PREDICTED: uncharacterized protein LOC103435620 isoform X4 [Malus 
domestica]
Length=103

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  367  AMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIG  546
            AMALVWQYGEKSG+ESWKGLSWGMVPLLGGA CACTWHFFYNS+SLEVLVALQAALTVIG
Sbjct  22   AMALVWQYGEKSGFESWKGLSWGMVPLLGGALCACTWHFFYNSDSLEVLVALQAALTVIG  81

Query  547  NATMCIAAFRIYKSSQE  597
            NATMC AA+RIY+SS+E
Sbjct  82   NATMCFAAYRIYRSSEE  98



>ref|XP_011463785.1| PREDICTED: uncharacterized protein LOC101306233 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=99

 Score =   150 bits (380),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  367  AMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIG  546
            AM LVWQYGEKSG+ESWKGL+WGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTV+G
Sbjct  18   AMVLVWQYGEKSGFESWKGLAWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVMG  77

Query  547  NATMCIAAFRIYKSSQE  597
            NATMC AA+RIY+S++E
Sbjct  78   NATMCFAAYRIYRSTEE  94



>ref|XP_010676629.1| PREDICTED: uncharacterized protein ycf49 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=87

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  361  VIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTV  540
            VIAMALVWQYGEK G ESWKGL+WGMVPLLGGA CACTWHFFYN+ESLEVLVALQAALT 
Sbjct  5    VIAMALVWQYGEKPGKESWKGLTWGMVPLLGGAMCACTWHFFYNAESLEVLVALQAALTT  64

Query  541  IGNATMCIAAFRIYKS  588
             GNATMCIAAFRIYKS
Sbjct  65   FGNATMCIAAFRIYKS  80



>ref|XP_010661687.1| PREDICTED: uncharacterized protein LOC100254735 isoform X2 [Vitis 
vinifera]
Length=178

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 73/76 (96%), Gaps = 0/76 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +QF+EPANALSLPTW IHVSSV+EW+IAM LVW+YGE+ G+ESWKGLSWGMVPLLGGAFC
Sbjct  73   LQFSEPANALSLPTWAIHVSSVVEWIIAMILVWKYGEQPGFESWKGLSWGMVPLLGGAFC  132

Query  466  ACTWHFFYNSESLEVL  513
            ACTWHFFYNSESLEV+
Sbjct  133  ACTWHFFYNSESLEVM  148



>ref|XP_003576744.2| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Brachypodium distachyon]
Length=487

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +1

Query  349  VIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQA  528
            V+ WV AMALVWQYGE++G + WKGLSWGMVPLLGGA CACTWHFFYNSESLEVLVALQ 
Sbjct  398  VMVWVTAMALVWQYGERTGLKGWKGLSWGMVPLLGGAMCACTWHFFYNSESLEVLVALQG  457

Query  529  ALTVIGNATMCIAAFRIYKSSQE  597
            ALTV GN TMCIAAFRI+K+SQE
Sbjct  458  ALTVTGNITMCIAAFRIFKASQE  480



>gb|KJB51970.1| hypothetical protein B456_008G241100 [Gossypium raimondii]
Length=155

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +  +EPANALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFC
Sbjct  80   LPLSEPANALSLPTWAIHVSSVVEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFC  139

Query  466  ACTWHFFYNSESLE  507
            ACTWHFFYNSESLE
Sbjct  140  ACTWHFFYNSESLE  153



>gb|EMS66927.1| putative sodium-dependent transporter yocS [Triticum urartu]
Length=655

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  349  VIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQA  528
            V+ WV AMALVW YGE++G + WKGLSWGMVPLLGGA CACTWHFFYNSESLEVLVALQ 
Sbjct  566  VMLWVTAMALVWDYGERTGLKGWKGLSWGMVPLLGGAMCACTWHFFYNSESLEVLVALQG  625

Query  529  ALTVIGNATMCIAAFRIYKSSQE  597
            ALTVIGN TMCIAA+RIYK SQE
Sbjct  626  ALTVIGNITMCIAAYRIYKGSQE  648



>gb|EMT03651.1| hypothetical protein F775_13980 [Aegilops tauschii]
Length=83

 Score =   142 bits (358),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  370  MALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIGN  549
            MALVW YGE++G + WKGLSWGMVPLLGGA CACTWHFFYNSESLE+LVA+Q ALTVIGN
Sbjct  1    MALVWDYGERTGLKGWKGLSWGMVPLLGGAMCACTWHFFYNSESLEILVAIQGALTVIGN  60

Query  550  ATMCIAAFRIYKSSQE  597
             TMCIAA+RIYK SQE
Sbjct  61   ITMCIAAYRIYKGSQE  76



>ref|XP_001694043.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02979.1| predicted protein [Chlamydomonas reinhardtii]
Length=194

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  295  AEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACT  474
            AEPANALSLPTW IHVSSV+EWV AM L+W+Y E +    WKG++WGMVP LG A  ACT
Sbjct  89   AEPANALSLPTWAIHVSSVVEWVTAMGLMWKYAEATNNPRWKGMAWGMVPSLGSAMAACT  148

Query  475  WHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            WHFFYNS  LE LV +Q+ALTVIGN T   AA+RIY+++Q
Sbjct  149  WHFFYNSPDLEFLVVVQSALTVIGNCTCWWAAYRIYEAAQ  188



>gb|EPS69478.1| hypothetical protein M569_05288, partial [Genlisea aurea]
Length=98

 Score =   141 bits (355),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
              +EP NALSLPTW +HVSSV+EW  AMALVWQYGE+SGYESWKGLSWGMVPLLGGA CA
Sbjct  25   NLSEPWNALSLPTWAVHVSSVVEWATAMALVWQYGERSGYESWKGLSWGMVPLLGGALCA  84

Query  469  CTWHFFYNSESLEV  510
            CTWHFFYNSESLEV
Sbjct  85   CTWHFFYNSESLEV  98



>ref|XP_002955488.1| hypothetical protein VOLCADRAFT_65897 [Volvox carteri f. nagariensis]
 gb|EFJ43559.1| hypothetical protein VOLCADRAFT_65897 [Volvox carteri f. nagariensis]
Length=188

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +1

Query  295  AEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACT  474
            AEP+NALSLPTW IHVSSV+EWV AM L+W+Y E SG   WKG++WGM+P LG A  ACT
Sbjct  83   AEPSNALSLPTWAIHVSSVLEWVTAMGLMWKYAEASGNPRWKGMAWGMLPSLGSAMAACT  142

Query  475  WHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
            WHFFYNS  LE LV +Q+ALTVIGN T   AA+RIY+++
Sbjct  143  WHFFYNSPDLEFLVVVQSALTVIGNCTCWWAAYRIYEAA  181



>ref|XP_008776049.1| PREDICTED: uncharacterized protein LOC103696264 isoform X2 [Phoenix 
dactylifera]
Length=178

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW IHVSSVIEW+ AMALVW+YGEKSG+ +WKGLSWGMVPLLGGA CACTW
Sbjct  82   EPANALSLPTWVIHVSSVIEWITAMALVWEYGEKSGFGTWKGLSWGMVPLLGGALCACTW  141

Query  478  HFFYNSESLEVLVA  519
            HFFYNS SLE+ +A
Sbjct  142  HFFYNSPSLELFLA  155



>ref|XP_005850999.1| hypothetical protein CHLNCDRAFT_19867 [Chlorella variabilis]
 gb|EFN58897.1| hypothetical protein CHLNCDRAFT_19867 [Chlorella variabilis]
Length=105

 Score =   136 bits (343),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW +H SSV+EWV AM L+W+YGE SG   WKG++WGM+P LG A CACTW
Sbjct  2    EPANALSLPTWAVHTSSVLEWVTAMGLMWRYGEVSGNTRWKGMAWGMLPCLGSAMCACTW  61

Query  478  HFFYNSESLEVLVALQAALTVIGNAT  555
            H FYNS  LE LVALQAALTV+GN T
Sbjct  62   HLFYNSPDLEFLVALQAALTVVGNFT  87



>ref|XP_010908784.1| PREDICTED: uncharacterized protein LOC105035078 isoform X5 [Elaeis 
guineensis]
Length=154

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW IHVSSVIEW+ AMAL+W+YGEKS + +WKGLSWGMVPLLGGA CACTW
Sbjct  82   EPANALSLPTWAIHVSSVIEWITAMALIWEYGEKSSFRTWKGLSWGMVPLLGGALCACTW  141

Query  478  HFFYNSESLEV  510
            HFFYNSESLE+
Sbjct  142  HFFYNSESLEM  152



>ref|XP_005650703.1| hypothetical protein COCSUDRAFT_12723, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26159.1| hypothetical protein COCSUDRAFT_12723, partial [Coccomyxa subellipsoidea 
C-169]
Length=100

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALSLPTW IH+SS +EW  AM L WQY E +G + WKGL+WGM+PLLGGA  ACT+HFF
Sbjct  1    NALSLPTWAIHISSTVEWATAMLLFWQYAEVTGNQRWKGLTWGMLPLLGGALAACTYHFF  60

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            YN   L++LVALQA LTV GN T   AA+RIY+ ++
Sbjct  61   YNPPELDILVALQAFLTVAGNCTCAWAAYRIYQDAE  96



>ref|XP_010277421.1| PREDICTED: uncharacterized protein LOC104611867 isoform X2 [Nelumbo 
nucifera]
Length=171

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 75/104 (72%), Gaps = 23/104 (22%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +Q  EPANALSLPTW +HVSSVIEWV AMALVWQYGEKSGYESWKGLSWGM         
Sbjct  86   LQLNEPANALSLPTWAVHVSSVIEWVTAMALVWQYGEKSGYESWKGLSWGM---------  136

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
                          VLVA+QAALTVIGN TMCIAAFRIY+S Q+
Sbjct  137  --------------VLVAIQAALTVIGNLTMCIAAFRIYRSFQK  166



>gb|KJB51971.1| hypothetical protein B456_008G241100 [Gossypium raimondii]
Length=183

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +  +EPANALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGLSWGMVPLLGGAFC
Sbjct  80   LPLSEPANALSLPTWAIHVSSVVEWITAMALVWQYGEKSGFESWKGLSWGMVPLLGGAFC  139

Query  466  ACTWHFFY  489
            ACTWHFFY
Sbjct  140  ACTWHFFY  147



>ref|XP_009347553.1| PREDICTED: uncharacterized protein LOC103939217 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009347558.1| PREDICTED: uncharacterized protein LOC103939218 isoform X3 [Pyrus 
x bretschneideri]
Length=144

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 74/100 (74%), Gaps = 23/100 (23%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP+NALSLPTW IHVSSV+EWV AMALVWQYGEKSG+ESWKGLSWGM             
Sbjct  63   EPSNALSLPTWAIHVSSVVEWVTAMALVWQYGEKSGFESWKGLSWGM-------------  109

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
                      VLVALQAALTVIGNATMC AA+RIY+SS+E
Sbjct  110  ----------VLVALQAALTVIGNATMCFAAYRIYRSSEE  139



>ref|XP_008372232.1| PREDICTED: uncharacterized protein LOC103435620 isoform X3 [Malus 
domestica]
Length=147

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 74/100 (74%), Gaps = 23/100 (23%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP+NALSLPTW IHVSSV+EWV AMALVWQYGEKSG+ESWKGLSWGM             
Sbjct  66   EPSNALSLPTWAIHVSSVVEWVTAMALVWQYGEKSGFESWKGLSWGM-------------  112

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
                      VLVALQAALTVIGNATMC AA+RIY+SS+E
Sbjct  113  ----------VLVALQAALTVIGNATMCFAAYRIYRSSEE  142



>ref|XP_005714398.1| unnamed protein product [Chondrus crispus]
 emb|CDF34579.1| unnamed protein product [Chondrus crispus]
Length=392

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALS PTW IHVSS++EW++AM LVW+Y E +   +WKGL+WGM+PL     CACT+
Sbjct  193  EPANALSFPTWVIHVSSLVEWLVAMGLVWKYAEVTDNPAWKGLTWGMLPLHTSGICACTY  252

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            H FYN+ SL +LVALQAALT  GN T+  AA+RI +S ++
Sbjct  253  HLFYNAPSLNILVALQAALTFFGNGTLVAAAYRISRSEKK  292



>ref|XP_004957388.1| PREDICTED: uncharacterized protein ycf49-like isoform X1 [Setaria 
italica]
Length=219

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW +HVSSV EWV AM LVW YGE++G + WKGLSWGMVPLLGGA CACTW
Sbjct  61   EPANALSLPTWAVHVSSVAEWVTAMWLVWDYGERTGIKGWKGLSWGMVPLLGGAMCACTW  120

Query  478  HFFYNSESLEV  510
            HFFYNSESLEV
Sbjct  121  HFFYNSESLEV  131



>ref|WP_010873588.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_442291.1| hypothetical protein sll0608 [Synechocystis sp. PCC 6803]
 sp|Q55720.1|YC49L_SYNY3 RecName: Full=Ycf49-like protein [Synechocystis sp. PCC 6803 
substr. Kazusa]
 dbj|BAA10361.1| sll0608 [Synechocystis sp. PCC 6803]
 dbj|BAK51146.1| hypothetical protein SYNGTS_2398 [Synechocystis sp. PCC 6803]
 dbj|BAL30144.1| hypothetical protein SYNGTI_2397 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL33313.1| hypothetical protein SYNPCCN_2396 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL36482.1| hypothetical protein SYNPCCP_2396 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM54049.1| hypothetical protein BEST7613_5118 [Synechocystis sp. PCC 6803]
 gb|AGF52653.1| hypothetical protein MYO_124230 [Synechocystis sp. PCC 6803]
Length=104

 Score =   128 bits (322),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSVIEW++A+ALV +Y  K+GY  W+ L+WGMVP L  A CACTWHFF
Sbjct  2    NALSIPTWMVHVSSVIEWIVAIALVSRYATKAGYGHWRALAWGMVPALVSATCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N+  L+ LV LQA  TVIGN T+C+AA+ IY+ S +
Sbjct  62   DNASQLDWLVTLQALTTVIGNITLCLAAWWIYRQSAQ  98



>ref|WP_026222330.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=102

 Score =   128 bits (322),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW++A+AL+W+YGE +G   W GLS+ M+P L  A CACTWHFF
Sbjct  2    HALSIPTWMIHISSVIEWIVAIALIWRYGEITGDRVWWGLSFAMLPALISALCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N +SL  LV LQAA+TV+GN T+C+AA+ I++SS+ 
Sbjct  62   DNPDSLSWLVTLQAAMTVLGNTTLCLAAWWIWRSSRS  98



>ref|WP_002766813.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI01486.1| Ycf49-like protein [Microcystis aeruginosa PCC 9443]
Length=103

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSV+EW+ A+ LVW YGE S  +SW+ LSWGM+P L GA CACTWHFF
Sbjct  2    NALSIPTWIVHVSSVVEWIAAIWLVWTYGEISSDQSWRMLSWGMLPALIGAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  +L  LV LQAA+TV+GN T+C A + +++SS+
Sbjct  62   DNISALSWLVTLQAAMTVLGNFTLCAAGWWLWRSSK  97



>ref|WP_002790576.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI20344.1| Ycf49-like protein [Microcystis aeruginosa PCC 9807]
Length=103

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSV+EW+ A+ LVW YGE S   SW+ LSWGM+P L GA CACTWHFF
Sbjct  2    NALSIPTWIVHVSSVVEWIAAIWLVWTYGEISSDRSWRMLSWGMLPALIGAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  +L  LV LQAA+TV+GN T+C A + +++SS+
Sbjct  62   DNISALSWLVTLQAAMTVLGNFTLCAAGWWLWRSSK  97



>ref|WP_015143187.1| hypothetical protein [Pleurocapsa minor]
 gb|AFY76881.1| Protein of unknown function (DUF2499) [Pleurocapsa sp. PCC 7327]
Length=104

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEWV A+ LVW YGE +G   W GLSW M+P L  A CACTWHFF
Sbjct  2    HALSIPTWVIHVSSVIEWVAAIWLVWIYGEVTGNRYWWGLSWAMLPALLSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N+ SLE LV LQA++TV+GN T+C AA+ I++S+
Sbjct  62   DNASSLEWLVTLQASMTVVGNCTLCAAAWWIWRSA  96



>ref|WP_006527841.1| Protein of unknown function (DUF2499) [Gloeocapsa sp. PCC 73106]
 gb|ELR99342.1| Protein of unknown function (DUF2499) [Gloeocapsa sp. PCC 73106]
Length=103

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH++SVIEW+  + LVW Y E +    W+ L+WGM+P L GA CACTWHFF
Sbjct  2    HALSIPTWIIHITSVIEWITVIWLVWTYAEVTQNTYWRALAWGMLPSLVGAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N ESLE LV++QAA+TV+GN T+C+AA+ I++SS++
Sbjct  62   DNIESLEWLVSVQAAMTVLGNFTLCVAAWWIWRSSKQ  98



>gb|KJB51972.1| hypothetical protein B456_008G241100 [Gossypium raimondii]
Length=165

 Score =   127 bits (320),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 73/104 (70%), Gaps = 23/104 (22%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +  +EPANALSLPTW IHVSSV+EW+ AMALVWQYGEKSG+ESWKGLSWGM         
Sbjct  80   LPLSEPANALSLPTWAIHVSSVVEWITAMALVWQYGEKSGFESWKGLSWGM---------  130

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
                          VLVALQAALTVIGNATMC AAFRI K + +
Sbjct  131  --------------VLVALQAALTVIGNATMCYAAFRICKVTDK  160



>ref|WP_008277234.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ89682.1| hypothetical protein CY0110_11227 [Cyanothece sp. CCY0110]
Length=110

 Score =   125 bits (315),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSVIEW +A+ LVW Y E S    W+ LSWGM+P L  A CACTWHFF
Sbjct  2    NALSIPTWMVHVSSVIEWTVAILLVWTYAEVSEKLYWRWLSWGMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYK  585
             N+ SL+ LV LQA+LTV+GN T+C+A +RI++
Sbjct  62   DNAPSLDWLVTLQASLTVVGNCTLCLAGWRIFR  94



>ref|WP_015147285.1| hypothetical protein [Oscillatoria acuminata]
 gb|AFY80635.1| Protein of unknown function (DUF2499) [Oscillatoria acuminata 
PCC 6304]
Length=120

 Score =   125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W+YGE +G   W+GLS+ M+P L GA CACTWH+F
Sbjct  2    HALSIPTWMIHVSSVIEWIAAIWLIWRYGEVTGDRYWRGLSFAMLPALVGAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N  SL+ LV LQA +TV+GN T+C+AA+ I++S++ 
Sbjct  62   DNPTSLDWLVTLQATMTVVGNCTLCLAAWWIWRSAKR  98



>ref|WP_002803528.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI37863.1| Ycf49-like protein [Microcystis aeruginosa PCC 9701]
Length=103

 Score =   125 bits (314),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSV+EW+ A+ LVW YG+ S   SW+ LSWGM+P L GA CACTWHFF
Sbjct  2    NALSIPTWMVHVSSVVEWIAAIWLVWTYGDISSDRSWRMLSWGMLPALIGAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  +L  LV LQAA+TV+GN T+C A + +++SS+
Sbjct  62   DNISALSWLVTLQAAMTVLGNFTLCAAGWWLWRSSK  97



>ref|WP_002734463.1| MULTISPECIES: hypothetical protein [Microcystis]
 dbj|BAG00548.1| hypothetical protein MAE_07260 [Microcystis aeruginosa NIES-843]
 emb|CCI00109.1| Ycf49-like protein [Microcystis aeruginosa PCC 9717]
 emb|CCI07644.1| Ycf49-like protein [Microcystis aeruginosa PCC 7941]
 emb|CCI12315.1| Ycf49-like protein [Microcystis aeruginosa PCC 9806]
 emb|CCI29132.1| Ycf49-like protein [Microcystis aeruginosa PCC 9808]
 emb|CCI21558.1| Ycf49-like protein [Microcystis aeruginosa PCC 9809]
 emb|CCI31611.1| Ycf49-like protein [Microcystis sp. T1-4]
 gb|ELP57057.1| hypothetical protein O53_1669 [Microcystis aeruginosa TAIHU98]
Length=103

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSV+EW+ A+ LVW YG+ S   SW+ LSWGM+P L GA CACTWHFF
Sbjct  2    NALSIPTWIVHVSSVVEWIAAIWLVWTYGDISSDRSWRMLSWGMLPALIGAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  +L  LV LQAA+TV+GN T+C A + +++SS+
Sbjct  62   DNISALSWLVTLQAAMTVLGNFTLCAAGWWLWRSSK  97



>ref|WP_015159623.1| Protein of unknown function (DUF2499) [Chamaesiphon minutus]
 gb|AFY93475.1| Protein of unknown function (DUF2499) [Chamaesiphon minutus PCC 
6605]
Length=100

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IH+SSVIEW+ A+ L+W Y E SG  +W+ LS+GM+P L  A CACTWHFF
Sbjct  2    HVLSIPTWVIHISSVIEWMTAIWLIWLYAETSGNLAWRSLSFGMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N+ +LE LV LQAA+TV+GNATMC+AA+ I K S
Sbjct  62   DNTPTLEWLVTLQAAMTVVGNATMCLAAWHISKQS  96



>ref|XP_002509640.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51027.1| conserved hypothetical protein [Ricinus communis]
Length=104

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  370  MALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIGN  549
            MALVWQYGEKSG+ESWKGLSWGMVPLLGGAFCACTWHFFYN+ESLEVLVALQAALTVIG 
Sbjct  1    MALVWQYGEKSGFESWKGLSWGMVPLLGGAFCACTWHFFYNAESLEVLVALQAALTVIGK  60

Query  550  ATM  558
             ++
Sbjct  61   LSV  63



>ref|WP_012597204.1| MULTISPECIES: hypothetical protein [Cyanothece]
 gb|ACK67950.1| conserved hypothetical protein [Cyanothece sp. PCC 8801]
 gb|ACV02846.1| conserved hypothetical protein [Cyanothece sp. PCC 8802]
Length=100

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            N LS+PTW +HVSSVIEW+ A+ LVW Y + +    W+ LSWGM+P L  A CACTWHFF
Sbjct  2    NVLSIPTWIVHVSSVIEWLAAIWLVWTYADVTKNYHWRWLSWGMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N ESL  LV LQAA+TV+GN T+C+AA+ I++SS+
Sbjct  62   DNLESLVWLVTLQAAMTVVGNCTLCLAAWWIWRSSR  97



>ref|WP_036484272.1| hypothetical protein [Myxosarcina sp. GI1]
Length=104

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+ TW +HVSSVIEW+ A+  +WQYG  +G  +W  LSW M+P L  A CACTWHFF
Sbjct  2    HALSISTWMVHVSSVIEWIAAIWFIWQYGAITGDRTWWALSWAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N E L+ LV LQAA+TV+GN T+C+AA+ I++S Q+
Sbjct  62   DNPELLDWLVVLQAAMTVVGNCTLCLAAWWIWRSRQD  98



>ref|WP_002741768.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO90598.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH91846.1| Ycf49-like protein [Microcystis aeruginosa PCC 9432]
 gb|ELS49386.1| hypothetical protein C789_845 [Microcystis aeruginosa DIANCHI905]
 gb|EPF18831.1| hypothetical protein MAESPC_04409 [Microcystis aeruginosa SPC777]
Length=103

 Score =   123 bits (308),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSV+EW+ A+ LVW Y + S   SW+ LSWGM+P L GA CACTWHFF
Sbjct  2    NALSIPTWIVHVSSVVEWIAAIWLVWTYSDISSDRSWRMLSWGMLPALIGAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  +L  LV LQAA+TV+GN T+C A + +++SS+
Sbjct  62   DNISALSWLVTLQAAMTVLGNFTLCAAGWWLWRSSK  97



>ref|WP_016925663.1| hypothetical protein [Prochlorothrix hollandica]
Length=100

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSV+EW++A+  VWQY E S  ++W+ L+WGMVP L  A CACTWHFF
Sbjct  2    HALSIPTWIIHVSSVLEWIVAIWFVWQYAEASQQKAWQALAWGMVPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+  L+ LV LQA++TV+GN T   AA+ IY+S Q
Sbjct  62   DNAPQLDWLVTLQASMTVVGNCTFMAAAWWIYRSLQ  97



>ref|WP_017719931.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=120

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEWV A+ L+W YGE +G  +W+ LS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWVGAIWLIWTYGEVTGNRAWRALSLAMLPSLVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N ESLE LV LQAA+TV+GN T+C  A+ I++SS+
Sbjct  62   DNPESLEWLVTLQAAMTVVGNCTLCAGAWWIWRSSR  97



>ref|WP_009625962.1| Protein of unknown function DUF2499 [Pseudanabaena biceps]
 gb|ELS33880.1| Protein of unknown function DUF2499 [Pseudanabaena biceps PCC 
7429]
Length=102

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            ++LSLPTW IH+SSVIEW +A+ L+WQY +++    W+GL+W M P L  A CA TWHFF
Sbjct  2    HSLSLPTWVIHISSVIEWTLAIWLIWQYDKQNPDRGWRGLAWAMFPALVSAMCAVTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N++SLE LV LQAA+T+IGN+T+ IAAF I+K ++
Sbjct  62   DNADSLEWLVTLQAAMTLIGNSTLAIAAFFIWKITR  97



>gb|AIE75459.1| putative conserved membrane protein Ycf49, BioY family [Synechocystis 
sp. PCC 6714]
Length=127

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +1

Query  301  PANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWH  480
            P NALS+PTW +HVSSVIEW++A+ALV +Y  + GY  W+ LSW MVP L  A CACTWH
Sbjct  23   PMNALSIPTWMVHVSSVIEWMVAIALVSRYATREGYGHWRILSWAMVPALVSAMCACTWH  82

Query  481  FFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
            FF N+  L  LV +QA  TV+GN T+C+AA+ IY+ S
Sbjct  83   FFDNASQLNWLVTIQALTTVLGNITLCLAAWWIYRQS  119



>ref|WP_015181131.1| hypothetical protein [Microcoleus sp. PCC 7113]
 gb|AFZ16971.1| Protein of unknown function (DUF2499) [Microcoleus sp. PCC 7113]
Length=117

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YGE     +W GLS+ M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIIHVSSVIEWIAAILLIWTYGEVKRDRTWWGLSFAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N  SLE LV LQA++TV+GN T+C AA+ I++S+Q+
Sbjct  62   DNPASLEWLVTLQASMTVLGNITLCAAAWWIWRSAQK  98



>ref|XP_007514713.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14953.1| predicted protein [Bathycoccus prasinos]
Length=526

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            +  EP NALSLPTW IH SS+IEW++AM+L+W Y +     S+KGL+WGMV        A
Sbjct  321  KHGEPGNALSLPTWVIHASSLIEWLVAMSLIWNYADVKKRPSYKGLTWGMVTSHASGLAA  380

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            CT+H FYNS +L  +VALQA LT IGNATM IAA+R+Y+  + 
Sbjct  381  CTFHVFYNSPALNSVVALQAGLTCIGNATMGIAAYRMYQEGKR  423



>ref|WP_009545091.1| MULTISPECIES: hypothetical protein [Cyanothece]
 gb|ACB53100.1| conserved hypothetical protein [Cyanothece sp. ATCC 51142]
Length=100

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSVIEW +A+  VW Y E S    W+ LSWGM+P L  A CACTWH F
Sbjct  2    NALSIPTWMVHVSSVIEWTVAILFVWTYAEVSQKLYWRSLSWGMLPALVSAMCACTWHLF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ SL+ LV LQA+LTV+GN T+C A + I++SS 
Sbjct  62   DNAPSLDWLVTLQASLTVVGNCTLCFAGWWIFRSSS  97



>ref|WP_015117311.1| hypothetical protein [Rivularia sp. PCC 7116]
 gb|AFY53733.1| Protein of unknown function (DUF2499) [Rivularia sp. PCC 7116]
Length=112

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  310  ALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFY  489
            ALS+PTW IHVSSVIEW+ A+ L+W+YGE  G  +W  LS+GM+P L  A CACTWHFF 
Sbjct  3    ALSIPTWIIHVSSVIEWIAAIWLIWKYGEVIGNRAWGALSFGMLPALVSAMCACTWHFFE  62

Query  490  NSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            NS SLE LV LQA++TVIGN T+ +AA+ IY S++
Sbjct  63   NSPSLEWLVTLQASMTVIGNFTLFVAAWWIYSSTK  97



>ref|WP_019507574.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=104

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +HVSSV+EW +A+  +WQYG+ +G  SW  LS+ M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIVHVSSVLEWAVAIFYIWQYGKITGDRSWYNLSFAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N +SLE LV +QA++TV+GN T+CIAA+ I++SS+ 
Sbjct  62   DNLQSLEWLVTMQASMTVVGNFTVCIAAWGIWRSSRN  98



>ref|WP_015134836.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 gb|AFY39082.1| Protein of unknown function DUF2499 [Leptolyngbya sp. PCC 7376]
Length=103

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS PTW +HVSSV+EWV+A+ L++ YG+ +  +SW  LSWGM+P L  A CACTWHFF
Sbjct  2    NALSFPTWIVHVSSVLEWVMAIWLIYTYGQLTKDKSWSALSWGMLPSLVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV  QAA TVIGN T+C+ A+ +++S +
Sbjct  62   DNAESLEWLVTTQAATTVIGNITLCLGAWWVWRSPK  97



>ref|WP_028947176.1| hypothetical protein [Synechocystis sp. PCC 6714]
Length=104

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSVIEW++A+ALV +Y  + GY  W+ LSW MVP L  A CACTWHFF
Sbjct  2    NALSIPTWMVHVSSVIEWMVAIALVSRYATREGYGHWRILSWAMVPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N+  L  LV +QA  TV+GN T+C+AA+ IY+ S
Sbjct  62   DNASQLNWLVTIQALTTVLGNITLCLAAWWIYRQS  96



>ref|WP_015204093.1| hypothetical protein [Crinalium epipsammum]
 gb|AFZ13986.1| Protein of unknown function DUF2499 [Crinalium epipsammum PCC 
9333]
Length=100

 Score =   120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YGE S   SW+ LS+ M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIIHVSSVIEWIAAIWLIWTYGEVSNNRSWRALSFAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N   LE LV LQA++TV+GN T+CIA + I++SS+
Sbjct  62   DNFPGLEWLVTLQASMTVVGNFTLCIAGWWIWRSSK  97



>emb|CCQ61555.1| hypothetical protein CWATWH0401_4266 [Crocosphaera watsonii WH 
0401]
Length=103

 Score =   120 bits (301),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            N LS+PTW +HVSSV+EW +A+  VW Y + S    W+ LSWGM+P L  A CACTWHFF
Sbjct  2    NVLSIPTWMVHVSSVVEWTVAILFVWTYAQVSAKLYWRSLSWGMLPGLVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N  SL+ LV LQA+LTVIGN T+C+A   I++SS
Sbjct  62   DNPASLDWLVTLQASLTVIGNCTLCLAGLWIFRSS  96



>ref|WP_012598193.1| hypothetical protein [Cyanothece sp. PCC 7424]
 gb|ACK69246.1| conserved hypothetical protein [Cyanothece sp. PCC 7424]
Length=101

 Score =   120 bits (301),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A  LVW YG+ +G   W+ LS+ M+P L GA CACTWHFF
Sbjct  2    HALSIPTWIIHISSVIEWIAATWLVWTYGDVTGDRVWRYLSYAMLPALVGALCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             NS SL  LV +QA++TV+GN T+  AA+ I++SSQE
Sbjct  62   DNSPSLNWLVTVQASMTVLGNCTLLAAAWWIWRSSQE  98



>ref|WP_007305080.1| hypothetical protein [Crocosphaera watsonii]
 gb|EAM51264.1| hypothetical protein CwatDRAFT_4426 [Crocosphaera watsonii WH 
8501]
 gb|EHJ13246.1| hypothetical protein CWATWH0003_2059 [Crocosphaera watsonii WH 
0003]
 emb|CCQ49378.1| FIG00557612: hypothetical protein [Crocosphaera watsonii WH 8502]
 emb|CCQ54123.1| hypothetical protein CWATWH0005_5514 [Crocosphaera watsonii WH 
0005]
 emb|CCQ67490.1| hypothetical protein CWATWH0402_5319 [Crocosphaera watsonii WH 
0402]
Length=103

 Score =   120 bits (301),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            N LS+PTW +HVSSV+EW +A+  VW Y + S    W+ LSWGM+P L  A CACTWHFF
Sbjct  2    NVLSIPTWMVHVSSVVEWTVAILFVWTYAQVSAKLYWRSLSWGMLPGLVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N  SL+ LV LQA+LTVIGN T+C+A + I++SS
Sbjct  62   DNPASLDWLVTLQASLTVIGNCTLCLAGWWIFRSS  96



>gb|ACJ84934.1| unknown [Medicago truncatula]
Length=126

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            ++  EP+NALSLPTW +HVSSV+EW+IAMALVWQYGEKSGYE+WKGL WGMVPLLGGAFC
Sbjct  64   LELQEPSNALSLPTWAVHVSSVVEWIIAMALVWQYGEKSGYEAWKGLFWGMVPLLGGAFC  123

Query  466  ACT  474
            ACT
Sbjct  124  ACT  126



>ref|WP_016950118.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=111

 Score =   120 bits (301),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W YGE +   SW GLS+GM+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIAAIWLIWTYGELTKNRSWWGLSFGMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NSESLE LV LQA +T++GN T+  AA+ I++S++
Sbjct  62   DNSESLEWLVTLQATMTLVGNFTLWAAAYLIWRSTK  97



>ref|WP_015138354.1| hypothetical protein [Nostoc sp. PCC 7524]
 gb|AFY47908.1| Protein of unknown function (DUF2499) [Nostoc sp. PCC 7524]
Length=115

 Score =   120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YGE +G  SW GLS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVIEWIAAIWLIWTYGELTGNRSWWGLSLAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQA +TV+GN T+  AA  I++SS+
Sbjct  62   DNAESLEWLVTLQATMTVVGNFTLWAAAVLIWRSSR  97



>ref|WP_015223995.1| hypothetical protein [Cyanobacterium stanieri]
 gb|AFZ48682.1| Protein of unknown function DUF2499 [Cyanobacterium stanieri 
PCC 7202]
Length=99

 Score =   120 bits (300),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +HVSSVIEW+ A+  +W+Y E +G +SW+ L+WGM+P L  A CACTWHF+
Sbjct  2    HALSIPTWIVHVSSVIEWIAAIWFIWRYAEVTGEDSWRWLAWGMLPALVSAMCACTWHFY  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYK  585
             N  SLE LV +QA  TVIGN T+C+ A+RI+ 
Sbjct  62   DNLPSLEWLVTIQALTTVIGNCTLCLGAWRIWS  94



>ref|WP_015230306.1| hypothetical protein [Dactylococcopsis salina]
 gb|AFZ51317.1| Protein of unknown function (DUF2499) [Dactylococcopsis salina 
PCC 8305]
Length=102

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HVSSVIEW++A+ L+W+YGE +G + W GLS  M P L  A CA TWHFF
Sbjct  2    NALSIPTWIVHVSSVIEWIVAIWLIWRYGEITGEKKWWGLSLAMFPALVSAMCAVTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N+ESL+ LV LQA +T++GN T+C AA+ I+++S
Sbjct  62   DNAESLDWLVILQAGMTLLGNITLCAAAWWIWRTS  96



>ref|WP_017285987.1| hypothetical protein [Leptolyngbya boryana]
Length=101

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
             ALS+PTW IHVSSVIEW+ A+ L+W+Y E SG   W+ LS+GM+P L  A CACTWHFF
Sbjct  2    TALSIPTWIIHVSSVIEWIAAIWLIWRYAEVSGDLVWRSLSFGMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N  +L+ LV LQAA+TV+GN T C A + I++S+Q 
Sbjct  62   DNPPALDWLVTLQAAMTVVGNCTCCAAGWWIWRSTQN  98



>ref|XP_005818625.1| hypothetical protein GUITHDRAFT_56967, partial [Guillardia theta 
CCMP2712]
 gb|EKX31645.1| hypothetical protein GUITHDRAFT_56967, partial [Guillardia theta 
CCMP2712]
Length=91

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALSLPTW +HVSS+IEW+ AM LVW+Y E +G   WKGL+WGM+P      CACT+H F
Sbjct  1    NALSLPTWMVHVSSLIEWLAAMGLVWRYAEVTGNPRWKGLTWGMLPFHSSGLCACTYHLF  60

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRI  579
            YNS ++  LVALQ+ALTV+G+ T   AA+RI
Sbjct  61   YNSPAVSGLVALQSALTVVGDFTCWYAAYRI  91



>ref|WP_017311954.1| MULTISPECIES: hypothetical protein [Stigonematales]
 gb|KIY09906.1| hypothetical protein SP67_30005 [Mastigocladus laminosus UU774]
Length=115

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IHVSSVIEW++A+ L+WQYGE +G  +W  LS GM+P L  A CACTWH+F
Sbjct  2    HVLSIPTWIIHVSSVIEWIVAIWLIWQYGEVTGNRAWWTLSLGMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESL+ LV LQA +T++GN T+  AA  I++SS+
Sbjct  62   ENAESLQWLVTLQATMTLVGNITLWAAAVWIWRSSK  97



>ref|WP_026097440.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=103

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IH+SSVIEW+ A+ LVW+YGE +G  +W  LS  M+P L  A CACTWHFF
Sbjct  2    HVLSIPTWMIHISSVIEWIAAIWLVWRYGEVTGNRAWHWLSVAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+E+LE LV +QAA TV+GN T+C+AA+ I++ ++
Sbjct  62   DNAEALEWLVTVQAATTVMGNCTLCLAAWWIWRRAR  97



>ref|WP_038016156.1| hypothetical protein [Synechococcus sp. PCC 7335]
Length=114

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +H+SSVIEW+ A+  +WQY E SGY +W+ +S+ M P L  A CACTWHFF
Sbjct  2    HALSIPTWIVHISSVIEWIAAIWFIWQYAEVSGYTAWRSMSFAMTPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N+ +L  LV +QAA+TV+GN T+C AA+ I++ S
Sbjct  62   DNATTLNWLVTVQAAMTVVGNCTVCAAAWWIWRHS  96



>ref|WP_041040154.1| hypothetical protein [Tolypothrix campylonemoides]
 gb|KIJ73442.1| hypothetical protein SD81_28545 [Tolypothrix campylonemoides 
VB511288]
Length=115

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W+YGE +G  +W  LS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIAAIWLIWKYGEVTGNRAWWALSFAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NSESLE LV LQA++T++GN T+  AA  I++S+Q
Sbjct  62   DNSESLEWLVTLQASMTLVGNFTLWAAAVLIWRSNQ  97



>gb|EKD07238.1| hypothetical protein SPLC1_S480060 [Arthrospira platensis C1]
Length=103

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW++A+ L+W YG  +   +W GLS+ M+P L  A CACTWH+F
Sbjct  4    HALSIPTWIIHISSVIEWIVAILLIWSYGVITKNRAWWGLSYAMLPALISAMCACTWHYF  63

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             NS +LE LV LQAA+TV GN T+CIAA+ ++++S+ 
Sbjct  64   DNSPNLEWLVTLQAAMTVTGNFTLCIAAWWLWRTSKS  100



>ref|WP_035759411.1| hypothetical protein [Arthrospira platensis]
Length=101

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW++A+ L+W YG  +   +W GLS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIVAILLIWSYGVITKNRAWWGLSYAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             NS +LE LV LQAA+TV GN T+CIAA+ ++++S+ 
Sbjct  62   DNSPNLEWLVTLQAAMTVTGNFTLCIAAWWLWRTSKS  98



>gb|ABI75121.1| unknown [Cylindrospermopsis raciborskii T3]
 gb|EFA74007.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=131

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
             P NALS+PTW IH+SSVIEWV+A++L+W+YGE +   SW+G + GM+P L  A  ACTW
Sbjct  22   NPMNALSIPTWIIHISSVIEWVVAISLIWKYGELTQNHSWRGFALGMIPALISALSACTW  81

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            H+F N +SLE LV LQA  T+IGN T+  AA  +++S++
Sbjct  82   HYFDNPQSLEWLVTLQATTTLIGNFTLWAAAVWVWRSTR  120



>ref|WP_013322828.1| hypothetical protein [Cyanothece sp. PCC 7822]
 gb|ADN14723.1| Protein of unknown function DUF2499 [Cyanothece sp. PCC 7822]
Length=101

 Score =   118 bits (296),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A  LVW YGE SG   W+  S+ M+P L GA  ACTWHFF
Sbjct  2    HALSIPTWIIHVSSVIEWLAATWLVWTYGEVSGDRVWRVFSYAMLPSLVGALSACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N+ SL+ LV +QA++TV+GN T+C AA+ I++SSQ+
Sbjct  62   DNTPSLDWLVTVQASMTVLGNCTLCAAAWWIWRSSQK  98



>ref|XP_002292481.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90456.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=97

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  AEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACT  474
            +EP NALS+PTW IH SSV E++ AM L+W++ E +    WKGL+WGM+PL      ACT
Sbjct  3    SEPINALSIPTWAIHFSSVFEFLFAMDLIWKFAETTDNPKWKGLTWGMLPLHASGIAACT  62

Query  475  WHFFYNSESLEVLVALQAALTVIGNATMCIAAFRI  579
            +HFFYN  SL+ LV LQA  T++GN T  IAA+RI
Sbjct  63   YHFFYNPSSLQFLVELQAFFTLLGNVTCAIAAYRI  97



>ref|WP_015219196.1| hypothetical protein [Cyanobacterium aponinum]
 gb|AFZ53467.1| Protein of unknown function DUF2499 [Cyanobacterium aponinum 
PCC 10605]
Length=99

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            ++LS+PTW +HVSSVIEW+ A+  VW+YGE SG  SW  L++GM+P L  A CACTWH F
Sbjct  2    HSLSIPTWIVHVSSVIEWIAAIWFVWRYGEVSGDRSWYWLAYGMLPALISAMCACTWHLF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N+ES + LV +QA  TVIGN T+CI A++I++SS
Sbjct  62   DNAESWQWLVTIQALTTVIGNITLCIGAWKIWQSS  96



>ref|WP_015194946.1| Protein of unknown function DUF2499 [Stanieria cyanosphaera]
 gb|AFZ37286.1| Protein of unknown function DUF2499 [Stanieria cyanosphaera PCC 
7437]
Length=100

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +HVSSVIEW+ AM  +W+YGE +G + W GLS+ M+P L  A  ACTWHFF
Sbjct  2    HALSIPTWIVHVSSVIEWIAAMWFIWRYGEITGEKYWYGLSFAMLPALISAMSACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N  SLE LV LQA+ TVIGN T+C+AA+ I++SS +
Sbjct  62   DNLPSLEWLVTLQASTTVIGNCTLCLAAWWIWRSSLQ  98



>ref|WP_006098050.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX78574.1| hypothetical protein MC7420_7227 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=117

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YG+ +G   W  LS  M P L GA CACTWHFF
Sbjct  2    HALSVPTWIIHVSSVIEWIAAIWLIWSYGDITGNRYWWALSCAMFPALVGAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N ESL+ LV LQA++TV+GN T+C AA+ I++ +++
Sbjct  62   DNPESLDWLVTLQASMTVLGNITLCTAAWWIWRCARK  98



>ref|WP_006668179.1| MULTISPECIES: hypothetical protein [Arthrospira]
 gb|EDZ96609.1| conserved hypothetical protein [Arthrospira maxima CS-328]
 emb|CCE18461.1| conserved hypothetical protein (membrane) [Arthrospira sp. PCC 
8005]
 emb|CDM96024.1| conserved hypothetical protein (membrane) [Arthrospira sp. PCC 
8005]
Length=101

 Score =   118 bits (295),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW++A+ L+W YG  +   +W GLS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWLIHISSVIEWIVAILLIWSYGVITENRAWWGLSYAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NS +LE LV LQAA+TV GN T+CIAA+ ++++S+
Sbjct  62   DNSPNLEWLVTLQAAMTVTGNFTLCIAAWWLWRTSK  97



>emb|CBN78627.1| conserved unknown protein [Ectocarpus siliculosus]
Length=206

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP NALS PTW +HVSS+IEW+ AM  VW++ + SG + WKGL+WGM+PL      ACT+
Sbjct  9    EPGNALSFPTWMVHVSSLIEWLAAMTYVWRFADVSGLKEWKGLTWGMLPLHTSGLIACTY  68

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            H FYN+  L  LVA+QA LT  GNATM  A +R++++ ++
Sbjct  69   HIFYNAPELISLVAMQAGLTCFGNATMAFATWRVWQAGKQ  108



>gb|AFZ32651.1| Protein of unknown function DUF2499 [Gloeocapsa sp. PCC 7428]
Length=114

 Score =   118 bits (296),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YGE +   SW  LS  M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIIHVSSVIEWIAAIWLIWTYGEVTRNRSWWALSVAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N+ESLE LV LQA +TV+GN T+ IAA+ I++S+ E
Sbjct  62   DNAESLEWLVTLQATMTVVGNFTLLIAAWLIWRSTTE  98



>ref|WP_016876590.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=115

 Score =   118 bits (296),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW++A+ L+W+YGE +   +W  LS+GM+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVIEWIVAIWLIWRYGELTNNRAWWALSFGMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQA++T++GN T+  AA  I++S++
Sbjct  62   DNAESLEWLVTLQASMTLVGNFTLWAAAVWIWRSTK  97



>ref|WP_026723608.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=115

 Score =   118 bits (296),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IHVSSVIEW++A+ L+WQYGE +G  +W  LS GM+P L  A CACTWHFF
Sbjct  2    HVLSIPTWIIHVSSVIEWIVAIWLIWQYGEVTGNRAWWTLSLGMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESL+ LV LQA +T++GN T+  AA  I+++++
Sbjct  62   ENAESLQWLVTLQATMTLVGNITLWAAAVWIWRNAK  97



>ref|XP_002178947.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49645.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=93

 Score =   117 bits (294),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+ TW IH SSV E++ AM LVW++ E +G E WKGL+WGM+PL     CACT+HFF
Sbjct  1    NALSISTWAIHFSSVFEYLFAMNLVWKFAETTGNERWKGLTWGMLPLHASGICACTYHFF  60

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRI  579
            YN  +L+ LV  QA LT++GN T  IAAFRI
Sbjct  61   YNPAALQFLVTSQAGLTLLGNITCMIAAFRI  91



>ref|WP_035155938.1| hypothetical protein [Calothrix sp. 336/3]
 gb|KFB85071.1| hypothetical protein IJ00_21055 [Calothrix sp. 336/3]
Length=115

 Score =   118 bits (296),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W+YGE +   +W  LSWGM+P L  A CACTWH+F
Sbjct  2    HALSVPTWIIHISSVIEWIAAIWLIWRYGETTNNHAWWALSWGMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  SLE LV LQA +T++GN T+  AAF I++ S 
Sbjct  62   DNVPSLEWLVTLQATMTLVGNFTLWAAAFWIWRQSN  97



>ref|WP_041919403.1| hypothetical protein, partial [Gloeocapsa sp. PCC 7428]
Length=96

 Score =   117 bits (294),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YGE +   SW  LS  M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIIHVSSVIEWIAAIWLIWTYGEVTRNRSWWALSVAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N+ESLE LV LQA +TV+GN T+ IAA+ I++S+
Sbjct  62   DNAESLEWLVTLQATMTVVGNFTLLIAAWLIWRST  96



>ref|WP_039743302.1| hypothetical protein [Hassallia byssoidea]
 gb|KIF35740.1| hypothetical protein PI95_16165 [Hassallia byssoidea VB512170]
Length=114

 Score =   118 bits (295),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W YGE +G  +W  LS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIAAIWLIWTYGEVTGNRTWGALSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQAA+T+IGN T+  AA  I++S++
Sbjct  62   DNAESLEWLVTLQAAMTLIGNFTLWAAAVLIWRSTK  97



>ref|WP_006194744.1| hypothetical protein [Nodularia spumigena]
 gb|EAW46750.1| hypothetical protein N9414_17273 [Nodularia spumigena CCY9414]
 gb|AHJ28131.1| hypothetical protein NSP_17980 [Nodularia spumigena CCY9414]
Length=115

 Score =   118 bits (295),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW++A+ ++W YGE +G  +W GLS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVIEWIVAIWIIWTYGELTGNRTWWGLSLAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ SLE LV LQAA+T+IGN T+  AA  I++S++
Sbjct  62   DNAASLEWLVTLQAAMTLIGNFTLWAAAVLIWRSTK  97



>ref|WP_011320098.1| hypothetical protein [Anabaena variabilis]
 gb|ABA22981.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=102

 Score =   117 bits (294),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            N LS+PTW IHVSSVIEW+ A+ L+W YGE +   SW GLS  M+P L  A CACTWH+F
Sbjct  2    NVLSIPTWIIHVSSVIEWIAAIWLIWTYGELTANRSWWGLSLAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NSESLE +V LQA +T++GN T+  AA+ I++S++
Sbjct  62   DNSESLEWIVTLQATMTLVGNFTLLAAAWLIWRSAK  97



>ref|WP_015213775.1| Protein of unknown function DUF2499 [Anabaena cylindrica]
 gb|AFZ57126.1| Protein of unknown function DUF2499 [Anabaena cylindrica PCC 
7122]
Length=111

 Score =   117 bits (294),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW++A+ L+W YGE +   SW GLS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIVAIWLIWTYGELTKNRSWWGLSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE +V LQAA+T++GN T+  AA  I++S++
Sbjct  62   DNAESLEWIVTLQAAMTLVGNFTLWAAAVWIWRSTK  97



>ref|WP_010998641.1| hypothetical protein [Nostoc sp. PCC 7120]
 dbj|BAB76207.1| all4508 [Nostoc sp. PCC 7120]
Length=102

 Score =   117 bits (293),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            N LS+PTW IHVSSVIEW+ A+ L+W YGE +   SW GLS  M+P L  A CACTWH+F
Sbjct  2    NVLSIPTWIIHVSSVIEWIAAIWLIWTYGELTANRSWWGLSLAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NSESLE +V LQA +T++GN T+  AA+ I++S++
Sbjct  62   DNSESLEWIVTLQATMTLVGNFTLLAAAWLIWRSAK  97



>emb|CEF98693.1| Uncharacterised protein family Ycf49 [Ostreococcus tauri]
Length=441

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW IHVSS++EW+IAM L+W+Y E     +WKGL+WGMVP       ACT+
Sbjct  240  EPANALSLPTWVIHVSSLVEWLIAMGLIWEYSEVIKRPAWKGLTWGMVPCHASGIAACTF  299

Query  478  HFFYNSE-SLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            H FYN++ +L  +VA+QA LTV+GN+T  +AA+RI K  + 
Sbjct  300  HLFYNAQPALSGVVAMQAFLTVVGNSTCALAAYRIAKEGER  340



>ref|WP_030007198.1| hypothetical protein [Synechococcus sp. NKBG042902]
Length=103

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS PTW +H+SSV+EW++A+ L+  YG  +  +SW  L+WGM+P L  A CACTWHFF
Sbjct  2    NALSFPTWIVHISSVLEWILAIWLIQTYGNLTQDKSWSALAWGMLPSLVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKS  588
             N+ SLE LV +QAALT++GN T+C+ A+ I++S
Sbjct  62   DNAPSLEWLVTIQAALTLVGNCTLCLGAWWIWRS  95



>ref|XP_003080291.1| Nuclear pore complex component (sc Seh1) (ISS) [Ostreococcus 
tauri]
Length=409

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EPANALSLPTW IHVSS++EW+IAM L+W+Y E     +WKGL+WGMVP       ACT+
Sbjct  208  EPANALSLPTWVIHVSSLVEWLIAMGLIWEYSEVIKRPAWKGLTWGMVPCHASGIAACTF  267

Query  478  HFFYNSE-SLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            H FYN++ +L  +VA+QA LTV+GN+T  +AA+RI K  + 
Sbjct  268  HLFYNAQPALSGVVAMQAFLTVVGNSTCALAAYRIAKEGER  308



>ref|WP_012406884.1| hypothetical protein [Nostoc punctiforme]
 gb|ACC78855.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=111

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IH+SSVIEW++A+ L+W YGE +   +W GLS  M+P L  A CACTWH+F
Sbjct  2    HTLSIPTWIIHISSVIEWIVAIWLIWTYGELTNNRNWWGLSLAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQA +T++GN T+  AAF I++S++
Sbjct  62   DNAESLEWLVTLQATMTLVGNFTLWAAAFLIWRSTK  97



>ref|WP_015083349.1| MULTISPECIES: hypothetical protein [Nostocaceae]
 gb|AFW96794.1| hypothetical protein ANA_C20349 [Anabaena sp. 90]
 gb|KHG42856.1| hypothetical protein OA07_02630 [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=111

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W YGE +   SW GLS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIAAIWLIWIYGELTENRSWWGLSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NSESLE LV LQA +T++GN T+  AA+ I++S++
Sbjct  62   DNSESLEWLVTLQATMTLVGNFTLWAAAYLIWRSTK  97



>ref|WP_026787189.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=101

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW++A+  +W YGE +   +W GLS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWVIHISSVIEWIVAIWFIWIYGEVTQNRAWWGLSFAMLPSLVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N  SLE LV LQA +TV+GN T+C+AA+ I++++  
Sbjct  62   DNPASLEWLVTLQATMTVVGNTTLCVAAWWIWRNANS  98



>ref|WP_006515723.1| Protein of unknown function (DUF2499) [Leptolyngbya sp. PCC 7375]
 gb|EKV01326.1| Protein of unknown function (DUF2499) [Leptolyngbya sp. PCC 7375]
Length=98

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +H+SSVIEW+ A+  VWQ+ + +G+ +WK LS+GM+P L  A CACTWHFF
Sbjct  2    HALSIPTWMVHISSVIEWIAAIYFVWQFADVTGWPAWKWLSFGMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NS SL  LV LQA++T++GN T C AA+ I++ ++
Sbjct  62   DNSPSLSWLVILQASMTMVGNCTACAAAWYIWRQAR  97



>ref|WP_023073811.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
 gb|ESA35486.1| hypothetical protein N836_12330 [Leptolyngbya sp. Heron Island 
J]
Length=98

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +H+SSVIEW+ A+  VWQ+ + SG+ +WK LS+GM+P L  A CACTWH F
Sbjct  2    HALSIPTWMVHISSVIEWIAAIYFVWQFADVSGWSAWKWLSFGMLPALISAMCACTWHLF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NS +L  LV LQA +TV+GN T+C AA+ I++ ++
Sbjct  62   DNSPNLSWLVILQATMTVVGNCTVCAAAWHIWRQAR  97



>ref|WP_012307040.1| hypothetical protein [Synechococcus sp. PCC 7002]
 gb|ACA99417.1| conserved hypothetical membrane protein [Synechococcus sp. PCC 
7002]
Length=103

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS PTW +H+SSV+EW++A+ L+  YG  +  +SW  L+WGM+P L  A CACTWHFF
Sbjct  2    NALSFPTWIVHISSVLEWILAIWLIQTYGNLTQDKSWSALAWGMLPSLVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKS  588
             N+ SLE LV +QAALT++GN T+C+ A+ I++S
Sbjct  62   DNAPSLEWLVTIQAALTLLGNCTLCLGAWWIWRS  95



>ref|WP_006617978.1| hypothetical protein [Arthrospira platensis]
 dbj|BAI93528.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR55366.1| hypothetical protein APPUASWS_023735 [Arthrospira platensis str. 
Paraca]
Length=101

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW++A+ L+W YG  +   +W GLS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIVAIGLIWSYGVITENRAWWGLSYAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  +LE LV LQAA+TV GN T+CIAA+ ++++S+
Sbjct  62   DNPPNLEWLVTLQAAMTVTGNFTLCIAAWWLWRTSK  97



>ref|WP_016859353.1| hypothetical protein [Fischerella muscicola]
Length=115

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IHVSSVIEW++A+ L+WQYGE +G  +W  LS GM+P L  A CACTWH+F
Sbjct  2    HVLSIPTWIIHVSSVIEWIVAIWLIWQYGEVTGNRAWWTLSLGMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESL+ LV LQA +T++GN T+  AA  I+++++
Sbjct  62   ENAESLQWLVTLQATMTLVGNITLWAAAVWIWRNAK  97



>ref|WP_024547105.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=103

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS PTW +H+SSV EW++A+ L+  YG+ +  +SW  L+WGM+P L  A CACTWHFF
Sbjct  2    NALSFPTWIVHISSVFEWILAIWLIQTYGQLTQDKSWTALAWGMLPSLVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKS  588
             N  SLE LV +QAALT++GN T+C+ A+ I++S
Sbjct  62   DNDPSLEWLVTVQAALTLVGNCTLCLGAWWIWRS  95



>ref|WP_029637726.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=114

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IHVSSVIEW+ A+ L+W YGE +G  +W  LS+ M+P L  A CACTWH+F
Sbjct  2    HVLSIPTWIIHVSSVIEWIAAIWLIWTYGEVTGNRTWGTLSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQAA+T+IGN T+  AA  I++S++
Sbjct  62   DNAESLEWLVTLQAAMTLIGNFTLWAAAVLIWRSTK  97



>ref|WP_042151144.1| hypothetical protein [Planktothrix agardhii]
 gb|KEI65379.1| hypothetical protein A19Y_0132 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=101

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW++A+  +W YGE +   +W GLS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWVIHISSVIEWIVAIWFIWIYGEVTQNRAWWGLSLAMLPSLVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N  SLE LV LQA +TV+GN T+C+AA+ I++++  
Sbjct  62   DNPASLEWLVTLQATMTVVGNTTLCVAAWWIWRNANS  98



>ref|WP_015170426.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 gb|AFY64858.1| Protein of unknown function DUF2499 [Geitlerinema sp. PCC 7407]
Length=101

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW IHVSSV+EW  A+ L+W YG+ SG  +W+ LS+ M+P L  A CACTWHFF
Sbjct  2    NALSIPTWIIHVSSVLEWAAAIWLIWTYGDVSGNRAWRSLSFAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  +LE LV LQA++TV+GN T+  AA+ I++S +
Sbjct  62   DNPPTLEWLVTLQASMTVLGNCTLMAAAWWIWRSRK  97



>ref|XP_003060626.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55395.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=91

 Score =   115 bits (289),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALSLPTW IHVSS+IEW++AM L+W+Y + SG  ++KGL+WGM+P       ACT+H F
Sbjct  1    NALSLPTWVIHVSSLIEWLVAMGLIWEYADVSGKRAYKGLTWGMIPGHASGIAACTFHLF  60

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRI  579
            YN+  L  +VA QA LTV GN T+ IAA+ I
Sbjct  61   YNAPVLSAVVATQAGLTVFGNVTLAIAAYHI  91



>gb|KIE11074.1| hypothetical protein DA73_0221920 [Tolypothrix bouteillei VB521301]
Length=115

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSV+EW+ A+ L+W+YGE +G  +W  LS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVVEWIAAIWLIWKYGEVTGNRAWGALSFAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N++SLE LV LQA +T++GN T+  AAF I++S +
Sbjct  62   DNAQSLEWLVTLQATMTLVGNFTLWAAAFWIWRSYR  97



>ref|WP_008184715.1| hypothetical protein [Moorea producens]
 gb|EGJ32477.1| protein of unknown function, DUF2499 [Moorea producens 3L]
Length=96

 Score =   115 bits (289),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W YGE +G  +W  LS+ M+P L  A CA TWHFF
Sbjct  2    HALSIPTWIIHISSVIEWIAAIWLIWTYGEITGNRAWWALSFAMLPALVSAMCAITWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N +SLE +V LQAA+TV+GN T+C AA+ I++S+
Sbjct  62   DNQQSLEWMVTLQAAMTVVGNCTLCGAAWWIWRSA  96



>ref|WP_040553261.1| hypothetical protein [Raphidiopsis brookii]
Length=108

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW IH+SSVIEWV+A++L+W+YGE +   SW+G + GM+P L  A  ACTWH+F
Sbjct  2    NALSIPTWIIHISSVIEWVVAISLIWKYGELTQNHSWRGFALGMIPALISALSACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N +SLE LV LQA  T+IGN T+  AA  +++S++
Sbjct  62   DNPQSLEWLVTLQATTTLIGNFTLWAAAVWVWRSTR  97



>ref|WP_033334577.1| hypothetical protein [Scytonema hofmanni]
Length=116

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W+YGE +G   W  LS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIAAIWLIWKYGEVTGNRVWGALSFAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N++SLE LV LQA +T++GN T+  AAF I++S Q
Sbjct  62   DNAKSLEWLVTLQATMTLVGNFTLWAAAFWIWRSYQ  97



>ref|WP_011429044.1| hypothetical protein [Synechococcus sp. JA-3-3Ab]
 gb|ABC98352.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
Length=108

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS PTW IH++SV+EW+ A+  VWQ+GE++G   W+GLSW M+P L GA CA TWH+F
Sbjct  2    HALSFPTWWIHIASVLEWLAAIVCVWQFGERTGRPEWRGLSWAMLPALVGAMCAITWHWF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  +L  +V  QA+LT++GN T+  AA+RI+++ Q
Sbjct  62   DNDPALNWVVTAQASLTLLGNCTLAWAAYRIWRAEQ  97



>ref|WP_040933950.1| hypothetical protein [Prochloron didemni]
Length=106

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +H SSVIEW+ A+  VW YGE +G   W GL+  M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIVHTSSVIEWIGAIWFVWIYGEVTGDRYWWGLACAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             NS SLE LV LQA +TV+GN T+CIAA+ I++++  
Sbjct  62   ENSTSLEWLVTLQAWMTVLGNCTLCIAAWWIWRTTNN  98



>ref|WP_015127947.1| hypothetical protein [Calothrix sp. PCC 7507]
 gb|AFY32129.1| Protein of unknown function DUF2499 [Calothrix sp. PCC 7507]
Length=107

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YGE +   +W GLS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVIEWIAAIWLIWTYGELTSNRTWWGLSLAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N++SLE LV LQA +T++GN TM  AA  I++S+Q
Sbjct  62   DNAQSLEWLVTLQATMTLVGNFTMWAAAVWIWRSAQ  97



>ref|WP_027844409.1| hypothetical protein [Mastigocoleus testarum]
Length=106

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W+YGE +G  SW  LS  M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIIHVSSVIEWIAAIWLIWEYGEITGNRSWWTLSLAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+E LE LV LQA++T++GN T+ +A++ I+++S+
Sbjct  62   DNAEFLEWLVILQASMTLLGNFTLLVASWWIWRASK  97



>gb|KIJ83175.1| hypothetical protein SD80_16405 [Scytonema tolypothrichoides 
VB-61278]
Length=115

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            N LS+PTW IHVSSVIEW++A+  +W+YGE +G  +W  LS+ M+P L  A CACTWH+F
Sbjct  2    NVLSIPTWIIHVSSVIEWIVAIWFIWKYGEVTGNRAWWALSFAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N ESLE LV LQA++T++GN T+  AA  I++S++
Sbjct  62   DNLESLEWLVTLQASMTLLGNFTLWAAAVWIWRSTK  97



>ref|WP_011434313.1| hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03696.1| putative membrane protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=108

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALSLPTW IH++SV+EW+ A+ LVWQ+GE+ G   W+ LSW M+P L GA CA TWH+F
Sbjct  2    HALSLPTWWIHIASVLEWIAAIVLVWQFGERVGQPEWRSLSWAMLPALSGAMCAITWHWF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N   L+ +V  QA+ T++GN T+  AA+RI+++ +
Sbjct  62   DNDPKLDWVVTAQASFTLLGNCTLAWAAYRIWRAER  97



>ref|WP_017321733.1| hypothetical protein [cyanobacterium PCC 7702]
Length=110

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YGE +   +W+ LS GM+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVIEWIAAIWLIWTYGELTKNRTWRTLSLGMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N++SLE LV LQA +TVIGN T+  AA  I++S+
Sbjct  62   DNAKSLEWLVTLQATMTVIGNFTLWAAAVWIWRST  96



>ref|WP_017654829.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=114

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YGE +   +W GLS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVIEWISAIWLIWTYGELTNNRTWWGLSLAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQA  T+IGN T+  AA  I++S+Q
Sbjct  62   DNAESLEWLVTLQATTTLIGNFTLLAAAVWIWRSAQ  97



>ref|WP_013191627.1| hypothetical protein [Trichormus azollae]
 gb|ADI64611.1| Protein of unknown function DUF2499 ['Nostoc azollae' 0708]
Length=111

 Score =   115 bits (288),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+ L+W YGE +   SW GLS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVIEWIAAIWLIWIYGELTKNRSWWGLSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQA +T++GN T+  AA  I++S++
Sbjct  62   DNAESLEWLVTLQATMTLVGNFTLWAAAVWIWRSTK  97



>ref|WP_027254858.1| hypothetical protein [Planktothrix agardhii]
Length=101

 Score =   115 bits (287),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSV EW++A+  +W YGE +   +W GLS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWVIHISSVTEWIVAIWFIWIYGEVTQNRAWWGLSFAMLPSLVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N  SLE LV LQA +TV+GN T+C+AA+ I++++  
Sbjct  62   DNPASLEWLVTLQATMTVVGNTTLCVAAWWIWRNANS  98



>ref|WP_015114395.1| hypothetical protein [Nostoc sp. PCC 7107]
 gb|AFY44190.1| Protein of unknown function DUF2499 [Nostoc sp. PCC 7107]
Length=115

 Score =   115 bits (288),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W YGE +G   W GLS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIAAIWLIWIYGELTGNRRWWGLSLAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQA +T++GN T+  AA  I++S++
Sbjct  62   DNAESLEWLVTLQATMTLVGNFTLWAAAVWIWRSTK  97



>gb|EFA70731.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=127

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
             P NALS+PTW IH+SSVIEWV+A++L+W+YGE +   SW+G +  M+P L  A  ACTW
Sbjct  18   NPMNALSIPTWIIHISSVIEWVVAISLIWKYGELTQNHSWRGFALAMIPALISALSACTW  77

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            H+F N +SLE LV LQA  T+IGN T+  AA  ++ S++
Sbjct  78   HYFDNPQSLEWLVTLQATTTLIGNFTLWAAAVWVWHSTR  116



>ref|WP_036004879.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=101

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW++A+ L+W Y E  G  +W+ LS  M+P L  A CACTWH F
Sbjct  2    HALSIPTWVIHISSVIEWIVAIWLIWIYSEVKGNPAWRMLSLAMLPALISAMCACTWHLF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+  LE LV LQAA+T++GN T+C A + I++S+Q
Sbjct  62   DNAPELEWLVTLQAAMTLVGNITLCAAGWWIWRSTQ  97



>ref|WP_027403771.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=111

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IH+SSVIEW+ A+ L+W YGE +   SW GLS+ M+P L  A CACTWH+F
Sbjct  2    HVLSIPTWIIHISSVIEWIAAIWLIWIYGELTENRSWWGLSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NSESLE LV LQA +T++GN T+  AA+ I++S++
Sbjct  62   DNSESLEWLVNLQATMTLVGNFTLWAAAYVIWRSTK  97



>ref|WP_017294734.1| hypothetical protein [Geminocystis herdmanii]
Length=103

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            ++LS+PTW +HVSSVIEW+ A+  VW+YGE +   SW  L++GM+P L  A CACTWH F
Sbjct  2    HSLSIPTWIVHVSSVIEWIAAIWFVWRYGEVTKDSSWYWLAYGMLPALISAMCACTWHLF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N+ES E LV +QA  TVIGN T+C+ A++I++SS
Sbjct  62   DNAESWEWLVTIQALTTVIGNITLCLGAWKIWQSS  96



>ref|WP_040483484.1| hypothetical protein [Lyngbya aestuarii]
Length=101

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSV+EW+ A+  +W+YGE +  ++W GLS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVLEWMAAIWFIWRYGEVTQNKAWWGLSVAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKS  588
             N  S E +V LQAA+TV+GN T+CIAA+ I++S
Sbjct  62   DNPPSFEWMVTLQAAMTVLGNVTLCIAAWYIWRS  95



>ref|WP_015208941.1| Protein of unknown function (DUF2499) [Cylindrospermum stagnale]
 gb|AFZ25693.1| Protein of unknown function (DUF2499) [Cylindrospermum stagnale 
PCC 7417]
Length=112

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W YGE +G  SW  LS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIAAIWLIWTYGELTGNRSWWALSLAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE +V LQA +T++GN T+  AA  I++S++
Sbjct  62   DNAESLEWMVTLQATMTLVGNFTLWAAAVWIWRSTK  97



>ref|WP_009454032.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC19471.1| Protein of unknown function DUF2499 [Fischerella sp. JSC-11]
Length=115

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IHVSSVIEW+ A+ L+WQYGE +G  +W  LS  M+P L  A CACTWH+F
Sbjct  2    HVLSIPTWIIHVSSVIEWIAAIWLIWQYGEVTGNRAWWTLSLAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQA +T++GN T+  AA  I+++++
Sbjct  62   ENAESLEWLVTLQATMTLVGNITLWAAAVWIWRNAK  97



>ref|WP_016867562.1| hypothetical protein [Fischerella muscicola]
Length=115

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IHVSSVIEW+ A+ L+WQYGE +G  +W  LS  M+P L  A CACTWH+F
Sbjct  2    HVLSIPTWIIHVSSVIEWIAAIWLIWQYGEVTGNRAWWTLSLAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESLE LV LQA +T++GN T+  AA  I+++++
Sbjct  62   ENAESLEWLVTLQATMTLVGNITLWAAAVWIWRNAK  97



>ref|WP_009787179.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW34275.1| hypothetical protein L8106_24185 [Lyngbya sp. PCC 8106]
Length=101

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSV+EW+ A+  +W+YGE +  ++W GLS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVLEWMAAIWFIWRYGEVTQNKAWWGLSVAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKS  588
             N  S E +V LQAA+TV+GN T+CIAA+ I++S
Sbjct  62   DNPPSFEWMVTLQAAMTVLGNITLCIAAWYIWRS  95



>ref|WP_011141874.1| hypothetical protein [Gloeobacter violaceus]
 ref|NP_924822.1| hypothetical protein glr1876 [Gloeobacter violaceus PCC 7421]
 dbj|BAC89817.1| glr1876 [Gloeobacter violaceus PCC 7421]
Length=104

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
             ALSLPTW IH++SV+EW +A+ALVW+Y E++G  S++ L WGM+P L GA     WH+F
Sbjct  2    QALSLPTWIIHIASVVEWTLAIALVWRYAERTGERSFRALCWGMLPALVGAMAVLVWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N   L  L  LQAA+T++GNAT+  AA+ IY+S++ 
Sbjct  62   DNRPELAYLGQLQAAMTLLGNATLAFAAYLIYRSARR  98



>ref|WP_009634070.1| Protein of unknown function (DUF2499) [Synechocystis sp. PCC 
7509]
Length=115

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEWV A+ L+W YGE +   SW  LS+ M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIIHISSVIEWVSAIWLIWLYGEATKNRSWFALSFAMLPALISAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ SLE LV LQAA+T+IGN T+  A + I+++S+
Sbjct  62   DNTTSLEWLVTLQAAMTLIGNCTLLAAGWWIWRTSK  97



>ref|XP_003056237.1| hypothetical protein MICPUCDRAFT_71043 [Micromonas pusilla CCMP1545]
 gb|EEH59613.1| hypothetical protein MICPUCDRAFT_71043 [Micromonas pusilla CCMP1545]
Length=623

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = +1

Query  301  PANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWH  480
            PANALS+PTW +HV S++EW++AM LVW Y + SG   W+ L+WGM+PL     CA T H
Sbjct  364  PANALSVPTWGVHVFSLVEWLVAMGLVWDYADVSGEPGWRKLTWGMLPLHASGVCAVTQH  423

Query  481  FFYNSESLEVLVALQAALTVIGNATMCIAAFRI  579
            FF+N + LE LVA Q ALT+IGNA MC AA  +
Sbjct  424  FFFNGDDLEWLVAAQGALTMIGNAGMCYAAVEL  456



>ref|XP_002504984.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66242.1| predicted protein [Micromonas sp. RCC299]
Length=478

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +1

Query  289  QFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCA  468
            + AEPANALSLPTW IHVSS+IEW++AM L+W+Y + +G + +KGL+WGMVP       A
Sbjct  248  RHAEPANALSLPTWVIHVSSLIEWLVAMGLIWEYADATGNQKYKGLTWGMVPCHASGIAA  307

Query  469  CTWHFFYNSESLEVLVALQAALTVIGNAT  555
            CT+H FYNS +L  +VA QA LTV+GN T
Sbjct  308  CTFHLFYNSPALNSVVATQAGLTVLGNTT  336



>ref|WP_028085489.1| hypothetical protein [Dolichospermum circinale]
Length=111

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IH+SSVIEW+ A+ L+W YGE +   SW GLS+ M+P L  A CACTWH+F
Sbjct  2    HVLSIPTWIIHISSVIEWITAIWLIWIYGELTKNRSWWGLSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NS++LE LV LQA +T++GN T+  AA+ I++S++
Sbjct  62   DNSQTLEWLVTLQATMTLVGNFTLWAAAYIIWRSTK  97



>ref|WP_039727288.1| MULTISPECIES: hypothetical protein [Oscillatoriophycideae]
 gb|KIF15268.1| hypothetical protein QP59_32995 [Aphanocapsa montana BDHKU210001]
 gb|KIF40183.1| hypothetical protein QQ91_25885 [Lyngbya confervoides BDU141951]
Length=105

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +H++SV+EW+ A+  +W +   +G+ +W+ LS+GM+P L  A CACTWHFF
Sbjct  2    HALSIPTWVVHITSVVEWIAAIWFIWVFAGVTGHTAWRALSFGMLPSLISAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ESL  LV LQA +TV+GN+T C+AA+ I++ ++
Sbjct  62   DNAESLSWLVTLQAGMTVVGNSTACLAAWWIWRQAK  97



>ref|WP_028091019.1| hypothetical protein [Dolichospermum circinale]
Length=111

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IH+SSVIEW+ A+ L+W YGE +   SW GLS+ M+P L  A CACTWH+F
Sbjct  2    HVLSIPTWIIHISSVIEWITAIWLIWIYGELTQNRSWWGLSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NS++LE LV LQA +T++GN T+  AA+ I++S++
Sbjct  62   DNSQTLEWLVTLQATMTLVGNFTLWAAAYIIWRSTK  97



>ref|WP_017315121.1| hypothetical protein [Mastigocladopsis repens]
Length=113

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IH+SSVIEW+ A+ L+W+YGE +   +W  LS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHISSVIEWIAAIWLIWKYGEVTANHAWWALSFAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N ESLE +V LQAA+T++GN T+  AA  I++S+ 
Sbjct  62   DNPESLEWMVTLQAAMTLVGNFTLWAAAVLIWRSTN  97



>ref|WP_041462416.1| hypothetical protein [Chroococcidiopsis thermalis]
Length=110

 Score =   112 bits (281),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW IA+ L+W YGE  G  +W  +S  M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIIHVSSVIEWAIAIWLIWSYGEVVGNRAWYAVSLAMLPALISAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N++SLE LV LQA++T+IGN T+  A + +++S++ 
Sbjct  62   DNAKSLEWLVMLQASMTLIGNFTLLAAGWLLWRSTRS  98



>ref|WP_019487416.1| MULTISPECIES: hypothetical protein [Kamptonema]
Length=101

 Score =   112 bits (280),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IH+SSVIEW+ A+  +W YGE S   +W  LS+GM+P L GA CACTWH+F
Sbjct  2    HTLSIPTWIIHISSVIEWIAALWFIWIYGEVSQNRAWWALSFGMLPALVGAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  SLE LV +QAA+T+IGN T+  AA+ I++S+Q
Sbjct  62   DNLPSLEWLVTVQAAMTLIGNFTLWAAAWWIWRSAQ  97



>ref|WP_017327899.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=104

 Score =   112 bits (280),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALSLPTW IH++SV+EW+ A+ LVW++   +G  +W+GL+W M+P L GA  A TWHFF
Sbjct  2    NALSLPTWFIHIASVVEWIAAIFLVWRFATVTGQRAWRGLAWAMLPALAGAMSALTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             NS  L+ +V LQA+LT++GN T+ +AA  I+  S++
Sbjct  62   DNSPELDWIVTLQASLTLMGNCTLALAAGSIWYQSRQ  98



>ref|WP_026732434.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=114

 Score =   112 bits (281),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW+ A+  +W+YGE +   +W  LS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVIEWIAAIWFIWKYGEVTSNRAWWTLSVAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N++SLE LV LQAA+TV+GN T+  AA  I++S++
Sbjct  62   DNAKSLEWLVTLQAAMTVVGNCTLWAAAVWIWRSTK  97



>ref|XP_002507924.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO69182.1| predicted protein, partial [Micromonas sp. RCC299]
Length=95

 Score =   112 bits (279),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW +HV S++EW++AM LVW+Y   SG + W+ L+WGM+PL     CAC  HFF
Sbjct  1    NALSVPTWGVHVFSLVEWLVAMGLVWEYAAASGVKEWRWLTWGMLPLHASGVCACVQHFF  60

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
            +N+  LE LV  Q ALT+ GNA MC AA ++ + S
Sbjct  61   FNAADLEWLVTAQGALTMAGNAGMCAAAGKLARRS  95



>ref|WP_015200012.1| hypothetical protein [Calothrix parietina]
 gb|AFZ03395.1| Protein of unknown function DUF2499 [Calothrix sp. PCC 6303]
Length=107

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            ++LS+PTW IH+SSVIEW+ A+ L+W YG+ +   SW  LS+GM+P L  A CACTWH+F
Sbjct  2    HSLSIPTWIIHISSVIEWITAIWLIWTYGKLTQNHSWYALSFGMLPSLISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             NS SLE +V LQAA+TV+GN T+  AA+ I+ SS +
Sbjct  62   DNSPSLEWVVTLQAAMTVVGNFTLFAAAWFIWYSSTQ  98



>ref|WP_040008386.1| hypothetical protein [Cylindrospermopsis raciborskii]
Length=108

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW IH+SSVIEWV+A++L+W+YGE +   SW+G +  M+P L  A  ACTWH+F
Sbjct  2    NALSIPTWIIHISSVIEWVVAISLIWKYGELTQNHSWRGFALAMIPALISALSACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N +SLE LV LQA  T+IGN T+  AA  ++ S++
Sbjct  62   DNPQSLEWLVTLQATTTLIGNFTLWAAAVWVWHSTR  97



>ref|XP_001418680.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96973.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=91

 Score =   111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALSLPTW IHVSS++EW+IAM L W+Y E +   +WKGL+ GM+P       ACT+H F
Sbjct  1    NALSLPTWVIHVSSLVEWLIAMGLAWEYAEVTKRPAWKGLTLGMIPCHASGIAACTFHLF  60

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRI  579
            YN+ +L  +VA+QA LTV+GN T  +A++RI
Sbjct  61   YNAPALNSVVAMQALLTVVGNTTCALASYRI  91



>gb|AFY87383.1| Protein of unknown function DUF2499 [Chroococcidiopsis thermalis 
PCC 7203]
Length=149

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW IA+ L+W YGE  G  +W  +S  M+P L  A CACTWHFF
Sbjct  41   HALSIPTWIIHVSSVIEWAIAIWLIWSYGEVVGNRAWYAVSLAMLPALISAMCACTWHFF  100

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N++SLE LV LQA++T+IGN T+  A + +++S++ 
Sbjct  101  DNAKSLEWLVMLQASMTLIGNFTLLAAGWLLWRSTRS  137



>ref|WP_037220436.1| hypothetical protein [Richelia intracellularis]
 emb|CDN13482.1| hypothetical protein RintRC_4419 [Richelia intracellularis]
Length=122

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW++A+ L+W YGE +   +W  LS+ M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVIEWIVAIWLIWDYGEVTNNHNWSALSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N  SL+ LV LQA+ T+ GN T+  AAF I++SS+
Sbjct  62   DNPTSLKWLVTLQASTTLFGNFTLWGAAFWIWRSSR  97



>ref|WP_039715707.1| hypothetical protein [Scytonema millei]
 gb|KIF18164.1| hypothetical protein QH73_33490 [Scytonema millei VB511283]
Length=110

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IHVSSVIEW IA+ L+W YGE  G  +W   S  M+P L  A CACTWHFF
Sbjct  2    HVLSIPTWIIHVSSVIEWAIAIWLIWSYGEAVGNRAWYAFSLAMLPALISAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N++SLE LV LQA++T+IGN T+  A + +++S++ 
Sbjct  62   DNAQSLEWLVTLQASMTLIGNFTLLAAGWLLWRSTRS  98



>ref|WP_006632397.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK88590.1| Protein of unknown function DUF2499 [Microcoleus vaginatus FGP-2]
Length=104

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSV+EW+ A+ L+W YGE +   +W  LS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVVEWIAAIWLIWTYGEVTQNRAWWALSAAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NS +LE +V LQAA+T+IGN T+  AA+ I++S+Q
Sbjct  62   DNSPALEWIVTLQAAMTLIGNFTLWAAAWWIWRSAQ  97



>ref|WP_040654637.1| hypothetical protein, partial [Rubidibacter lacunae]
Length=97

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW +H+SSVIEW  A+  VW++GE +G   W  L+WGM+P L  A CA TWHFF
Sbjct  2    HVLSIPTWIVHISSVIEWAAAIWFVWRFGELTGDRDWFWLAWGMLPALVSAMCAVTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ +L  LV +QAA TV+GN T+C AA+ I++ ++
Sbjct  62   DNAPTLSWLVTMQAAFTVVGNVTLCAAAWWIWRGTR  97



>ref|WP_019493343.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=101

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW IHVSSVIEW+ A+ L+W YGE +  ++W G S+ M+P L  A CACTWH+F
Sbjct  2    HVLSIPTWIIHVSSVIEWIAAIWLIWTYGELTQNKAWWGFSFAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             NS +L  LV LQA++TV+GN T+ IAAF I++ S+ 
Sbjct  62   DNSPALGWLVTLQASMTVLGNFTLFIAAFWIWRQSRS  98



>ref|WP_009556121.1| Protein of unknown function (DUF2499) [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ69209.1| Protein of unknown function (DUF2499) [Oscillatoriales cyanobacterium 
JSC-12]
Length=99

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+P W IHVSSVIEW+ A+ L+W YGE +    W  LS+ M+P L  A CACTWHFF
Sbjct  2    NALSIPNWIIHVSSVIEWIAAIWLIWIYGEITNQRYWWALSFAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N  SL+ LV LQAA+TV+GN T+ +A + I+K +
Sbjct  62   DNPASLDWLVTLQAAMTVVGNVTLMMAGWWIWKQT  96



>ref|WP_006511613.1| Protein of unknown function (DUF2499) [Xenococcus sp. PCC 7305]
 gb|ELS01232.1| Protein of unknown function (DUF2499) [Xenococcus sp. PCC 7305]
Length=101

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +HVSSVIEW+ A+  +W+YGE +    W  LS+ M+P L  A CACTWHFF
Sbjct  2    HALSIPTWIVHVSSVIEWIAAIWFIWRYGEVTRDRDWWVLSFAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N E LE LV +QA +TV GN T+C+A + IY++  +
Sbjct  62   DNVEYLEWLVTVQALMTVAGNVTLCLAGWWIYRNRSK  98



>ref|WP_012954329.1| hypothetical protein [Candidatus Atelocyanobacterium thalassa]
 gb|ADB95642.1| Protein of unknown function (DUF2499) [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=110

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +1

Query  313  LSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYN  492
            LS+PTW IH++SV EW+IA+ LVW Y E S    WK LS  M+P L  A CAC WHFF N
Sbjct  4    LSIPTWMIHIASVTEWIIAIWLVWTYSEVSNKNYWKFLSVAMLPSLASASCACLWHFFDN  63

Query  493  SESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            S SL+ LV +QAALT++GN+T+C+A   I+ +SQ
Sbjct  64   SPSLDWLVTIQAALTLLGNSTLCLAGRHIFLNSQ  97



>gb|ERN43101.1| protein of unknown function (DUF2499) [Rubidibacter lacunae KORDI 
51-2]
Length=121

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            + LS+PTW +H+SSVIEW  A+  VW++GE +G   W  L+WGM+P L  A CA TWHFF
Sbjct  2    HVLSIPTWIVHISSVIEWAAAIWFVWRFGELTGDRDWFWLAWGMLPALVSAMCAVTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ +L  LV +QAA TV+GN T+C AA+ I++ ++
Sbjct  62   DNAPTLSWLVTMQAAFTVVGNVTLCAAAWWIWRGTR  97



>ref|XP_009032125.1| hypothetical protein AURANDRAFT_7066, partial [Aureococcus anophagefferens]
 gb|EGB12878.1| hypothetical protein AURANDRAFT_7066, partial [Aureococcus anophagefferens]
Length=98

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            +  AEP NALS PTW IH SS++EW++AM L W+Y E S   +W+G++WGM+PL      
Sbjct  1    LDVAEPPNALSAPTWAIHTSSLVEWLVAMGLAWRYAEASATPAWRGVTWGMLPLHTSGIV  60

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRI  579
            AC +H FYN+  L   VALQA  T +GN T+  A +R+
Sbjct  61   ACCYHLFYNAPDLAWCVALQAGCTCLGNTTLAFACYRL  98



>ref|WP_015224239.1| hypothetical protein [Halothece sp. PCC 7418]
 gb|AFZ42361.1| Protein of unknown function DUF2499 [Halothece sp. PCC 7418]
Length=102

 Score =   110 bits (274),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +HVSSV EW++A+ L+W+YGE +G + W GLS  M P L  A CA TWH+F
Sbjct  2    HALSIPTWIVHVSSVAEWILAIWLIWRYGEITGEKKWWGLSLAMFPALISAMCAVTWHWF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+E+L+ LV +QA  T++GN T+C AA+ I+++++
Sbjct  62   DNAEALDWLVIMQAGTTLLGNTTLCAAAWWIWRTAE  97



>ref|WP_015176609.1| Protein of unknown function DUF2499 [Oscillatoria nigro-viridis]
 gb|AFZ07327.1| Protein of unknown function DUF2499 [Oscillatoria nigro-viridis 
PCC 7112]
Length=103

 Score =   109 bits (273),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSV+EW+ A+ L+W YGE +   +W  LS  M+P L  A CACTWH+F
Sbjct  2    HALSIPTWIIHVSSVVEWIAAIWLIWTYGEVTQNRAWWALSAAMLPALVSAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NS +LE +V LQAA+T+ GN T+  AA+ I++S+Q
Sbjct  62   DNSPALEWIVTLQAAMTLFGNFTLWAAAWWIWRSAQ  97



>ref|WP_012162283.1| hypothetical protein [Acaryochloris marina]
 gb|ABW26768.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=102

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW++A+ L+W Y E S   +W+  S  M+P L GA CACTWHFF
Sbjct  2    HALSIPTWIIHVSSVIEWIMAIWLIWTYSEVSQNPTWRWFSLAMLPALVGAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N   LE LV LQA++TV+GN T+C  A  ++   Q
Sbjct  62   DNPVELEWLVTLQASMTVLGNTTLCGVAALLWSQRQ  97



>ref|WP_010477841.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=102

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW IHVSSVIEW++A+ L+W Y E S   +W+  S  M+P L GA CACTWHFF
Sbjct  2    HALSIPTWIIHVSSVIEWIMAIWLIWTYSEVSQNPTWRWFSLAMLPALVGAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N   LE LV LQA++TV+GN T+C  A  ++   Q
Sbjct  62   DNPVELEWLVTLQASMTVLGNVTLCGVAALLWSQRQ  97



>ref|WP_015169586.1| hypothetical protein [Synechococcus sp. PCC 7502]
 gb|AFY74935.1| Protein of unknown function (DUF2499) [Synechococcus sp. PCC 
7502]
Length=103

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGY--ESWKGLSWGMVPLLGGAFCACTWH  480
            N LSLPTW IH+SSV+EWVIA+ L+W + +      + WKGL+ GMVP L  A CACTWH
Sbjct  2    NVLSLPTWIIHISSVLEWVIAIWLIWNHSKMQPQVAKEWKGLALGMVPALVSAMCACTWH  61

Query  481  FFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            FF NS  L+ LV +QAA T+IGN T+ IA + +YK+  
Sbjct  62   FFDNSIYLDWLVTVQAATTLIGNCTLAIAGYFLYKTRN  99



>ref|WP_027268723.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=101

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+PTW +H++SV+EW+ A+  +W Y E S   +W+ LS+GM+P L  A CACTWHFF
Sbjct  2    HALSIPTWMVHITSVVEWIAAIWFIWLYAEVSQRPAWRALSFGMLPSLVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N+  L  LV LQA +TV+GN T C AA+ I+  S++
Sbjct  62   DNAPHLVWLVTLQAGMTVVGNTTACAAAWWIWHQSRQ  98



>ref|WP_040054846.1| hypothetical protein [Candidatus Atelocyanobacterium thalassa]
 gb|KFF41391.1| Protein of unknown function (DUF2499) [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=112

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +1

Query  313  LSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYN  492
            LS+PTW IH++SV EW+IA+ LVW Y E S    WK LS+ M+P L  A CAC WHFF N
Sbjct  4    LSIPTWMIHIASVTEWIIAIWLVWTYAEVSKRNYWKVLSFAMLPSLASAACACIWHFFDN  63

Query  493  SESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
              SL+ LV +QA LT++GN+T+C+A   I++ S
Sbjct  64   LPSLDWLVTIQATLTLLGNSTLCLAGRHIFRHS  96



>gb|EJK71733.1| hypothetical protein THAOC_06800 [Thalassiosira oceanica]
Length=549

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +1

Query  286  VQFAEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFC  465
            V  +EP NALS+PTW IH SSV E++ AM  +W++ + +    WKGL+WGM+PL      
Sbjct  235  VMHSEPDNALSIPTWAIHFSSVFEFLFAMDTIWKFADATDNPKWKGLTWGMLPLHASGIA  294

Query  466  ACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRI  579
            ACT+HFFYN  SL+ +V LQA  T++GN T  IAA+RI
Sbjct  295  ACTYHFFYNPSSLQFVVELQAFFTLLGNLTCAIAAYRI  332



>ref|WP_008234855.1| hypothetical protein [Richelia intracellularis]
 emb|CCH67820.1| hypothetical protein RINTHH_16650 [Richelia intracellularis HH01]
Length=102

 Score =   108 bits (269),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+ TW IH+SSVIEW+IA+ L+W+YG+     +W  LS+ M+P L  A CACTWH+F
Sbjct  2    HALSIFTWIIHISSVIEWIIAIWLIWEYGKGINNNNWWILSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NS SLE LV LQA  T++GN T+  AAFRI+ SS+
Sbjct  62   DNSPSLEWLVTLQATTTLLGNCTLWGAAFRIWYSSR  97



>ref|WP_015164015.1| hypothetical protein [Pseudanabaena sp. PCC 7367]
 gb|AFY69041.1| Protein of unknown function DUF2499 [Pseudanabaena sp. PCC 7367]
Length=110

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALSLPTW IH+SSVIEW +A+ L+  Y + +  ++W GLS+ M+P L  A CACTWHFF
Sbjct  2    HALSLPTWIIHISSVIEWALAIWLIATYAQLNHNKAWLGLSFAMLPALVSALCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
             N+ SLE LV LQAA+T++GN  + IA + I++ +Q+
Sbjct  62   DNATSLEWLVILQAAMTLVGNIALAIAGYFIWRYAQQ  98



>ref|WP_019502955.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=100

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALSLPTW IH+SSV+EW +A+ L+W Y + S   +W+GL+  M P L  A CACTWHFF
Sbjct  2    NALSLPTWIIHISSVLEWTLAIWLIWIYAKLSQNLAWRGLAIAMFPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+ SL  LV +QA  T++GN  M IAA+ I+K +Q
Sbjct  62   DNAISLGWLVTVQATTTLLGNVAMAIAAYFIWKQAQ  97



>ref|WP_008224796.1| hypothetical protein [Richelia intracellularis]
 emb|CCH64536.1| hypothetical protein RINTHM_530 [Richelia intracellularis HM01]
Length=102

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALS+ TW IH+SSVIEW+IA+ L+W+YG+     +W  LS+ M+P L  A CACTWH+F
Sbjct  2    HALSIFTWIIHISSVIEWIIAIWLIWEYGKGINNNNWWILSFAMLPALISAMCACTWHYF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             NS SLE LV LQA  T++GN T+  AAFRI+ SS+
Sbjct  62   DNSPSLEWLVTLQATTTLLGNFTLWGAAFRIWYSSR  97



>ref|XP_011463784.1| PREDICTED: uncharacterized protein LOC101306233 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=100

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 65/91 (71%), Gaps = 6/91 (7%)
 Frame = +1

Query  325  TWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFFYNSESL  504
            T  + +S + +W    ++V   G   G  S        VPLLGGAFCACTWHFFYNSESL
Sbjct  11   TCQVSLSGLQQWCWCGSMVRSPGSNRGKGSLG------VPLLGGAFCACTWHFFYNSESL  64

Query  505  EVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            EVLVALQAALTV+GNATMC AA+RIY+S++E
Sbjct  65   EVLVALQAALTVMGNATMCFAAYRIYRSTEE  95



>ref|XP_005833130.1| hypothetical protein GUITHDRAFT_70958, partial [Guillardia theta 
CCMP2712]
 gb|EKX46150.1| hypothetical protein GUITHDRAFT_70958, partial [Guillardia theta 
CCMP2712]
Length=86

 Score =   106 bits (265),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            NALS+PTW IH SSV EW+ AM LVW Y + S  ++WKGL+WGM+PL      ACT+HFF
Sbjct  1    NALSIPTWAIHFSSVFEWIFAMRLVWDYADASKDQTWKGLTWGMLPLHASGVAACTYHFF  60

Query  487  YNSESLEVLVALQAALTV  540
            YN+  L  LVALQA LTV
Sbjct  61   YNNPDLSFLVALQAGLTV  78



>ref|WP_012629834.1| hypothetical protein [Cyanothece sp. PCC 7425]
 gb|ACL46788.1| conserved hypothetical protein [Cyanothece sp. PCC 7425]
Length=109

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALSLPTWTIHVSSVIEW+ A+ L+W++ E     +W+ L+  M+P L  A CACTWHFF
Sbjct  2    HALSLPTWTIHVSSVIEWITAIGLIWRFAEIKQNPAWRVLALAMLPALVSAMCACTWHFF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N   L  LV LQAA+TV+GN T+C AA  ++ +++
Sbjct  62   DNPPQLAWLVTLQAAMTVVGNLTLCGAAGWLWWTAR  97



>ref|XP_002508130.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69388.1| predicted protein [Micromonas sp. RCC299]
Length=583

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +1

Query  298  EPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTW  477
            EP+NALS+PTW +HVSSV EW +AM L++ + + SG ++W+ +S  M P L   FCACT+
Sbjct  282  EPSNALSVPTWAVHVSSVTEWALAMRLIYAFADVSGNKNWRNVSVAMTPFLASGFCACTF  341

Query  478  HFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            H FYNS  +  LV LQA LT++GN    +AA+ + K  +
Sbjct  342  HLFYNSPGVNALVPLQALLTLLGNCACGVAAWSVVKEGE  380



>ref|WP_015124353.1| hypothetical protein [Synechococcus sp. PCC 6312]
 gb|AFY60809.1| Protein of unknown function (DUF2499) [Synechococcus sp. PCC 
6312]
Length=101

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
             ALS+PTW IH+SSV+EW+ A+ L+W++GE    + WK L+  M+P L  A CACTWH++
Sbjct  2    QALSIPTWVIHISSVLEWMAAIVLIWRFGELHPQQGWKWLALAMLPALISAMCACTWHYY  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N   L+ LV +QA LT+ GN T+C+AA  IY   Q
Sbjct  62   DNDVQLDWLVTVQAGLTLFGNTTLCLAAGWIYYRYQ  97



>dbj|BAD46676.1| hypothetical protein [Oryza sativa Japonica Group]
Length=175

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  436  MVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQE  597
            MVPLLGGA CACTWHFFYNSESLEVLVALQ  LTVIGN TMCIAAFRI+K+SQE
Sbjct  117  MVPLLGGAMCACTWHFFYNSESLEVLVALQGVLTVIGNITMCIAAFRIFKASQE  170



>ref|WP_017300317.1| hypothetical protein [Nodosilinea nodulosa]
Length=103

 Score =   104 bits (259),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALSLPTW IH+SSV+EW+ AM  VWQ+   +    W+ L+ GM+P L  A  ACTWH F
Sbjct  2    HALSLPTWMIHISSVLEWMAAMWFVWQFAAVTQRPVWRWLAIGMLPALVSAMAACTWHLF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
             N+  L  LV LQAA+TV GNAT+C+AA+ I++  +
Sbjct  62   DNAPGLAWLVTLQAAMTVAGNATLCLAAWWIWRQGR  97



>ref|XP_009041602.1| hypothetical protein AURANDRAFT_67808 [Aureococcus anophagefferens]
 gb|EGB03673.1| hypothetical protein AURANDRAFT_67808 [Aureococcus anophagefferens]
Length=503

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  301  PANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWH  480
            P NALS+PTW +H SSV E+V+AM L  +Y   +G E W G++WGM+P      CACT+H
Sbjct  212  PVNALSVPTWAVHFSSVCEFVLAMRLAVKYAAWTGDEKWNGVAWGMLPSHASGVCACTYH  271

Query  481  FFYNSESLEVLVALQAALTVIGNATMCIAAFRI  579
             FYN  +L  LV  QA LT +GN T+C+AAFR+
Sbjct  272  LFYNQAALAWLVTAQAGLTFLGNCTLCVAAFRL  304



>ref|XP_003080005.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL53653.1| Uncharacterised protein family Ycf49 [Ostreococcus tauri]
Length=511

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +1

Query  295  AEPANALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACT  474
            +EP NALSLPTW +HVSSV EW +AM  V  + +++  E W+ L+  M P L   F ACT
Sbjct  224  SEPTNALSLPTWAVHVSSVTEWALAMKYVAGHADRTKNERWRYLTVAMSPFLASGFTACT  283

Query  475  WHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKSSQ  594
            +H FYN  +L  LV LQA LT++GNA   IAA+RI K+  
Sbjct  284  FHAFYNPSTLNQLVPLQATLTLLGNAGCAIAAYRISKNDD  323



>ref|XP_010908778.1| PREDICTED: uncharacterized protein LOC105035078 isoform X1 [Elaeis 
guineensis]
 ref|XP_010908779.1| PREDICTED: uncharacterized protein LOC105035078 isoform X1 [Elaeis 
guineensis]
Length=200

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  409  ESWKGLSWGMVPLLGGAFCACTWHFFYNSESLEVLVALQAALTVIGNATMCIAAFRIYKS  588
             S+ G     VPLLGGA CACTWHFFYNSESLE+LVALQAALTVIGN TMCIAAFRI+K+
Sbjct  133  RSFLGDGKRKVPLLGGALCACTWHFFYNSESLEILVALQAALTVIGNITMCIAAFRIFKA  192

Query  589  SQE  597
            SQE
Sbjct  193  SQE  195



>ref|WP_025782100.1| hypothetical protein [Candidatus Synechococcus spongiarum]
Length=102

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  NALSLPTWTIHVSSVIEWVIAMALVWQYGEKSGYESWKGLSWGMVPLLGGAFCACTWHFF  486
            +ALSLPTW IHV+SV+EW +AM LV +YG   G   W  L+  M P L  A CACTWH F
Sbjct  2    HALSLPTWWIHVTSVLEWCLAMGLVVRYGRLRGEADWCWLAMAMTPALVSAMCACTWHAF  61

Query  487  YNSESLEVLVALQAALTVIGNATMCIAAFRIYKSS  591
             N++SL+ LV LQAA T++GN+T+ +AA+ ++K +
Sbjct  62   DNADSLKWLVTLQAAATLLGNSTLALAAWWLWKQA  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750