BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003L22

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG04267.1|  ADP-ribosylation factor                                 254   2e-82   Gossypium arboreum [tree cotton]
gb|KJB11520.1|  hypothetical protein B456_001G263300                    253   2e-82   Gossypium raimondii
ref|XP_006386699.1|  hypothetical protein POPTR_0002s19210g             251   2e-82   
sp|O48920.3|ARF_VIGUN  RecName: Full=ADP-ribosylation factor            253   2e-82   Vigna unguiculata
ref|XP_009612443.1|  PREDICTED: ADP-ribosylation factor                 253   2e-82   Nicotiana tomentosiformis
ref|XP_002521452.1|  ADP-ribosylation factor, arf, putative             253   2e-82   Ricinus communis
gb|ACJ84691.1|  unknown                                                 253   2e-82   Medicago truncatula
sp|P51822.2|ARF1_DAUCA  RecName: Full=ADP-ribosylation factor 1         253   2e-82   Daucus carota [carrots]
ref|XP_002318935.1|  hypothetical protein POPTR_0013s00700g             253   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_002457613.1|  hypothetical protein SORBIDRAFT_03g010350          252   2e-82   Sorghum bicolor [broomcorn]
ref|XP_003536036.1|  PREDICTED: ADP-ribosylation factor-like isof...    252   2e-82   
gb|AAT08648.1|  ADP-ribosylation factor                                 253   2e-82   Hyacinthus orientalis [common hyacinth]
ref|XP_002302788.1|  hypothetical protein POPTR_0002s19210g             252   3e-82   Populus trichocarpa [western balsam poplar]
ref|XP_011003178.1|  PREDICTED: ADP-ribosylation factor-like isof...    252   3e-82   Populus euphratica
gb|KDP28302.1|  hypothetical protein JCGZ_14073                         252   3e-82   Jatropha curcas
gb|KHN00225.1|  ADP-ribosylation factor 2                               252   3e-82   Glycine soja [wild soybean]
ref|XP_006840725.1|  hypothetical protein AMTR_s00096p00110370          252   3e-82   
gb|AFW67226.1|  hypothetical protein ZEAMMB73_332083                    254   3e-82   
gb|KJB24452.1|  hypothetical protein B456_004G146100                    252   3e-82   Gossypium raimondii
ref|XP_011040674.1|  PREDICTED: ADP-ribosylation factor-like isof...    252   3e-82   Populus euphratica
ref|XP_010524305.1|  PREDICTED: ADP-ribosylation factor-like            252   3e-82   Tarenaya hassleriana [spider flower]
ref|XP_010092942.1|  ADP-ribosylation factor 2                          252   4e-82   
ref|XP_011038977.1|  PREDICTED: ADP-ribosylation factor-like            252   4e-82   Populus euphratica
ref|XP_008777957.1|  PREDICTED: ADP-ribosylation factor                 252   4e-82   Phoenix dactylifera
emb|CBI25984.3|  unnamed protein product                                253   4e-82   Vitis vinifera
ref|XP_006480700.1|  PREDICTED: ADP-ribosylation factor 2-like is...    252   4e-82   Citrus sinensis [apfelsine]
ref|XP_003626009.1|  ADP-ribosylation factor-like protein               253   4e-82   
gb|KJB11518.1|  hypothetical protein B456_001G263300                    253   4e-82   Gossypium raimondii
ref|XP_004494449.1|  PREDICTED: ADP-ribosylation factor 2-like          252   4e-82   Cicer arietinum [garbanzo]
ref|XP_010659724.1|  PREDICTED: ADP-ribosylation factor isoform X1      252   4e-82   Vitis vinifera
gb|AFW67224.1|  hypothetical protein ZEAMMB73_332083                    253   4e-82   
ref|XP_004981305.1|  PREDICTED: ADP-ribosylation factor-like isof...    253   5e-82   
gb|ACU16903.1|  unknown                                                 252   5e-82   Glycine max [soybeans]
gb|KDO66124.1|  hypothetical protein CISIN_1g029675mg                   252   5e-82   Citrus sinensis [apfelsine]
ref|XP_010941504.1|  PREDICTED: ADP-ribosylation factor                 251   6e-82   Elaeis guineensis
gb|EPS68301.1|  hypothetical protein M569_06468                         251   6e-82   Genlisea aurea
ref|XP_010674549.1|  PREDICTED: ADP-ribosylation factor-like isof...    251   6e-82   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO72117.1|  hypothetical protein CISIN_1g030193mg                   250   6e-82   Citrus sinensis [apfelsine]
ref|XP_010679455.1|  PREDICTED: ADP-ribosylation factor 2-B-like        251   6e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010108788.1|  ADP-ribosylation factor                            251   6e-82   
ref|XP_009389142.1|  PREDICTED: ADP-ribosylation factor 1-like          251   6e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007031496.1|  ADP-ribosylation factor A1F                        251   6e-82   Theobroma cacao [chocolate]
gb|KHG02135.1|  ADP-ribosylation factor                                 252   7e-82   Gossypium arboreum [tree cotton]
gb|KHG04030.1|  ADP-ribosylation factor 2                               251   7e-82   Gossypium arboreum [tree cotton]
gb|ADB85106.1|  ADP ribosylation factor 002                             251   7e-82   Jatropha curcas
ref|NP_001105897.1|  ADP-ribosylation factor                            251   7e-82   
gb|AFW67223.1|  hypothetical protein ZEAMMB73_332083                    251   7e-82   
gb|EYU46850.1|  hypothetical protein MIMGU_mgv1a014704mg                250   7e-82   Erythranthe guttata [common monkey flower]
ref|XP_003618209.1|  ADP-ribosylation factor                            251   7e-82   Medicago truncatula
ref|NP_001051676.1|  Os03g0811900                                       251   7e-82   
ref|XP_010248146.1|  PREDICTED: ADP-ribosylation factor                 251   7e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006488769.1|  PREDICTED: ADP-ribosylation factor-like            251   7e-82   Citrus sinensis [apfelsine]
gb|KJB75878.1|  hypothetical protein B456_012G062700                    251   7e-82   Gossypium raimondii
emb|CDP13175.1|  unnamed protein product                                252   7e-82   Coffea canephora [robusta coffee]
ref|XP_002466220.1|  hypothetical protein SORBIDRAFT_01g003770          251   7e-82   Sorghum bicolor [broomcorn]
gb|EYU46846.1|  hypothetical protein MIMGU_mgv1a014704mg                251   7e-82   Erythranthe guttata [common monkey flower]
ref|NP_001275425.1|  ADP-ribosylation factor 2-like                     251   8e-82   Solanum tuberosum [potatoes]
gb|AEX49947.1|  ADP-ribosylation factor 1                               251   8e-82   Haloxylon ammodendron
gb|KCW56002.1|  hypothetical protein EUGRSUZ_I01779                     251   8e-82   Eucalyptus grandis [rose gum]
gb|ACF80896.1|  unknown                                                 251   8e-82   Zea mays [maize]
ref|XP_004304633.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    251   8e-82   Fragaria vesca subsp. vesca
ref|XP_006361664.1|  PREDICTED: ADP-ribosylation factor 2-like is...    251   8e-82   Solanum tuberosum [potatoes]
ref|NP_001236384.1|  uncharacterized protein LOC100306021               251   8e-82   Glycine max [soybeans]
ref|XP_007205794.1|  hypothetical protein PRUPE_ppa010615mg             253   8e-82   
ref|XP_007151018.1|  hypothetical protein PHAVU_004G011900g             251   9e-82   Phaseolus vulgaris [French bean]
gb|AFK39359.1|  unknown                                                 251   9e-82   Medicago truncatula
ref|XP_010943658.1|  PREDICTED: ADP-ribosylation factor 2-like          251   9e-82   Elaeis guineensis
gb|ACM67553.1|  ADP-ribosylation factor-like protein                    251   9e-82   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006399980.1|  hypothetical protein EUTSA_v10014797mg             251   9e-82   Eutrema salsugineum [saltwater cress]
ref|XP_010094415.1|  ADP-ribosylation factor 2                          252   9e-82   
gb|KDP46432.1|  hypothetical protein JCGZ_10272                         251   9e-82   Jatropha curcas
ref|NP_001274832.1|  ADP-ribosylation factor 1-like protein             251   1e-81   Solanum tuberosum [potatoes]
ref|XP_008389662.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    251   1e-81   Malus domestica [apple tree]
ref|XP_009403841.1|  PREDICTED: ADP-ribosylation factor 1-like          251   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_172533.2|  ADP-ribosylation factor A1F                           251   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AAF17671.1|AC009398_20  F20B24.7                                     251   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AAR18698.1|  ADP-ribosylation factor 1                               251   1e-81   Populus tomentosa [Chinese white poplar]
ref|XP_002892585.1|  ADP-ribosylation factor                            251   1e-81   Arabidopsis lyrata subsp. lyrata
ref|XP_004252939.1|  PREDICTED: ADP-ribosylation factor 2               251   1e-81   Solanum lycopersicum
ref|XP_010674548.1|  PREDICTED: ADP-ribosylation factor-like isof...    251   1e-81   
ref|XP_009375124.1|  PREDICTED: ADP-ribosylation factor 1-like          251   1e-81   Pyrus x bretschneideri [bai li]
ref|NP_001280835.1|  ADP-ribosylation factor                            251   1e-81   Malus domestica [apple tree]
ref|XP_002871626.1|  ADP-ribosylation factor A1B                        251   1e-81   Arabidopsis lyrata subsp. lyrata
gb|KGN51378.1|  hypothetical protein Csa_5G524710                       251   1e-81   Cucumis sativus [cucumbers]
gb|EYU19417.1|  hypothetical protein MIMGU_mgv1a014679mg                251   1e-81   Erythranthe guttata [common monkey flower]
ref|XP_004288363.1|  PREDICTED: ADP-ribosylation factor 2-like          251   1e-81   Fragaria vesca subsp. vesca
gb|EYU38402.1|  hypothetical protein MIMGU_mgv1a014684mg                251   1e-81   Erythranthe guttata [common monkey flower]
ref|XP_006417443.1|  hypothetical protein EUTSA_v10008885mg             251   1e-81   Eutrema salsugineum [saltwater cress]
ref|XP_010492280.1|  PREDICTED: ADP-ribosylation factor isoform X1      251   1e-81   Camelina sativa [gold-of-pleasure]
gb|ADP00406.1|  ADP-ribosylation factor                                 251   1e-81   Actinidia chinensis
ref|XP_009121644.1|  PREDICTED: ADP-ribosylation factor 2               251   1e-81   Brassica rapa
ref|NP_001290536.1|  uncharacterized protein LOC105052388               251   1e-81   Elaeis guineensis
ref|NP_177206.1|  ARF GTPase family protein                             250   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ29027.1|  hypothetical protein OsJ_13076                          251   1e-81   Oryza sativa Japonica Group [Japonica rice]
gb|KJB82421.1|  hypothetical protein B456_013G208600                    251   1e-81   Gossypium raimondii
ref|XP_004981304.1|  PREDICTED: ADP-ribosylation factor-like isof...    252   1e-81   
gb|ABF99502.1|  ADP-ribosylation factor, putative, expressed            251   1e-81   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393904.1|  PREDICTED: ADP-ribosylation factor 1-like          250   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP26602.1|  hypothetical protein JCGZ_17760                         250   1e-81   Jatropha curcas
gb|ADH44695.1|  ADP-ribosylation factor                                 250   1e-81   Salvia miltiorrhiza [Chinese salvia]
ref|XP_002888782.1|  hypothetical protein ARALYDRAFT_476172             250   2e-81   
ref|XP_006356426.1|  PREDICTED: ADP-ribosylation factor 2-like is...    250   2e-81   Solanum tuberosum [potatoes]
ref|XP_006305639.1|  hypothetical protein CARUB_v10010344mg             250   2e-81   
gb|ACJ84889.1|  unknown                                                 250   2e-81   Medicago truncatula
ref|XP_003618207.1|  ADP-ribosylation factor                            253   2e-81   
gb|KJB31031.1|  hypothetical protein B456_005G181600                    250   2e-81   Gossypium raimondii
ref|XP_006288755.1|  hypothetical protein CARUB_v10002073mg             250   2e-81   Capsella rubella
gb|AIX10946.1|  putative ADP-ribosylation factor                        250   2e-81   Gardenia jasminoides
ref|XP_004135253.1|  PREDICTED: ADP-ribosylation factor 2-like is...    251   2e-81   
gb|KCW56001.1|  hypothetical protein EUGRSUZ_I01779                     250   2e-81   Eucalyptus grandis [rose gum]
gb|ACJ85257.1|  unknown                                                 251   2e-81   Medicago truncatula
gb|KHG28118.1|  ARF2-B: ADP-ribosylation factor 2-B                     250   2e-81   Gossypium arboreum [tree cotton]
pdb|3AQ4|A  Chain A, Molecular Insights Into Plant Cell Prolifera...    250   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002277054.2|  PREDICTED: ADP-ribosylation factor isoform X2      250   2e-81   Vitis vinifera
gb|AAC98042.1|  Strong similarity to gb|M95166 ADP-ribosylation f...    250   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660901.1|  PREDICTED: ADP-ribosylation factor isoform X1      250   2e-81   Vitis vinifera
emb|CAD12855.1|  ADP-ribosylation factor                                250   2e-81   Gossypium hirsutum [American cotton]
gb|ACU13131.1|  unknown                                                 250   2e-81   Glycine max [soybeans]
gb|AGV54515.1|  ADP ribosylation factor                                 252   2e-81   Phaseolus vulgaris [French bean]
ref|XP_008443527.1|  PREDICTED: ADP-ribosylation factor 1-like          250   2e-81   Cucumis melo [Oriental melon]
ref|XP_010922925.1|  PREDICTED: ADP-ribosylation factor-like isof...    249   2e-81   
gb|KJB15578.1|  hypothetical protein B456_002G185200                    250   2e-81   Gossypium raimondii
gb|AGH68504.1|  ADP-ribosylation factor                                 250   2e-81   Ipomoea batatas [batate]
ref|XP_008812250.1|  PREDICTED: ADP-ribosylation factor 2-like          250   2e-81   Phoenix dactylifera
ref|XP_008806237.1|  PREDICTED: ADP-ribosylation factor 2-like          250   2e-81   Phoenix dactylifera
ref|NP_196971.1|  ADP-ribosylation factor A1B                           250   2e-81   
ref|XP_004981306.1|  PREDICTED: ADP-ribosylation factor-like isof...    250   2e-81   
ref|NP_001042668.1|  Os01g0265100                                       250   2e-81   
ref|XP_004967765.1|  PREDICTED: ADP-ribosylation factor 2-like          250   2e-81   Setaria italica
ref|XP_006390885.1|  hypothetical protein EUTSA_v10019096mg             251   2e-81   
emb|CDX69567.1|  BnaA10g19160D                                          251   3e-81   
ref|XP_006841600.1|  hypothetical protein AMTR_s00003p00209290          249   3e-81   
ref|NP_182239.1|  ADP-ribosylation factor 1                             249   3e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410044.1|  PREDICTED: ADP-ribosylation factor 1-like          249   3e-81   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY09875.1|  BnaC09g42860D                                          251   3e-81   Brassica napus [oilseed rape]
ref|XP_009417875.1|  PREDICTED: ADP-ribosylation factor 1-like          249   3e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001044599.1|  Os01g0813400                                       249   3e-81   
ref|XP_010551906.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    249   3e-81   Tarenaya hassleriana [spider flower]
gb|AEZ00866.1|  putative ADP-ribosylation factor protein                249   3e-81   Elaeis guineensis
ref|XP_009776781.1|  PREDICTED: ADP-ribosylation factor-like            249   3e-81   Nicotiana sylvestris
ref|XP_002265983.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    249   3e-81   Vitis vinifera
ref|NP_001055892.1|  Os05g0489600                                       249   3e-81   
ref|XP_010491587.1|  PREDICTED: ADP-ribosylation factor 1-like          249   3e-81   Camelina sativa [gold-of-pleasure]
ref|XP_006291918.1|  hypothetical protein CARUB_v10018102mg             249   3e-81   Capsella rubella
ref|XP_009110099.1|  PREDICTED: ADP-ribosylation factor 1 isoform X2    249   3e-81   Brassica rapa
ref|XP_008444322.1|  PREDICTED: ADP-ribosylation factor 2-like          249   4e-81   Cucumis melo [Oriental melon]
ref|XP_006344797.1|  PREDICTED: ADP-ribosylation factor 1-like is...    249   4e-81   Solanum tuberosum [potatoes]
ref|XP_010553607.1|  PREDICTED: ADP-ribosylation factor 2-B             249   4e-81   Tarenaya hassleriana [spider flower]
ref|XP_009416365.1|  PREDICTED: ADP-ribosylation factor 1               249   4e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010922923.1|  PREDICTED: ADP-ribosylation factor 2-like is...    249   4e-81   Elaeis guineensis
emb|CDY47221.1|  BnaC09g14700D                                          249   4e-81   Brassica napus [oilseed rape]
ref|XP_011087519.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    249   4e-81   
ref|XP_009399937.1|  PREDICTED: ADP-ribosylation factor 2-like          249   4e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABY76246.1|  ADP-ribosylation factor                                 249   4e-81   Brassica napus [oilseed rape]
ref|XP_006296139.1|  hypothetical protein CARUB_v10025292mg             249   4e-81   
emb|CDY47137.1|  BnaA08g05460D                                          249   4e-81   Brassica napus [oilseed rape]
ref|XP_002888469.1|  ADP-ribosylation factor                            249   4e-81   
ref|XP_010651474.1|  PREDICTED: ADP-ribosylation factor 2 isoform X2    249   4e-81   
gb|AAU82112.1|  ADP-ribosylation factor                                 249   4e-81   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009383762.1|  PREDICTED: ADP-ribosylation factor 1               249   4e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009110098.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    249   4e-81   Brassica rapa
ref|NP_001274834.1|  ARF-like small GTPase-like protein                 249   4e-81   Solanum tuberosum [potatoes]
emb|CDM84658.1|  unnamed protein product                                249   4e-81   Triticum aestivum [Canadian hard winter wheat]
gb|ABR17508.1|  unknown                                                 249   5e-81   Picea sitchensis
ref|XP_002876669.1|  ADP-ribosylation factor                            249   5e-81   
ref|XP_010232478.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    249   5e-81   Brachypodium distachyon [annual false brome]
gb|AFK42466.1|  unknown                                                 249   5e-81   Lotus japonicus
gb|EMT17349.1|  ADP-ribosylation factor 2                               249   5e-81   
ref|XP_006305640.1|  hypothetical protein CARUB_v10010344mg             249   5e-81   
ref|XP_010313707.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    249   5e-81   
gb|EMT22177.1|  ADP-ribosylation factor                                 252   5e-81   
gb|ABR25719.1|  ADP-ribosylation factor 1                               249   6e-81   Oryza sativa Indica Group [Indian rice]
ref|XP_009629758.1|  PREDICTED: ADP-ribosylation factor 2 isoform X1    251   6e-81   Nicotiana tomentosiformis
ref|XP_009105711.1|  PREDICTED: ADP-ribosylation factor 2-B-like        249   6e-81   Brassica rapa
ref|XP_007224194.1|  hypothetical protein PRUPE_ppa017304mg             249   6e-81   
ref|XP_003557370.1|  PREDICTED: ADP-ribosylation factor 1               249   6e-81   Brachypodium distachyon [annual false brome]
ref|XP_010551905.1|  PREDICTED: ADP-ribosylation factor 1 isoform X1    250   6e-81   Tarenaya hassleriana [spider flower]
ref|XP_010319588.1|  PREDICTED: ADP-ribosylation factor                 249   6e-81   
ref|XP_009391635.1|  PREDICTED: ADP-ribosylation factor 2               249   6e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002962225.1|  ARF family GTPase                                  249   6e-81   Selaginella moellendorffii
ref|XP_003557369.1|  PREDICTED: ADP-ribosylation factor 1-like          249   6e-81   Brachypodium distachyon [annual false brome]
dbj|BAJ87426.1|  predicted protein                                      249   6e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB81136.1|  hypothetical protein B456_013G131000                    250   6e-81   Gossypium raimondii
ref|XP_009381359.1|  PREDICTED: ADP-ribosylation factor 1-like          249   7e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001059207.1|  Os07g0223400                                       249   7e-81   
gb|EAY92309.1|  hypothetical protein OsI_14032                          254   7e-81   Oryza sativa Indica Group [Indian rice]
emb|CDX95712.1|  BnaC03g25930D                                          249   7e-81   
gb|AGV54289.1|  ADP-ribosylation factor                                 249   7e-81   Phaseolus vulgaris [French bean]
ref|XP_006416080.1|  hypothetical protein EUTSA_v10008884mg             248   7e-81   Eutrema salsugineum [saltwater cress]
ref|NP_001136508.1|  uncharacterized protein LOC100216623               248   8e-81   Zea mays [maize]
ref|XP_009394868.1|  PREDICTED: ADP-ribosylation factor 1-like          248   8e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG17087.1|  ARF2-B: ADP-ribosylation factor 2-B                     249   9e-81   Gossypium arboreum [tree cotton]
gb|EEE66819.1|  hypothetical protein OsJ_23579                          252   9e-81   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001168955.1|  uncharacterized protein LOC100382775               248   9e-81   Zea mays [maize]
gb|EMS63688.1|  ADP-ribosylation factor 2                               248   1e-80   Triticum urartu
gb|ACR37635.1|  unknown                                                 247   1e-80   Zea mays [maize]
ref|XP_009113207.1|  PREDICTED: ADP-ribosylation factor 1-like          248   1e-80   Brassica rapa
ref|NP_191788.1|  ADP-ribosylation factor A1E                           248   1e-80   Arabidopsis thaliana [mouse-ear cress]
gb|ACM67554.1|  ADP-ribosylation factor-like protein                    248   1e-80   Musa acuminata AAA Group [Cavendish banana]
gb|ABD73294.1|  ADP-ribosylation factor-like protein                    248   1e-80   Panax ginseng [Asiatic ginseng]
ref|XP_004970327.1|  PREDICTED: ADP-ribosylation factor 1-like is...    248   1e-80   
ref|XP_004970328.1|  PREDICTED: ADP-ribosylation factor 1-like is...    248   1e-80   Setaria italica
ref|XP_004228551.1|  PREDICTED: ADP-ribosylation factor 2-like          248   1e-80   Solanum lycopersicum
gb|ABF74733.1|  ADP-ribosylation factor 1                               248   1e-80   Nicotiana benthamiana
gb|EAY73411.1|  hypothetical protein OsI_01294                          249   1e-80   Oryza sativa Indica Group [Indian rice]
gb|AAT08663.1|  ADP-ribosylation factor                                 248   1e-80   Hyacinthus orientalis [common hyacinth]
gb|AFW79615.1|  hypothetical protein ZEAMMB73_444016                    249   1e-80   
ref|NP_001149117.1|  ADP-ribosylation factor                            248   1e-80   Zea mays [maize]
ref|XP_009595261.1|  PREDICTED: ADP-ribosylation factor 1-like          248   1e-80   Nicotiana tomentosiformis
ref|XP_002318934.1|  hypothetical protein POPTR_0013s00690g             248   2e-80   
ref|XP_009115521.1|  PREDICTED: ADP-ribosylation factor 2-B             248   2e-80   
ref|XP_004158320.1|  PREDICTED: ADP-ribosylation factor 1-like          248   2e-80   
gb|AFW78462.1|  hypothetical protein ZEAMMB73_418055                    248   2e-80   
emb|CDX83340.1|  BnaA03g21660D                                          248   2e-80   
ref|XP_009420958.1|  PREDICTED: ADP-ribosylation factor 1-like          248   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395959.1|  PREDICTED: ADP-ribosylation factor 1-like          248   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008443534.1|  PREDICTED: ADP-ribosylation factor 1-like is...    248   2e-80   Cucumis melo [Oriental melon]
gb|AAO62347.1|  ARF1-like GTP-binding protein                           247   2e-80   Gossypium hirsutum [American cotton]
ref|XP_008223454.1|  PREDICTED: ADP-ribosylation factor-like            247   2e-80   Prunus mume [ume]
ref|XP_011462890.1|  PREDICTED: ADP-ribosylation factor-like isof...    247   2e-80   Fragaria vesca subsp. vesca
ref|XP_001776112.1|  Arf1_5/ArfA-family small GTPase                    247   2e-80   
ref|XP_009133804.1|  PREDICTED: ADP-ribosylation factor 1-like          247   3e-80   Brassica rapa
gb|AAF79587.1|AC007945_7  F28C11.12                                     249   3e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001170436.1|  uncharacterized protein LOC100384428               247   4e-80   Zea mays [maize]
gb|EMS51203.1|  ADP-ribosylation factor 2                               249   4e-80   Triticum urartu
gb|AFW78457.1|  hypothetical protein ZEAMMB73_418055                    247   4e-80   
gb|ACG31280.1|  ADP-ribosylation factor 1                               246   4e-80   Zea mays [maize]
sp|O23778.3|ARF1_CATRO  RecName: Full=ADP-ribosylation factor 1         246   5e-80   Catharanthus roseus [chatas]
gb|AFW79619.1|  hypothetical protein ZEAMMB73_444016                    250   5e-80   
gb|AAD17207.1|  ADP-ribosylation factor                                 246   5e-80   Glycine max [soybeans]
ref|XP_009138731.1|  PREDICTED: ADP-ribosylation factor 1               246   6e-80   Brassica rapa
ref|XP_001764375.1|  Arf1_5/ArfA-family small GTPase                    246   6e-80   
ref|XP_001764701.1|  Arf1_5/ArfA-family small GTPase                    246   6e-80   
ref|NP_001237492.1|  uncharacterized protein LOC100499890               246   6e-80   Glycine max [soybeans]
gb|EEE66818.1|  hypothetical protein OsJ_23578                          248   7e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003055413.1|  predicted protein                                  246   7e-80   Micromonas pusilla CCMP1545
gb|ABR17658.1|  unknown                                                 246   8e-80   Picea sitchensis
dbj|BAB90396.1|  ADP-ribosylation factor                                252   1e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001776147.1|  Arf1_5/ArfA-family small GTPase                    246   1e-79   
ref|XP_009118871.1|  PREDICTED: ADP-ribosylation factor 1-like          245   1e-79   Brassica rapa
ref|XP_011462888.1|  PREDICTED: ADP-ribosylation factor-like isof...    246   1e-79   Fragaria vesca subsp. vesca
ref|XP_005643690.1|  ADP-ribosylation factor 1                          245   1e-79   Coccomyxa subellipsoidea C-169
ref|XP_007147411.1|  hypothetical protein PHAVU_006G122200g             245   2e-79   Phaseolus vulgaris [French bean]
gb|KJB09503.1|  hypothetical protein B456_001G146100                    245   2e-79   Gossypium raimondii
ref|XP_001764700.1|  predicted protein                                  245   2e-79   
gb|AAP69821.1|  ARF                                                     245   2e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004141190.1|  PREDICTED: ADP-ribosylation factor 1-like          251   3e-79   
ref|XP_002312302.1|  ADP-ribosylation factor family protein             244   4e-79   Populus trichocarpa [western balsam poplar]
ref|XP_002314987.1|  ADP-ribosylation factor family protein             244   4e-79   Populus trichocarpa [western balsam poplar]
ref|XP_001420856.1|  predicted protein                                  244   6e-79   Ostreococcus lucimarinus CCE9901
ref|XP_010694842.1|  PREDICTED: ADP-ribosylation factor 1-like          244   6e-79   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI39638.3|  unnamed protein product                                256   7e-79   Vitis vinifera
ref|XP_001776146.1|  predicted protein                                  243   1e-78   
emb|CEF99966.1|  Small GTPase superfamily, ARF/SAR type                 244   1e-78   Ostreococcus tauri
ref|XP_003613219.1|  ADP-ribosylation factor                            252   1e-78   
sp|P51821.2|ARF1_CHLRE  RecName: Full=ADP-ribosylation factor 1         242   2e-78   Chlamydomonas reinhardtii
ref|XP_003533111.1|  PREDICTED: ADP-ribosylation factor 2-B-like        242   3e-78   Glycine max [soybeans]
gb|KCW56007.1|  hypothetical protein EUGRSUZ_I01779                     242   3e-78   Eucalyptus grandis [rose gum]
ref|XP_006438364.1|  hypothetical protein CICLE_v10032807mg             242   6e-78   
gb|AAO63779.1|  ADP-ribosylation factor 1                               241   6e-78   Populus tremuloides
dbj|BAK00965.1|  predicted protein                                      240   1e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005845590.1|  hypothetical protein CHLNCDRAFT_49011              240   2e-77   Chlorella variabilis
emb|CDS06496.1|  Putative ADP-ribosylation factor 1                     240   2e-77   Lichtheimia ramosa
ref|XP_005830502.1|  hypothetical protein GUITHDRAFT_163836             239   3e-77   Guillardia theta CCMP2712
emb|CDH54768.1|  adp-ribosylation factor                                239   5e-77   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002973399.1|  ARF family GTPase                                  239   5e-77   Selaginella moellendorffii
ref|XP_003578999.1|  PREDICTED: ADP-ribosylation factor 1-like          238   6e-77   Brachypodium distachyon [annual false brome]
emb|CDH50625.1|  adp-ribosylation factor                                238   7e-77   Lichtheimia corymbifera JMRC:FSU:9682
gb|EYU46843.1|  hypothetical protein MIMGU_mgv1a020290mg                238   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_006302886.1|  hypothetical protein CARUB_v10021017mg             237   3e-76   Capsella rubella
gb|KIY96152.1|  ADP-ribosylation factor 1                               237   3e-76   Monoraphidium neglectum
gb|KIY94970.1|  ADP-ribosylation factor 1                               237   3e-76   Monoraphidium neglectum
ref|XP_002119700.1|  PREDICTED: ADP-ribosylation factor 1               237   4e-76   
ref|XP_008086386.1|  P-loop containing nucleoside triphosphate hy...    237   4e-76   Glarea lozoyensis ATCC 20868
gb|EIE79751.1|  ADP-ribosylation factor                                 236   4e-76   Rhizopus delemar RA 99-880
emb|CEG67980.1|  Putative ADP-ribosylation factor 1                     236   6e-76   Rhizopus microsporus
ref|XP_001558462.1|  ADP-ribosylation factor                            236   6e-76   Botrytis cinerea B05.10
ref|XP_007913163.1|  putative adp-ribosylation factor protein           236   6e-76   Phaeoacremonium minimum UCRPA7
ref|XP_001690893.1|  small ARF-related GTPase                           236   6e-76   Chlamydomonas reinhardtii
ref|XP_007788559.1|  putative adp-ribosylation factor protein           236   7e-76   
sp|P51824.2|ARF1_SOLTU  RecName: Full=ADP-ribosylation factor 1         236   7e-76   
gb|EPB84634.1|  ADP-ribosylation factor 1                               236   7e-76   
ref|XP_005760428.1|  ADP-ribosylation factor                            236   8e-76   
ref|XP_003054231.1|  predicted protein                                  236   8e-76   
emb|CDX68343.1|  BnaA07g23830D                                          236   8e-76   
gb|EWY94085.1|  ADP-ribosylation factor                                 235   8e-76   
gb|EWZ91915.1|  ADP-ribosylation factor                                 235   9e-76   
gb|EIE86445.1|  ADP-ribosylation factor                                 236   9e-76   
gb|KJB15575.1|  hypothetical protein B456_002G185200                    234   9e-76   
gb|EWZ50626.1|  ADP-ribosylation factor                                 234   1e-75   
gb|KIX04641.1|  ADP-ribosylation factor                                 236   1e-75   
ref|XP_008811520.1|  PREDICTED: ADP-ribosylation factor 1-like          233   1e-75   
gb|KHN99894.1|  ADP-ribosylation factor 1                               236   1e-75   
ref|XP_003856771.1|  hypothetical protein MYCGRDRAFT_102943             236   1e-75   
ref|XP_007920061.1|  hypothetical protein MYCFIDRAFT_49010              236   1e-75   
ref|XP_007820253.1|  RAS-like GTPase, Rho2 subfamily                    235   1e-75   
ref|XP_007747463.1|  ADP-ribosylation factor                            235   1e-75   
ref|XP_007293765.1|  ADP-ribosylation factor 1                          235   1e-75   
ref|XP_002900890.1|  ADP-ribosylation factor family                     235   1e-75   
ref|XP_002900891.1|  ADP-ribosylation factor family                     235   1e-75   
gb|KIW06748.1|  ADP-ribosylation factor                                 235   1e-75   
ref|XP_001825200.1|  ADP-ribosylation factor                            235   1e-75   
ref|XP_007725373.1|  ADP-ribosylation factor                            235   2e-75   
ref|XP_007758701.1|  ADP-ribosylation factor                            235   2e-75   
ref|XP_007672425.1|  hypothetical protein BAUCODRAFT_61772              235   2e-75   
ref|XP_003713533.1|  ADP-ribosylation factor                            235   2e-75   
gb|KIL95193.1|  adp-ribosylation factor                                 235   2e-75   
ref|XP_002628950.1|  conserved hypothetical protein                     234   2e-75   
ref|XP_007343507.1|  ARF/SAR                                            234   2e-75   
ref|XP_009104952.1|  PREDICTED: ADP-ribosylation factor 2-B-like        234   2e-75   
ref|XP_002948332.1|  small Arf-related GTPase                           234   2e-75   
gb|KDE06822.1|  ADP-ribosylation factor 1                               234   3e-75   
gb|EPB86904.1|  ADP-ribosylation factor                                 234   3e-75   
ref|XP_002790403.1|  ADP-ribosylation factor                            234   3e-75   
gb|KEQ60941.1|  ARF/SAR superfamily                                     234   3e-75   
ref|XP_008610697.1|  ADP-ribosylation factor                            234   3e-75   
gb|KFY84038.1|  hypothetical protein V500_09663                         234   3e-75   
gb|KDB16711.1|  ADP-ribosylation factor                                 234   3e-75   
ref|XP_008896095.1|  ADP-ribosylation factor                            236   3e-75   
gb|KFH64649.1|  ADP-ribosylation factor                                 234   3e-75   
ref|XP_752539.1|  ADP-ribosylation factor                               234   3e-75   
ref|XP_007692073.1|  hypothetical protein COCMIDRAFT_106246             234   3e-75   
ref|XP_006671098.1|  ADP-ribosylation factor                            234   3e-75   
gb|EPQ67144.1|  ADP-ribosylation factor GTPase of the Ras superfa...    234   3e-75   
ref|XP_001797240.1|  hypothetical protein SNOG_06879                    234   3e-75   
gb|EPS65320.1|  hypothetical protein M569_09462                         232   3e-75   
ref|XP_001210450.1|  ADP-ribosylation factor                            234   3e-75   
gb|ELR01747.1|  ADP-ribosylation factor                                 234   3e-75   
emb|CEG74858.1|  Putative ADP-ribosylation factor                       234   4e-75   
emb|CAN71086.1|  hypothetical protein VITISV_006303                     233   4e-75   
gb|EYE95405.1|  ARF/SAR superfamily                                     234   4e-75   
ref|XP_001269102.1|  ADP-ribosylation factor, putative                  234   4e-75   
ref|XP_006962569.1|  ADP-ribosylation factor GTPase of the ras su...    234   4e-75   
gb|KJB82424.1|  hypothetical protein B456_013G208600                    233   4e-75   
ref|XP_002286443.1|  adp-ribosylation factor                            234   5e-75   
ref|XP_001392486.1|  ADP-ribosylation factor                            234   5e-75   
gb|KEY71043.1|  hypothetical protein S7711_00867                        234   5e-75   
ref|XP_007828274.1|  ADP-ribosylation factor                            234   5e-75   
ref|XP_009495037.1|  arf/Sar family, other                              236   6e-75   
dbj|GAM83579.1|  hypothetical protein ANO11243_015670                   234   6e-75   
gb|AGT16095.1|  ADP-ribosylation factor                                 233   6e-75   
emb|CDY23500.1|  BnaC06g24690D                                          234   6e-75   
gb|EWM26802.1|  adp-ribosylation factor                                 233   6e-75   
gb|KGK37938.1|  hypothetical protein JL09_g2915                         233   7e-75   
ref|XP_001386620.1|  hypothetical protein PICST_79956                   233   7e-75   
ref|XP_006675831.1|  ADP-Ribosylation factor                            233   9e-75   
ref|XP_009226423.1|  ADP-ribosylation factor                            233   9e-75   
gb|KHJ35367.1|  putative adp-ribosylation factor                        233   1e-74   
ref|XP_658730.1|  ARF_AJECA ADP-RIBOSYLATION FACTOR                     233   1e-74   
gb|KIO32788.1|  hypothetical protein M407DRAFT_95874                    233   1e-74   
ref|XP_009269147.1|  ADP-ribosylation factor                            232   2e-74   
ref|XP_002585174.1|  ADP-ribosylation factor                            233   2e-74   
emb|CDR39163.1|  CYFA0S03e00342g1_1                                     232   2e-74   
ref|XP_001837013.1|  ADP-ribosylation factor Arf1                       232   2e-74   
emb|CBJ48963.1|  Arf1, ARF family GTPase                                232   2e-74   
gb|EKV18057.1|  hypothetical protein PDIP_28470                         232   2e-74   
ref|XP_723175.1|  potential ADP-ribosylation factor                     232   2e-74   
ref|XP_002618500.1|  ADP-ribosylation factor 1                          232   2e-74   
ref|XP_007373512.1|  hypothetical protein SPAPADRAFT_59312              231   2e-74   
ref|XP_009367578.1|  PREDICTED: ADP-ribosylation factor 2-like is...    232   3e-74   
gb|EMS22909.1|  ADP-ribosylation factor                                 232   3e-74   
gb|AAP80740.1|  ADP-ribosylation factor 1                               232   3e-74   
dbj|GAD95122.1|  ADP-ribosylation factor, putative                      232   3e-74   
emb|CEJ85970.1|  Putative ADP-ribosylation factor                       232   3e-74   
emb|CCI50104.1|  unnamed protein product                                232   3e-74   
ref|XP_005703144.1|  ADP-ribosylation factor                            232   3e-74   
ref|XP_009367594.1|  PREDICTED: ADP-ribosylation factor 2-like is...    232   3e-74   
ref|XP_002559517.1|  Pc13g10970                                         232   3e-74   
ref|XP_459420.1|  DEHA2E02002p                                          232   3e-74   
gb|EJU06117.1|  ARF/SAR                                                 232   3e-74   
ref|XP_001386074.1|  hypothetical protein PICST_62979                   231   3e-74   
gb|EUB59848.1|  ADP-ribosylation factor                                 232   3e-74   
gb|KDD76860.1|  ADP-ribosylation factor                                 231   3e-74   
gb|EWC44149.1|  ADP-ribosylation factor 1                               231   3e-74   
ref|XP_007268416.1|  ARF/SAR                                            231   4e-74   
ref|XP_005706095.1|  ADP-ribosylation factor                            231   4e-74   
gb|KIM91090.1|  hypothetical protein PILCRDRAFT_811607                  231   4e-74   
gb|KDQ20587.1|  hypothetical protein BOTBODRAFT_26592                   231   4e-74   
ref|XP_005830635.1|  hypothetical protein GUITHDRAFT_95331              231   4e-74   
gb|KII94939.1|  hypothetical protein PLICRDRAFT_97075                   231   5e-74   
gb|KJB43808.1|  hypothetical protein B456_007G217400                    231   5e-74   
ref|XP_002177519.1|  predicted protein                                  231   5e-74   
gb|KJB43807.1|  hypothetical protein B456_007G217400                    231   5e-74   
ref|XP_003070170.1|  ADP-ribosylation factor family protein             231   5e-74   
ref|XP_009035447.1|  ADP-ribosylation factor                            231   5e-74   
ref|XP_006959545.1|  ARF/SAR                                            231   5e-74   
gb|AFW79620.1|  hypothetical protein ZEAMMB73_444016                    229   5e-74   
ref|XP_007376194.1|  hypothetical protein SPAPADRAFT_61980              231   6e-74   
ref|XP_002839805.1|  hypothetical protein                               231   6e-74   
ref|XP_002619854.1|  ADP-ribosylation factor 1                          231   6e-74   
ref|XP_001634219.1|  predicted protein                                  231   6e-74   
gb|KDN47361.1|  ARF/SAR                                                 231   7e-74   
ref|XP_003868774.1|  Arf2 ADP-ribosylation factor                       231   7e-74   
gb|KEZ44483.1|  hypothetical protein SAPIO_CDS3496                      231   7e-74   
emb|CDO71404.1|  hypothetical protein BN946_scf184908.g162              231   7e-74   
gb|KEP55349.1|  ADP-ribosylation factor Arf1                            232   7e-74   
gb|EUC66412.1|  ADP-ribosylation factor Arf1                            232   8e-74   
ref|XP_007803162.1|  ADP-ribosylation factor                            231   8e-74   
gb|KIL70197.1|  hypothetical protein M378DRAFT_96593                    231   9e-74   
ref|XP_007302431.1|  ARF/SAR                                            231   9e-74   
gb|KCW59480.1|  hypothetical protein EUGRSUZ_H02224                     231   9e-74   
gb|KDP31993.1|  hypothetical protein JCGZ_12454                         230   1e-73   
gb|AFW78461.1|  hypothetical protein ZEAMMB73_418055                    229   1e-73   
gb|KIR49173.1|  ADP-ribosylation factor                                 230   1e-73   
ref|XP_003975384.1|  PREDICTED: ADP-ribosylation factor 1-like 2-...    230   1e-73   
emb|CDH53772.1|  adp-ribosylation factor 2-like                         230   1e-73   
gb|EPS25841.1|  hypothetical protein PDE_00777                          230   1e-73   
ref|XP_011276692.1|  ADP-ribosylation factor 1                          230   1e-73   
ref|XP_010070606.1|  PREDICTED: ADP-ribosylation factor 1-like          230   1e-73   
ref|XP_007413478.1|  hypothetical protein MELLADRAFT_117357             230   1e-73   
ref|XP_003307076.1|  ADP-ribosylation factor                            230   1e-73   
gb|EIF48368.1|  adp-ribosylation factor                                 229   1e-73   
ref|XP_001877050.1|  predicted protein                                  230   1e-73   
emb|CCM05575.1|  predicted protein                                      230   1e-73   
ref|XP_007873034.1|  hypothetical protein PNEG_01119                    230   1e-73   
gb|KIR88675.1|  ADP-ribosylation factor                                 230   1e-73   
ref|XP_002307284.1|  ADP-ribosylation factor family protein             230   1e-73   
ref|XP_002371620.1|  ADP ribosylation factor 1                          230   1e-73   
gb|KIY49393.1|  ADP-ribosylation facter                                 230   1e-73   
gb|AAF35891.1|AF227524_1  ADP ribosylation factor 1                     230   1e-73   
gb|EXX72896.1|  Arf2p                                                   230   1e-73   
gb|KHG29570.1|  ADP-ribosylation factor 2                               229   1e-73   
ref|XP_003036735.1|  ADP-ribosylation facter                            230   1e-73   
ref|XP_008391498.1|  PREDICTED: ADP-ribosylation factor 2-like          230   2e-73   
gb|EFX02468.1|  ADP-ribosylation factor                                 230   2e-73   
gb|KIK44238.1|  hypothetical protein CY34DRAFT_802845                   230   2e-73   
ref|XP_007861708.1|  ARF/SAR protein                                    230   2e-73   
gb|ESX02015.1|  ADP-ribosylation factor 1                               230   2e-73   
ref|XP_007846256.1|  adp-ribosylation factor                            230   2e-73   
ref|XP_011099095.1|  PREDICTED: ADP-ribosylation factor 1-like          229   2e-73   
gb|EPT03609.1|  ARF/SAR protein                                         229   2e-73   
ref|XP_002174014.1|  ADP-ribosylation factor                            229   2e-73   
ref|XP_009620631.1|  PREDICTED: ADP-ribosylation factor 2-B-like        229   2e-73   
gb|KDQ64318.1|  hypothetical protein JAAARDRAFT_27945                   229   2e-73   
ref|XP_007382404.1|  ARF/SAR                                            229   2e-73   
ref|XP_007364157.1|  ARF/SAR                                            229   2e-73   
ref|XP_001730296.1|  hypothetical protein MGL_2678                      229   2e-73   
ref|XP_007205981.1|  hypothetical protein PRUPE_ppa012138mg             229   3e-73   
ref|XP_008238827.1|  PREDICTED: ADP-ribosylation factor 1-like          229   3e-73   
ref|XP_791037.1|  PREDICTED: ADP-ribosylation factor 1-like             229   3e-73   
dbj|GAM41493.1|  ADP-ribosylation factor                                229   3e-73   
ref|XP_009015604.1|  hypothetical protein HELRODRAFT_64136              229   3e-73   
emb|CCU97464.1|  unnamed protein product                                229   3e-73   
emb|CAN59803.1|  hypothetical protein VITISV_038875                     229   3e-73   
emb|CDP02537.1|  unnamed protein product                                229   4e-73   
ref|XP_007882123.1|  hypothetical protein PFL1_06914                    229   4e-73   
ref|XP_636353.1|  ADP-ribosylation factor                               229   4e-73   
ref|XP_004592558.1|  PREDICTED: ADP-ribosylation factor 5               229   4e-73   
ref|XP_002848567.1|  ADP-ribosylation factor                            229   4e-73   
gb|EPZ32912.1|  ADP-ribosylation factor                                 229   4e-73   
gb|KIY74215.1|  ARF/SAR superfamily                                     229   5e-73   
ref|XP_002151474.1|  ADP-ribosylation factor, putative                  229   5e-73   
emb|CDK29565.1|  unnamed protein product                                229   5e-73   
ref|XP_007047386.1|  ADP-ribosylation factor A1F isoform 2              229   5e-73   
gb|EGD99827.1|  ADP-ribosylation factor                                 228   6e-73   
ref|XP_003293580.1|  ADP-ribosylation factor 1                          228   6e-73   
ref|XP_003231686.1|  ADP-ribosylation factor                            228   6e-73   
emb|CCA21601.1|  ADPribosylation factor family putative                 234   6e-73   
ref|XP_572032.1|  ARF small monomeric GTPase                            228   6e-73   
emb|CCA21603.1|  ADPribosylation factor family putative                 234   6e-73   
ref|XP_002524920.1|  ADP-ribosylation factor, arf, putative             228   6e-73   
gb|EJT48679.1|  ARF small monomeric GTPase                              228   7e-73   
ref|XP_002634374.1|  C. briggsae CBR-ARF-3 protein                      228   7e-73   
emb|CAF98439.1|  unnamed protein product                                228   7e-73   
emb|CCA21602.1|  ADPribosylation factor family putative                 233   8e-73   
emb|CCA21604.1|  ADPribosylation factor family putative                 233   8e-73   
ref|XP_002341722.1|  ADP-ribosylation factor, putative                  228   8e-73   
emb|CDJ41618.1|  ADP ribosylation factor 1, putative                    228   8e-73   
emb|CDJ56817.1|  ADP ribosylation factor 1, putative                    228   8e-73   
ref|XP_004204777.1|  Piso0_000052                                       228   9e-73   
gb|ABV22434.1|  ADP-ribosylation factor 1                               228   9e-73   
gb|AAX51847.1|  ADP-ribosylation factor                                 228   9e-73   
ref|NP_596118.1|  ADP-ribosylation factor, Arf family Arf1              228   9e-73   
gb|KIJ70131.1|  hypothetical protein HYDPIDRAFT_143136                  228   1e-72   
ref|XP_011115839.1|  hypothetical protein H072_10361                    228   1e-72   
ref|XP_002740964.1|  PREDICTED: ADP-ribosylation factor 1-like is...    228   1e-72   
emb|CCI50103.1|  unnamed protein product                                228   1e-72   
gb|EFA83987.1|  ADP-ribosylation factor                                 228   1e-72   
ref|XP_457567.1|  DEHA2B14322p                                          228   1e-72   
ref|XP_003611669.1|  ADP-ribosylation factor                            228   1e-72   
ref|NP_956170.1|  ADP-ribosylation factor 4                             228   1e-72   
ref|XP_003174397.1|  ADP-ribosylation factor                            228   1e-72   
ref|XP_009028190.1|  hypothetical protein HELRODRAFT_186077             228   1e-72   
ref|NP_001082540.1|  ADP-ribosylation factor 4                          228   1e-72   
emb|CAG31674.1|  hypothetical protein RCJMB04_9i5                       228   1e-72   
emb|CBY18999.1|  unnamed protein product                                228   1e-72   
gb|ELU00694.1|  hypothetical protein CAPTEDRAFT_4023                    228   1e-72   
ref|XP_006339849.1|  PREDICTED: ADP-ribosylation factor 2-B-like        228   1e-72   
gb|KIO12637.1|  hypothetical protein M404DRAFT_124073                   228   1e-72   
ref|XP_008312304.1|  PREDICTED: ADP-ribosylation factor 1-like          227   2e-72   
gb|EDL34206.1|  ADP-ribosylation factor 2, isoform CRA_b                226   2e-72   
gb|KFG58001.1|  ADP ribosylation factor ARF1                            238   2e-72   
gb|KFG47556.1|  ADP ribosylation factor ARF1                            238   2e-72   
gb|EPR59241.1|  ADP ribosylation factor ARF1                            238   2e-72   
ref|NP_001025648.1|  ADP-ribosylation factor 4                          227   2e-72   
gb|EPT31929.1|  ADP ribosylation factor ARF1                            238   2e-72   
ref|XP_007425297.1|  PREDICTED: ADP-ribosylation factor 4               227   2e-72   
ref|NP_501336.1|  Protein ARF-3                                         227   2e-72   
ref|XP_011008774.1|  PREDICTED: ADP-ribosylation factor 1-like          227   2e-72   
ref|XP_010244258.1|  PREDICTED: ADP-ribosylation factor 2-like          227   2e-72   



>gb|KHG04267.1| ADP-ribosylation factor [Gossypium arboreum]
Length=237

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KJB11520.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=183

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006386699.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 gb|ERP64496.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 gb|KDO86879.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KJB41775.1| hypothetical protein B456_007G120600 [Gossypium raimondii]
Length=153

 Score =   251 bits (642),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>sp|O48920.3|ARF_VIGUN RecName: Full=ADP-ribosylation factor [Vigna unguiculata]
 gb|AAB91395.1| ADP-ribosylation factor [Vigna unguiculata]
Length=181

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009612443.1| PREDICTED: ADP-ribosylation factor [Nicotiana tomentosiformis]
Length=181

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002521452.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|EEF40942.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
Length=181

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ACJ84691.1| unknown [Medicago truncatula]
 gb|AFK35530.1| unknown [Medicago truncatula]
 gb|AES82227.2| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
Length=181

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>sp|P51822.2|ARF1_DAUCA RecName: Full=ADP-ribosylation factor 1 [Daucus carota]
 dbj|BAA08259.1| ADP-ribosylation factor [Daucus carota]
Length=181

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002318935.1| hypothetical protein POPTR_0013s00700g [Populus trichocarpa]
 ref|XP_003553934.1| PREDICTED: ADP-ribosylation factor isoform 3 [Glycine max]
 ref|XP_006382311.1| hypothetical protein POPTR_0005s00910g [Populus trichocarpa]
 ref|XP_006375716.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 ref|XP_006375717.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_009757514.1| PREDICTED: ADP-ribosylation factor [Nicotiana sylvestris]
 ref|XP_010550140.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010550141.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554051.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554052.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010554053.1| PREDICTED: ADP-ribosylation factor [Tarenaya hassleriana]
 ref|XP_010672580.1| PREDICTED: ADP-ribosylation factor [Beta vulgaris subsp. vulgaris]
 ref|XP_011023829.1| PREDICTED: ADP-ribosylation factor isoform X1 [Populus euphratica]
 ref|XP_011023830.1| PREDICTED: ADP-ribosylation factor isoform X2 [Populus euphratica]
 ref|XP_011023831.1| PREDICTED: ADP-ribosylation factor isoform X3 [Populus euphratica]
 ref|XP_011023832.1| PREDICTED: ADP-ribosylation factor isoform X4 [Populus euphratica]
 ref|XP_011038984.1| PREDICTED: ADP-ribosylation factor [Populus euphratica]
 gb|ABK93177.1| unknown [Populus trichocarpa]
 gb|ABK93657.1| unknown [Populus trichocarpa]
 gb|ABK95673.1| unknown [Populus trichocarpa]
 gb|EEE94858.1| hypothetical protein POPTR_0013s00700g [Populus trichocarpa]
 gb|ERP53513.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 gb|ERP53514.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP60108.1| hypothetical protein POPTR_0005s00910g [Populus trichocarpa]
 gb|KHN23524.1| ADP-ribosylation factor [Glycine soja]
 gb|KHN27442.1| ADP-ribosylation factor [Glycine soja]
 gb|KJB11517.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
 gb|KJB11519.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
 gb|KJB11521.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=181

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002457613.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
 gb|EES02733.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
Length=181

 Score =   252 bits (644),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_003536036.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Glycine max]
 ref|XP_006589106.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Glycine max]
 ref|XP_006589107.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Glycine max]
 ref|XP_006589108.1| PREDICTED: ADP-ribosylation factor-like isoform X4 [Glycine max]
Length=181

 Score =   252 bits (644),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAT08648.1| ADP-ribosylation factor [Hyacinthus orientalis]
Length=199

 Score =   253 bits (646),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  19   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  78

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  79   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  138

Query  467  LLV  475
            LLV
Sbjct  139  LLV  141



>ref|XP_002302788.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 ref|XP_002320274.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_002264654.1| PREDICTED: ADP-ribosylation factor [Vitis vinifera]
 ref|XP_002281047.1| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
 ref|XP_002515227.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 ref|XP_002515230.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 ref|XP_003518676.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 ref|XP_003535875.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 ref|XP_003555789.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Glycine 
max]
 ref|XP_003555790.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Glycine 
max]
 ref|XP_003591352.1| ADP ribosylation factor [Medicago truncatula]
 ref|XP_003632415.1| PREDICTED: ADP-ribosylation factor [Vitis vinifera]
 ref|XP_004135977.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 ref|XP_004169278.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 ref|XP_004302301.1| PREDICTED: ADP-ribosylation factor-like [Fragaria vesca subsp. 
vesca]
 ref|XP_004495884.1| PREDICTED: ADP-ribosylation factor 2-like [Cicer arietinum]
 ref|XP_006386700.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006382312.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006375425.1| hypothetical protein POPTR_0014s11180g [Populus trichocarpa]
 ref|XP_006428233.1| hypothetical protein CICLE_v10012898mg [Citrus clementina]
 ref|XP_006444563.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006444564.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006444565.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 ref|XP_006480701.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006492378.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492379.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_007051216.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007145024.1| hypothetical protein PHAVU_007G203600g [Phaseolus vulgaris]
 ref|XP_007145120.1| hypothetical protein PHAVU_007G211700g [Phaseolus vulgaris]
 ref|XP_007163209.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 ref|XP_007163210.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 ref|XP_007205795.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 ref|XP_008246262.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
 ref|XP_008353867.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 ref|XP_008362551.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 ref|XP_008461403.1| PREDICTED: ADP-ribosylation factor-like [Cucumis melo]
 ref|XP_008461404.1| PREDICTED: ADP-ribosylation factor-like [Cucumis melo]
 ref|XP_010042229.1| PREDICTED: ADP-ribosylation factor-like [Eucalyptus grandis]
 ref|XP_010270872.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270873.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270874.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270875.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270882.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270883.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010270884.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010276502.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_010276503.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
 ref|XP_011040695.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011038982.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011038983.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
 ref|XP_011003176.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011003177.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011079513.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011079514.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011092180.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 ref|XP_011092181.1| PREDICTED: ADP-ribosylation factor [Sesamum indicum]
 gb|ABB03801.1| ADP ribosylation factor 002 [Daucus carota]
 gb|ABK93146.1| unknown [Populus trichocarpa]
 gb|ABK93165.1| unknown [Populus trichocarpa]
 gb|ACJ84391.1| unknown [Medicago truncatula]
 gb|EEE82061.1| hypothetical protein POPTR_0002s19210g [Populus trichocarpa]
 gb|EEE98589.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|EEF47211.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|EEF47214.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gb|AEA92306.1| Arf2 [Hevea brasiliensis]
 gb|AES61603.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AFK34270.1| unknown [Medicago truncatula]
 gb|AFS50009.1| hypothetical protein [Dendrobium catenatum]
 gb|EMJ06994.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 gb|EOX95373.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|ERP53222.1| hypothetical protein POPTR_0014s11180g [Populus trichocarpa]
 gb|ERP60109.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP64497.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ESR41473.1| hypothetical protein CICLE_v10012898mg [Citrus clementina]
 gb|ESR57803.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESR57804.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESR57805.1| hypothetical protein CICLE_v10022488mg [Citrus clementina]
 gb|ESW17018.1| hypothetical protein PHAVU_007G203600g [Phaseolus vulgaris]
 gb|ESW17114.1| hypothetical protein PHAVU_007G211700g [Phaseolus vulgaris]
 gb|ESW35203.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 gb|ESW35204.1| hypothetical protein PHAVU_001G215400g [Phaseolus vulgaris]
 gb|KDO86877.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KDO86878.1| hypothetical protein CISIN_1g030191mg [Citrus sinensis]
 gb|KGN45043.1| hypothetical protein Csa_7G414405 [Cucumis sativus]
 gb|KHG07003.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHG09762.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHG21203.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KHN00327.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN02820.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KJB22479.1| hypothetical protein B456_004G049700 [Gossypium raimondii]
 gb|KJB24450.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
 gb|KJB24451.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
 gb|KJB41774.1| hypothetical protein B456_007G120600 [Gossypium raimondii]
 gb|KJB49771.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
 gb|KJB49772.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
 gb|KJB49773.1| hypothetical protein B456_008G137100 [Gossypium raimondii]
Length=181

 Score =   252 bits (644),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_011003178.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Populus euphratica]
Length=181

 Score =   252 bits (644),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KDP28302.1| hypothetical protein JCGZ_14073 [Jatropha curcas]
Length=181

 Score =   252 bits (644),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KHN00225.1| ADP-ribosylation factor 2 [Glycine soja]
Length=184

 Score =   252 bits (644),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006840725.1| hypothetical protein AMTR_s00096p00110370 [Amborella trichopoda]
 gb|ERN02400.1| hypothetical protein AMTR_s00096p00110370 [Amborella trichopoda]
Length=188

 Score =   252 bits (644),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AFW67226.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=241

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 127/133 (95%), Gaps = 3/133 (2%)
 Frame = +2

Query  77   FTCDSVDI*NMGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG  256
            F C+  +   MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG
Sbjct  46   FGCEREE---MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG  102

Query  257  FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRM  436
            FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRM
Sbjct  103  FNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRM  162

Query  437  LNEDELRDAVLLV  475
            LNEDELRDAVLLV
Sbjct  163  LNEDELRDAVLLV  175



>gb|KJB24452.1| hypothetical protein B456_004G146100 [Gossypium raimondii]
Length=184

 Score =   252 bits (644),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_011040674.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011040681.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011040689.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
Length=189

 Score =   252 bits (644),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010524305.1| PREDICTED: ADP-ribosylation factor-like [Tarenaya hassleriana]
Length=181

 Score =   252 bits (643),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010092942.1| ADP-ribosylation factor 2 [Morus notabilis]
 gb|EXB52995.1| ADP-ribosylation factor 2 [Morus notabilis]
Length=188

 Score =   252 bits (644),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_011038977.1| PREDICTED: ADP-ribosylation factor-like [Populus euphratica]
 ref|XP_011038978.1| PREDICTED: ADP-ribosylation factor-like [Populus euphratica]
 ref|XP_011038980.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
 ref|XP_011038981.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Populus euphratica]
Length=183

 Score =   252 bits (643),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_008777957.1| PREDICTED: ADP-ribosylation factor [Phoenix dactylifera]
 ref|XP_008777958.1| PREDICTED: ADP-ribosylation factor [Phoenix dactylifera]
 ref|XP_010914673.1| PREDICTED: ADP-ribosylation factor-like [Elaeis guineensis]
 ref|XP_010914674.1| PREDICTED: ADP-ribosylation factor-like [Elaeis guineensis]
 gb|ACL67836.1| ADP ribosylation factor [Jatropha curcas]
 gb|KDP23360.1| hypothetical protein JCGZ_23193 [Jatropha curcas]
Length=181

 Score =   252 bits (643),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>emb|CBI25984.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   253 bits (646),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  31   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  90

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  91   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  150

Query  467  LLV  475
            LLV
Sbjct  151  LLV  153



>ref|XP_006480700.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
Length=183

 Score =   252 bits (643),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_003626009.1| ADP-ribosylation factor-like protein [Medicago truncatula]
Length=206

 Score =   253 bits (645),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KJB11518.1| hypothetical protein B456_001G263300 [Gossypium raimondii]
Length=205

 Score =   253 bits (645),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  25   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  84

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  85   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  144

Query  467  LLV  475
            LLV
Sbjct  145  LLV  147



>ref|XP_004494449.1| PREDICTED: ADP-ribosylation factor 2-like [Cicer arietinum]
 ref|XP_011092183.1| PREDICTED: ADP-ribosylation factor-like [Sesamum indicum]
Length=181

 Score =   252 bits (643),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010659724.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
Length=183

 Score =   252 bits (643),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AFW67224.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=206

 Score =   253 bits (645),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004981305.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Setaria italica]
Length=213

 Score =   253 bits (645),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ACU16903.1| unknown [Glycine max]
Length=204

 Score =   252 bits (644),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KDO66124.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
Length=189

 Score =   252 bits (643),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010941504.1| PREDICTED: ADP-ribosylation factor [Elaeis guineensis]
Length=181

 Score =   251 bits (642),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EPS68301.1| hypothetical protein M569_06468, partial [Genlisea aurea]
Length=180

 Score =   251 bits (642),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV+EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVIEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010674549.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score =   251 bits (642),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KDO72117.1| hypothetical protein CISIN_1g030193mg [Citrus sinensis]
Length=153

 Score =   250 bits (639),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010679455.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679456.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679457.1| PREDICTED: ADP-ribosylation factor 2-B-like [Beta vulgaris subsp. 
vulgaris]
Length=181

 Score =   251 bits (641),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010108788.1| ADP-ribosylation factor [Morus notabilis]
 gb|EXC20303.1| ADP-ribosylation factor [Morus notabilis]
Length=185

 Score =   251 bits (642),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009389142.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389143.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389144.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389145.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 gb|KJB75876.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
 gb|KJB75877.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
Length=181

 Score =   251 bits (641),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_007031496.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007215053.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 ref|XP_007215054.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 ref|XP_008379235.1| PREDICTED: ADP-ribosylation factor [Malus domestica]
 gb|EMJ16252.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 gb|EMJ16253.1| hypothetical protein PRUPE_ppa012153mg [Prunus persica]
 gb|EOY02422.1| ADP-ribosylation factor A1F [Theobroma cacao]
Length=181

 Score =   251 bits (641),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KHG02135.1| ADP-ribosylation factor [Gossypium arboreum]
Length=209

 Score =   252 bits (644),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KHG04030.1| ADP-ribosylation factor 2 [Gossypium arboreum]
 gb|KJB15573.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
 gb|KJB15574.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
 gb|KJB15577.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
Length=181

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ADB85106.1| ADP ribosylation factor 002 [Jatropha curcas]
Length=181

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001105897.1| ADP-ribosylation factor [Zea mays]
 sp|P49076.2|ARF_MAIZE RecName: Full=ADP-ribosylation factor [Zea mays]
 emb|CAA56351.1| ADP-ribosylation factor [Zea mays]
Length=181

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AFW67223.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
Length=183

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EYU46850.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
Length=153

 Score =   250 bits (639),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_003618209.1| ADP-ribosylation factor [Medicago truncatula]
 ref|XP_004142795.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004142796.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156684.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156685.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004304634.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_004489257.1| PREDICTED: ADP-ribosylation factor 1-like [Cicer arietinum]
 ref|XP_006470306.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470307.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_008230584.1| PREDICTED: ADP-ribosylation factor 1 [Prunus mume]
 ref|XP_008341441.1| PREDICTED: ADP-ribosylation factor 1 [Malus domestica]
 ref|XP_008341442.1| PREDICTED: ADP-ribosylation factor 1 [Malus domestica]
 ref|XP_008458781.1| PREDICTED: ADP-ribosylation factor 1 [Cucumis melo]
 ref|XP_009334096.1| PREDICTED: ADP-ribosylation factor 1 [Pyrus x bretschneideri]
 ref|XP_009334097.1| PREDICTED: ADP-ribosylation factor 1 [Pyrus x bretschneideri]
 ref|XP_010029154.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010029155.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010029156.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010033289.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 ref|XP_010033290.1| PREDICTED: ADP-ribosylation factor 1 [Eucalyptus grandis]
 gb|AAR29293.1| ADP-ribosylation factor [Medicago sativa]
 emb|CAI29265.1| ADP-ribosylation factor 1 [Medicago truncatula]
 gb|AES74427.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AEV66152.1| ADP-ribosylation factor [Arachis hypogaea]
 gb|AFK42113.1| unknown [Medicago truncatula]
 gb|AFK44737.1| unknown [Lotus japonicus]
 gb|KCW56003.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56004.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56005.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KCW56006.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
 gb|KDO66122.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
 gb|KDO66123.1| hypothetical protein CISIN_1g029675mg [Citrus sinensis]
 gb|KGN59678.1| hypothetical protein Csa_3G837590 [Cucumis sativus]
Length=181

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001051676.1| Os03g0811900 [Oryza sativa Japonica Group]
 ref|XP_006650781.1| PREDICTED: ADP-ribosylation factor 1-like [Oryza brachyantha]
 gb|AAP73857.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 gb|ABF99500.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99501.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99504.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13590.1| Os03g0811900 [Oryza sativa Japonica Group]
 emb|CCI55417.1| PH01B015M02.18 [Phyllostachys edulis]
Length=181

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010248146.1| PREDICTED: ADP-ribosylation factor [Nelumbo nucifera]
Length=181

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006488769.1| PREDICTED: ADP-ribosylation factor-like [Citrus sinensis]
 gb|KDO72116.1| hypothetical protein CISIN_1g030193mg [Citrus sinensis]
Length=181

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KJB75878.1| hypothetical protein B456_012G062700 [Gossypium raimondii]
Length=191

 Score =   251 bits (642),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>emb|CDP13175.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   252 bits (644),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002466220.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
 ref|XP_010227861.1| PREDICTED: ADP-ribosylation factor [Brachypodium distachyon]
 gb|EER93218.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
Length=181

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EYU46846.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46847.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46848.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
 gb|EYU46849.1| hypothetical protein MIMGU_mgv1a014704mg [Erythranthe guttata]
Length=181

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001275425.1| ADP-ribosylation factor 2-like [Solanum tuberosum]
 gb|ABA40446.1| unknown [Solanum tuberosum]
Length=181

 Score =   251 bits (641),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AEX49947.1| ADP-ribosylation factor 1 [Haloxylon ammodendron]
Length=181

 Score =   251 bits (641),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KCW56002.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
Length=190

 Score =   251 bits (642),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ACF80896.1| unknown [Zea mays]
 gb|AFW67225.1| ADP-ribosylation factor [Zea mays]
Length=181

 Score =   251 bits (641),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004304633.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   251 bits (641),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006361664.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361665.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006361666.1| PREDICTED: ADP-ribosylation factor 2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_009604530.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009604531.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009762302.1| PREDICTED: ADP-ribosylation factor 2-like [Nicotiana sylvestris]
Length=181

 Score =   251 bits (641),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001236384.1| uncharacterized protein LOC100306021 [Glycine max]
 ref|XP_003517709.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Glycine 
max]
 ref|XP_003519837.1| PREDICTED: ADP-ribosylation factor 2-like isoformX1 [Glycine 
max]
 ref|XP_003557055.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Glycine 
max]
 ref|XP_004135254.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004165817.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004238652.1| PREDICTED: ADP-ribosylation factor 2 [Solanum lycopersicum]
 ref|XP_006356427.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006574623.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Glycine 
max]
 ref|XP_007044675.1| ADP-ribosylation factor A1F [Theobroma cacao]
 ref|XP_007153744.1| hypothetical protein PHAVU_003G061400g [Phaseolus vulgaris]
 ref|XP_007223549.1| hypothetical protein PRUPE_ppa012160mg [Prunus persica]
 ref|XP_008221835.1| PREDICTED: ADP-ribosylation factor 2 [Prunus mume]
 ref|XP_008389663.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Malus domestica]
 ref|XP_008340051.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Malus domestica]
 ref|XP_008446200.1| PREDICTED: ADP-ribosylation factor 2 [Cucumis melo]
 ref|XP_008776867.1| PREDICTED: ADP-ribosylation factor 2 [Phoenix dactylifera]
 ref|XP_008776868.1| PREDICTED: ADP-ribosylation factor 2 [Phoenix dactylifera]
 ref|XP_009622926.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana tomentosiformis]
 ref|XP_009629759.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009759206.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana sylvestris]
 ref|XP_009758092.1| PREDICTED: ADP-ribosylation factor 2 [Nicotiana sylvestris]
 ref|XP_010029157.1| PREDICTED: ADP-ribosylation factor 2 [Eucalyptus grandis]
 ref|XP_010552645.1| PREDICTED: ADP-ribosylation factor 2 [Tarenaya hassleriana]
 ref|XP_010904967.1| PREDICTED: ADP-ribosylation factor 2 [Elaeis guineensis]
 ref|XP_011071092.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 ref|XP_011071093.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 ref|XP_011086584.1| PREDICTED: ADP-ribosylation factor 2 [Sesamum indicum]
 gb|ACJ85464.1| unknown [Medicago truncatula]
 gb|ACN39752.1| unknown [Picea sitchensis]
 gb|ACN39787.1| unknown [Picea sitchensis]
 gb|ACN41130.1| unknown [Picea sitchensis]
 gb|ACU13997.1| unknown [Glycine max]
 gb|ACU23220.1| unknown [Glycine max]
 gb|AFK34829.1| unknown [Medicago truncatula]
 gb|AFK43802.1| unknown [Lotus japonicus]
 gb|AFK44369.1| unknown [Lotus japonicus]
 gb|AFK46588.1| unknown [Medicago truncatula]
 gb|EMJ24748.1| hypothetical protein PRUPE_ppa012160mg [Prunus persica]
 gb|EOY00507.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|ESW25738.1| hypothetical protein PHAVU_003G061400g [Phaseolus vulgaris]
 gb|EYU22499.1| hypothetical protein MIMGU_mgv1a014705mg [Erythranthe guttata]
 gb|EYU22500.1| hypothetical protein MIMGU_mgv1a014705mg [Erythranthe guttata]
 gb|EYU28446.1| hypothetical protein MIMGU_mgv1a014709mg [Erythranthe guttata]
 gb|KCW56009.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KCW56010.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KCW56011.1| hypothetical protein EUGRSUZ_I01780 [Eucalyptus grandis]
 gb|KEH27753.1| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|AES96177.2| ADP-ribosylation factor-like protein A1D [Medicago truncatula]
 gb|KGN51799.1| hypothetical protein Csa_5G601490 [Cucumis sativus]
 gb|KHN00363.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN12112.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN25534.1| ADP-ribosylation factor 2 [Glycine soja]
 gb|KHN26886.1| ADP-ribosylation factor 2 [Glycine soja]
Length=181

 Score =   251 bits (641),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_007205794.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 gb|EMJ06993.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
Length=243

 Score =   253 bits (646),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  63   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  122

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  123  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  182

Query  467  LLV  475
            LLV
Sbjct  183  LLV  185



>ref|XP_007151018.1| hypothetical protein PHAVU_004G011900g [Phaseolus vulgaris]
 gb|AGZ15424.1| ADP-ribosylation factor 1 [Phaseolus vulgaris]
 gb|ESW23012.1| hypothetical protein PHAVU_004G011900g [Phaseolus vulgaris]
Length=181

 Score =   251 bits (641),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AFK39359.1| unknown [Medicago truncatula]
Length=181

 Score =   251 bits (641),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010943658.1| PREDICTED: ADP-ribosylation factor 2-like [Elaeis guineensis]
Length=181

 Score =   251 bits (641),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ACM67553.1| ADP-ribosylation factor-like protein [Musa acuminata AAA Group]
Length=181

 Score =   251 bits (641),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006399980.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 ref|XP_006399981.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 ref|XP_010420114.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010420115.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010453596.1| PREDICTED: ADP-ribosylation factor [Camelina sativa]
 ref|XP_010492281.1| PREDICTED: ADP-ribosylation factor isoform X2 [Camelina sativa]
 gb|ESQ41433.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
 gb|ESQ41434.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum]
Length=181

 Score =   251 bits (641),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010094415.1| ADP-ribosylation factor 2 [Morus notabilis]
 gb|EXB55996.1| ADP-ribosylation factor 2 [Morus notabilis]
Length=203

 Score =   252 bits (643),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KDP46432.1| hypothetical protein JCGZ_10272 [Jatropha curcas]
Length=181

 Score =   251 bits (640),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001274832.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB16972.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB16982.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum]
 gb|ABB87122.1| ADP-ribosylation factor 1-like [Solanum tuberosum]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_008389662.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Malus domestica]
 ref|XP_008340050.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Malus domestica]
Length=182

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009403841.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_172533.2| ADP-ribosylation factor A1F [Arabidopsis thaliana]
 ref|XP_010475938.1| PREDICTED: ADP-ribosylation factor 1-like [Camelina sativa]
 gb|AAT41759.1| At1g10630 [Arabidopsis thaliana]
 gb|AAT70455.1| At1g10630 [Arabidopsis thaliana]
 dbj|BAE98462.1| similar to ADP-ribosylation factor gb|AAD17207 [Arabidopsis thaliana]
 gb|AEE28611.1| ADP-ribosylation factor A1F [Arabidopsis thaliana]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAF17671.1|AC009398_20 F20B24.7 [Arabidopsis thaliana]
Length=186

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAR18698.1| ADP-ribosylation factor 1 [Populus tomentosa]
Length=195

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002892585.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 ref|XP_007031214.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|EFH68844.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EOY11716.1| ADP-ribosylation factor A1F [Theobroma cacao]
 gb|KHG17086.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
 gb|KHG18341.1| ADP-ribosylation factor 2-B -like protein [Gossypium arboreum]
 gb|KJB81134.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
 gb|KJB81135.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004252939.1| PREDICTED: ADP-ribosylation factor 2 [Solanum lycopersicum]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010674548.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009375124.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009375125.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009377201.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
 ref|XP_009377202.1| PREDICTED: ADP-ribosylation factor 1-like [Pyrus x bretschneideri]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001280835.1| ADP-ribosylation factor [Malus domestica]
 gb|AEX97079.1| ADP-ribosylation factor [Malus domestica]
Length=188

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002871626.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47885.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
Length=183

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KGN51378.1| hypothetical protein Csa_5G524710 [Cucumis sativus]
Length=191

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EYU19417.1| hypothetical protein MIMGU_mgv1a014679mg [Erythranthe guttata]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004288363.1| PREDICTED: ADP-ribosylation factor 2-like [Fragaria vesca subsp. 
vesca]
 ref|XP_007221509.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 ref|XP_007221510.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 ref|XP_008227807.1| PREDICTED: ADP-ribosylation factor 2 [Prunus mume]
 ref|XP_008381455.1| PREDICTED: ADP-ribosylation factor 2-like [Malus domestica]
 ref|XP_009363094.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 ref|XP_009367177.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 ref|XP_009376185.1| PREDICTED: ADP-ribosylation factor 2-like [Pyrus x bretschneideri]
 gb|EMJ22708.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
 gb|EMJ22709.1| hypothetical protein PRUPE_ppa012151mg [Prunus persica]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EYU38402.1| hypothetical protein MIMGU_mgv1a014684mg [Erythranthe guttata]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF+KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFSKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006417443.1| hypothetical protein EUTSA_v10008885mg [Eutrema salsugineum]
 ref|XP_010547797.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 ref|XP_010547805.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 ref|XP_010533952.1| PREDICTED: ADP-ribosylation factor 2-B-like [Tarenaya hassleriana]
 gb|ESQ35796.1| hypothetical protein EUTSA_v10008885mg [Eutrema salsugineum]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010492280.1| PREDICTED: ADP-ribosylation factor isoform X1 [Camelina sativa]
Length=183

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ADP00406.1| ADP-ribosylation factor [Actinidia chinensis]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDA+
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAI  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009121644.1| PREDICTED: ADP-ribosylation factor 2 [Brassica rapa]
 ref|XP_009121645.1| PREDICTED: ADP-ribosylation factor 2 [Brassica rapa]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001290536.1| uncharacterized protein LOC105052388 [Elaeis guineensis]
 ref|XP_006438365.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 ref|XP_006438366.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 ref|XP_006483876.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006483877.1| PREDICTED: ADP-ribosylation factor 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006483878.1| PREDICTED: ADP-ribosylation factor 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006842402.1| hypothetical protein AMTR_s00204p00014880 [Amborella trichopoda]
 ref|XP_008792471.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008792472.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008807332.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008807333.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 gb|AEQ94161.1| ADP-ribosylation factor [Elaeis guineensis]
 gb|ERN04077.1| hypothetical protein AMTR_s00204p00014880 [Amborella trichopoda]
 gb|ESR51605.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
 gb|ESR51606.1| hypothetical protein CICLE_v10032807mg [Citrus clementina]
Length=181

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_177206.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|NP_564195.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 ref|NP_850975.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|NP_974120.1| ARF GTPase family protein [Arabidopsis thaliana]
 ref|XP_002890586.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009127800.1| PREDICTED: ADP-ribosylation factor 2-B isoform X2 [Brassica rapa]
 ref|XP_009127801.1| PREDICTED: ADP-ribosylation factor 2-B isoform X2 [Brassica rapa]
 ref|XP_009103171.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_009103173.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_010498859.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010415728.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010415729.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010427826.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010427827.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010460136.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010471043.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010471044.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 ref|XP_010477643.1| PREDICTED: ADP-ribosylation factor 2-B [Camelina sativa]
 sp|P0DH91.1|ARF2B_ARATH RecName: Full=ADP-ribosylation factor 2-B; Short=AtARF2; AltName: 
Full=ARF1-like protein U5 [Arabidopsis thaliana]
 sp|Q9LQC8.2|ARF2A_ARATH RecName: Full=ADP-ribosylation factor 2-A; Short=AtARF2 [Arabidopsis 
thaliana]
 gb|AAG40035.1|AF324684_1 At1g23490 [Arabidopsis thaliana]
 gb|AAG40377.1|AF325025_1 At1g70490 [Arabidopsis thaliana]
 gb|AAG42921.1|AF329504_1 putative ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAG52463.1|AC010796_2 putative ADP-ribosylation factor 1; 15065-14075 [Arabidopsis 
thaliana]
 gb|AAK25874.1|AF360164_1 putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAK49591.1|AF372875_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gb|AAK49617.1|AF372901_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gb|AAL07190.1| putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAL15357.1| At1g23490/F5O8_5 [Arabidopsis thaliana]
 gb|AAM44988.1| putative ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAM64791.1| ADP-ribosylation factor 1-like [Arabidopsis thaliana]
 gb|EFH66845.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30394.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AEE35068.1| ARF GTPase family protein [Arabidopsis thaliana]
 gb|AEE35069.1| ARF GTPase family protein [Arabidopsis thaliana]
 gb|AEE35070.1| ARF GTPase family protein [Arabidopsis thaliana]
 emb|CDY54291.1| BnaC07g48320D [Brassica napus]
 emb|CDY44152.1| BnaA09g31000D [Brassica napus]
 emb|CDY25787.1| BnaA07g09950D [Brassica napus]
 emb|CDY11588.1| BnaC06g31510D [Brassica napus]
 emb|CDY09441.1| BnaC02g19830D [Brassica napus]
 emb|CDY04706.1| BnaC05g18830D [Brassica napus]
 emb|CDY03747.1| BnaA02g14900D [Brassica napus]
Length=181

 Score =   250 bits (639),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EAZ29027.1| hypothetical protein OsJ_13076 [Oryza sativa Japonica Group]
Length=184

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KJB82421.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
Length=204

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004981304.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Setaria italica]
Length=230

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  18   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  77

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  78   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  137

Query  467  LLV  475
            LLV
Sbjct  138  LLV  140



>gb|ABF99502.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica 
Group]
Length=194

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009393904.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393905.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   250 bits (639),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KDP26602.1| hypothetical protein JCGZ_17760 [Jatropha curcas]
Length=181

 Score =   250 bits (639),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ADH44695.1| ADP-ribosylation factor [Salvia miltiorrhiza]
Length=181

 Score =   250 bits (639),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDK+RPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKVRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002888782.1| hypothetical protein ARALYDRAFT_476172 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009127797.1| PREDICTED: ADP-ribosylation factor 2-B isoform X1 [Brassica rapa]
 ref|XP_009127798.1| PREDICTED: ADP-ribosylation factor 2-B isoform X1 [Brassica rapa]
 gb|EFH65041.1| hypothetical protein ARALYDRAFT_476172 [Arabidopsis lyrata subsp. 
lyrata]
Length=182

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006356426.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Solanum 
tuberosum]
Length=184

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006305639.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
 gb|EOA38537.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
Length=168

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  17   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  76

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAV
Sbjct  77   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAV  136

Query  467  LLV  475
            LLV
Sbjct  137  LLV  139



>gb|ACJ84889.1| unknown [Medicago truncatula]
Length=167

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAG+TTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGRTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_003618207.1| ADP-ribosylation factor [Medicago truncatula]
Length=248

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  68   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  127

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  128  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  187

Query  467  LLV  475
            LLV
Sbjct  188  LLV  190



>gb|KJB31031.1| hypothetical protein B456_005G181600, partial [Gossypium raimondii]
Length=180

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006288755.1| hypothetical protein CARUB_v10002073mg [Capsella rubella]
 gb|EOA21653.1| hypothetical protein CARUB_v10002073mg [Capsella rubella]
Length=181

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AIX10946.1| putative ADP-ribosylation factor [Gardenia jasminoides]
Length=181

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004135253.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004165816.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Cucumis 
sativus]
Length=189

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KCW56001.1| hypothetical protein EUGRSUZ_I01779 [Eucalyptus grandis]
Length=183

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ACJ85257.1| unknown [Medicago truncatula]
Length=191

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KHG28118.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
Length=190

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  10   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  69

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  70   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  129

Query  467  LLV  475
            LLV
Sbjct  130  LLV  132



>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance 
By Agrobacterium Protein 6b
 pdb|3AQ4|B Chain B, Molecular Insights Into Plant Cell Proliferation Disturbance 
By Agrobacterium Protein 6b
Length=184

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = +2

Query  104  NMGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK  283
            +MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK
Sbjct  3    HMGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK  62

Query  284  NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDA  463
            NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDA
Sbjct  63   NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDA  122

Query  464  VLLV  475
            VLLV
Sbjct  123  VLLV  126



>ref|XP_002277054.2| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
 ref|XP_010660903.1| PREDICTED: ADP-ribosylation factor isoform X2 [Vitis vinifera]
Length=181

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRD+V
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDSV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAC98042.1| Strong similarity to gb|M95166 ADP-ribosylation factor from Arabidopsis 
thaliana. ESTs gb|Z25826, gb|R90191, gb|N65697, gb|AA713150, 
gb|T46332, gb|AA040967, gb|AA712956, gb|T46403, 
gb|T46050, gb|AI100391 and gb|Z25043 come from this gene [Arabidopsis 
thaliana]
Length=188

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010660901.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
 ref|XP_010660902.1| PREDICTED: ADP-ribosylation factor isoform X1 [Vitis vinifera]
Length=183

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRD+V
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDSV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>emb|CAD12855.1| ADP-ribosylation factor [Gossypium hirsutum]
 gb|AAO37820.1| ADP-ribosylation factor [Gossypium hirsutum]
 gb|AAO45616.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
 gb|AAO62348.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
 gb|KJB82422.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82423.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82426.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82427.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82428.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
 gb|KJB82429.1| hypothetical protein B456_013G208600 [Gossypium raimondii]
Length=181

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ACU13131.1| unknown [Glycine max]
Length=180

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MG SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGQSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AGV54515.1| ADP ribosylation factor [Phaseolus vulgaris]
Length=237

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_008443527.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis melo]
 ref|XP_008443528.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis melo]
Length=181

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010922925.1| PREDICTED: ADP-ribosylation factor-like isoform X2 [Elaeis guineensis]
Length=152

 Score =   249 bits (635),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KJB15578.1| hypothetical protein B456_002G185200 [Gossypium raimondii]
Length=192

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AGH68504.1| ADP-ribosylation factor, partial [Ipomoea batatas]
Length=180

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFKKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_008812250.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008812251.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
 ref|XP_008812252.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
Length=181

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_008806237.1| PREDICTED: ADP-ribosylation factor 2-like [Phoenix dactylifera]
Length=181

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_196971.1| ADP-ribosylation factor A1B [Arabidopsis thaliana]
 emb|CAB87634.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|AED92061.1| ADP-ribosylation factor A1B [Arabidopsis thaliana]
Length=188

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004981306.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Setaria italica]
Length=198

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  18   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  77

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  78   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  137

Query  467  LLV  475
            LLV
Sbjct  138  LLV  140



>ref|NP_001042668.1| Os01g0265100 [Oryza sativa Japonica Group]
 dbj|BAA90347.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAA92519.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF04582.1| Os01g0265100 [Oryza sativa Japonica Group]
 dbj|BAG90318.1| unnamed protein product [Oryza sativa Japonica Group]
Length=181

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004967765.1| PREDICTED: ADP-ribosylation factor 2-like [Setaria italica]
 ref|XP_006644030.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
Length=181

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006390885.1| hypothetical protein EUTSA_v10019096mg [Eutrema salsugineum]
 gb|ESQ28171.1| hypothetical protein EUTSA_v10019096mg [Eutrema salsugineum]
Length=226

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  46   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  105

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  106  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  165

Query  467  LLV  475
            LLV
Sbjct  166  LLV  168



>emb|CDX69567.1| BnaA10g19160D [Brassica napus]
Length=206

 Score =   251 bits (640),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006841600.1| hypothetical protein AMTR_s00003p00209290 [Amborella trichopoda]
 gb|ERN03275.1| hypothetical protein AMTR_s00003p00209290 [Amborella trichopoda]
Length=172

 Score =   249 bits (636),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_182239.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 sp|P36397.2|ARF1_ARATH RecName: Full=ADP-ribosylation factor 1; Short=AtARF1 [Arabidopsis 
thaliana]
 gb|AAA32729.1| ADP-ribosylation factor [Arabidopsis thaliana]
 gb|AAB63817.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAL75910.1| At2g47170/T3D7.2 [Arabidopsis thaliana]
 gb|AAM15469.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAM64892.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gb|AAM98296.1| At2g47170/T3D7.2 [Arabidopsis thaliana]
 gb|AEC10810.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009410044.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>emb|CDY09875.1| BnaC09g42860D [Brassica napus]
Length=213

 Score =   251 bits (640),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLNFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009417875.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001044599.1| Os01g0813400 [Oryza sativa Japonica Group]
 sp|Q06396.3|ARF1_ORYSJ RecName: Full=ADP-ribosylation factor 1; AltName: Full=13 kDa 
cold-induced protein [Oryza sativa Japonica Group]
 dbj|BAD68219.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAD82682.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF06513.1| Os01g0813400 [Oryza sativa Japonica Group]
 dbj|BAG88255.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89491.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71689.1| hypothetical protein OsI_04181 [Oryza sativa Indica Group]
 gb|EEE55569.1| hypothetical protein OsJ_03844 [Oryza sativa Japonica Group]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010551906.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Tarenaya hassleriana]
 ref|XP_010551907.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Tarenaya hassleriana]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AEZ00866.1| putative ADP-ribosylation factor protein [Elaeis guineensis]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
             SFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   FSFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009776781.1| PREDICTED: ADP-ribosylation factor-like [Nicotiana sylvestris]
 ref|XP_009776782.1| PREDICTED: ADP-ribosylation factor-like [Nicotiana sylvestris]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQG+IFVVDSNDRDRV+EARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDRVIEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002265983.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Vitis vinifera]
 ref|XP_002265874.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Vitis vinifera]
 ref|XP_004297476.1| PREDICTED: ADP-ribosylation factor 2 [Fragaria vesca subsp. vesca]
 ref|XP_007157443.1| hypothetical protein PHAVU_002G070500g [Phaseolus vulgaris]
 ref|XP_010682536.1| PREDICTED: ADP-ribosylation factor 2 [Beta vulgaris subsp. vulgaris]
 gb|ESW29437.1| hypothetical protein PHAVU_002G070500g [Phaseolus vulgaris]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001055892.1| Os05g0489600 [Oryza sativa Japonica Group]
 ref|XP_002441289.1| hypothetical protein SORBIDRAFT_09g023880 [Sorghum bicolor]
 ref|XP_004961688.1| PREDICTED: ADP-ribosylation factor 2-like [Setaria italica]
 ref|XP_006644888.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
 ref|XP_006654568.1| PREDICTED: ADP-ribosylation factor 2-like [Oryza brachyantha]
 ref|XP_010232477.1| PREDICTED: ADP-ribosylation factor 2 [Brachypodium distachyon]
 ref|XP_010232479.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Brachypodium 
distachyon]
 sp|P51823.2|ARF2_ORYSJ RecName: Full=ADP-ribosylation factor 2 [Oryza sativa Japonica 
Group]
 dbj|BAA04607.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAB41081.1| ADP-ribosylation factor [Triticum aestivum]
 emb|CAD48129.2| ADP-ribosylation factor 1-like protein [Hordeum vulgare subsp. 
vulgare]
 gb|AAT77289.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 dbj|BAF17806.1| Os05g0489600 [Oryza sativa Japonica Group]
 gb|EAY98506.1| hypothetical protein OsI_20417 [Oryza sativa Indica Group]
 dbj|BAG88186.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90235.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99847.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64179.1| hypothetical protein OsJ_19011 [Oryza sativa Japonica Group]
 gb|EES19719.1| hypothetical protein SORBIDRAFT_09g023880 [Sorghum bicolor]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010491587.1| PREDICTED: ADP-ribosylation factor 1-like [Camelina sativa]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006291918.1| hypothetical protein CARUB_v10018102mg [Capsella rubella]
 ref|XP_006295602.1| hypothetical protein CARUB_v10024713mg [Capsella rubella]
 ref|XP_006397909.1| hypothetical protein EUTSA_v10001656mg [Eutrema salsugineum]
 ref|XP_006402389.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 ref|XP_006402390.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 ref|XP_009599611.1| PREDICTED: ADP-ribosylation factor 1 [Nicotiana tomentosiformis]
 ref|XP_009599612.1| PREDICTED: ADP-ribosylation factor 1 [Nicotiana tomentosiformis]
 ref|XP_010506745.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010507921.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010512616.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010518410.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010413292.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010468970.1| PREDICTED: ADP-ribosylation factor 1 [Camelina sativa]
 ref|XP_010544949.1| PREDICTED: ADP-ribosylation factor 1 [Tarenaya hassleriana]
 ref|XP_011087521.1| PREDICTED: ADP-ribosylation factor 1 isoform X3 [Sesamum indicum]
 gb|AAF65512.1| ADP-ribosylation factor [Capsicum annuum]
 gb|AAR03592.1| ARF-like small GTPase [Brassica juncea]
 gb|EOA24816.1| hypothetical protein CARUB_v10018102mg [Capsella rubella]
 gb|EOA28500.1| hypothetical protein CARUB_v10024713mg [Capsella rubella]
 gb|ESQ39362.1| hypothetical protein EUTSA_v10001656mg [Eutrema salsugineum]
 gb|ESQ43842.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 gb|ESQ43843.1| hypothetical protein EUTSA_v10006262mg [Eutrema salsugineum]
 emb|CDX93979.1| BnaC04g21380D [Brassica napus]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009110099.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Brassica rapa]
 gb|ACD37536.1| putative ADP-ribosylation factor [Brassica napus]
 emb|CDY41444.1| BnaA08g20460D [Brassica napus]
 emb|CDX91717.1| BnaC08g06360D [Brassica napus]
Length=181

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_008444322.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_008444323.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_008444324.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis melo]
 ref|XP_010551584.1| PREDICTED: ADP-ribosylation factor 2-like [Tarenaya hassleriana]
Length=181

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006344797.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006344798.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_011087517.1| PREDICTED: ADP-ribosylation factor 1-like [Sesamum indicum]
Length=181

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010553607.1| PREDICTED: ADP-ribosylation factor 2-B [Tarenaya hassleriana]
Length=181

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009416365.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416366.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416367.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416368.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416369.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416370.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
Length=181

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEA+DELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEAKDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010922923.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010922924.1| PREDICTED: ADP-ribosylation factor 2-like isoform X1 [Elaeis 
guineensis]
Length=181

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>emb|CDY47221.1| BnaC09g14700D [Brassica napus]
Length=181

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_011087519.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Sesamum indicum]
 ref|XP_011087520.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Sesamum indicum]
Length=192

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  12   MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  71

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  72   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  131

Query  467  LLV  475
            LLV
Sbjct  132  LLV  134



>ref|XP_009399937.1| PREDICTED: ADP-ribosylation factor 2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399938.1| PREDICTED: ADP-ribosylation factor 2-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ABY76246.1| ADP-ribosylation factor [Brassica napus]
Length=181

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006296139.1| hypothetical protein CARUB_v10025292mg, partial [Capsella rubella]
 gb|EOA29037.1| hypothetical protein CARUB_v10025292mg, partial [Capsella rubella]
Length=180

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>emb|CDY47137.1| BnaA08g05460D [Brassica napus]
Length=181

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002888469.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64728.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
Length=189

 Score =   249 bits (637),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010651474.1| PREDICTED: ADP-ribosylation factor 2 isoform X2 [Vitis vinifera]
Length=181

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAU82112.1| ADP-ribosylation factor [Triticum aestivum]
Length=181

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFGRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009383762.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009383763.1| PREDICTED: ADP-ribosylation factor 1 [Musa acuminata subsp. malaccensis]
Length=180

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009110098.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Brassica rapa]
Length=182

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001274834.1| ARF-like small GTPase-like protein [Solanum tuberosum]
 ref|XP_006344796.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum tuberosum]
 ref|XP_009626500.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana tomentosiformis]
 ref|XP_009794408.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 ref|XP_009759065.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 ref|XP_010313700.1| PREDICTED: ADP-ribosylation factor 1 [Solanum lycopersicum]
 ref|XP_010313704.1| PREDICTED: ADP-ribosylation factor 1 [Solanum lycopersicum]
 ref|XP_010313716.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum lycopersicum]
 ref|XP_010313724.1| PREDICTED: ADP-ribosylation factor 1 isoform X2 [Solanum lycopersicum]
 gb|ABA40455.1| ARF-like small GTPase-like protein [Solanum tuberosum]
 gb|ABC01907.1| ARF-like small GTPase-like protein [Solanum tuberosum]
Length=181

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>emb|CDM84658.1| unnamed protein product [Triticum aestivum]
Length=182

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ABR17508.1| unknown [Picea sitchensis]
 gb|ABR17650.1| unknown [Picea sitchensis]
 gb|ABR18399.1| unknown [Picea sitchensis]
 gb|ACN39755.1| unknown [Picea sitchensis]
 gb|ACN39884.1| unknown [Picea sitchensis]
 gb|ACN40399.1| unknown [Picea sitchensis]
Length=181

 Score =   249 bits (636),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFQRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002876669.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52928.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
Length=189

 Score =   249 bits (636),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010232478.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Brachypodium 
distachyon]
Length=182

 Score =   249 bits (636),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AFK42466.1| unknown [Lotus japonicus]
Length=181

 Score =   249 bits (635),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDA GKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAVGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EMT17349.1| ADP-ribosylation factor 2 [Aegilops tauschii]
Length=193

 Score =   249 bits (637),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006305640.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
 gb|EOA38538.1| hypothetical protein CARUB_v10010344mg, partial [Capsella rubella]
Length=197

 Score =   249 bits (637),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  17   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  76

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDELHRMLNEDELRDAV
Sbjct  77   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDELHRMLNEDELRDAV  136

Query  467  LLV  475
            LLV
Sbjct  137  LLV  139



>ref|XP_010313707.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Solanum lycopersicum]
 ref|XP_010313711.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Solanum lycopersicum]
Length=183

 Score =   249 bits (636),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EMT22177.1| ADP-ribosylation factor [Aegilops tauschii]
Length=263

 Score =   252 bits (643),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  24   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  83

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  84   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  143

Query  467  LLV  475
            LLV
Sbjct  144  LLV  146



>gb|ABR25719.1| ADP-ribosylation factor 1 [Oryza sativa Indica Group]
Length=181

 Score =   249 bits (635),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009629758.1| PREDICTED: ADP-ribosylation factor 2 isoform X1 [Nicotiana tomentosiformis]
Length=244

 Score =   251 bits (641),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  64   MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  123

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  124  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  183

Query  467  LLV  475
            LLV
Sbjct  184  LLV  186



>ref|XP_009105711.1| PREDICTED: ADP-ribosylation factor 2-B-like [Brassica rapa]
Length=181

 Score =   249 bits (635),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_007224194.1| hypothetical protein PRUPE_ppa017304mg [Prunus persica]
 gb|EMJ25393.1| hypothetical protein PRUPE_ppa017304mg [Prunus persica]
Length=182

 Score =   249 bits (635),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDA+GKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDASGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDRVVEARDE+HRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRVVEARDEMHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_003557370.1| PREDICTED: ADP-ribosylation factor 1 [Brachypodium distachyon]
Length=181

 Score =   249 bits (635),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_010551905.1| PREDICTED: ADP-ribosylation factor 1 isoform X1 [Tarenaya hassleriana]
Length=208

 Score =   250 bits (638),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  28   MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  87

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAV
Sbjct  88   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAV  147

Query  467  LLV  475
            LLV
Sbjct  148  LLV  150



>ref|XP_010319588.1| PREDICTED: ADP-ribosylation factor [Solanum lycopersicum]
Length=185

 Score =   249 bits (635),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MG+SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGMSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRD V
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDVV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009391635.1| PREDICTED: ADP-ribosylation factor 2 [Musa acuminata subsp. malaccensis]
Length=181

 Score =   249 bits (635),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV+EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVIEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002962225.1| ARF family GTPase [Selaginella moellendorffii]
 ref|XP_002965138.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ33976.1| ARF family GTPase [Selaginella moellendorffii]
 gb|EFJ37485.1| ARF family GTPase [Selaginella moellendorffii]
Length=181

 Score =   249 bits (635),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFQRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_003557369.1| PREDICTED: ADP-ribosylation factor 1-like [Brachypodium distachyon]
Length=181

 Score =   249 bits (635),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>dbj|BAJ87426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=181

 Score =   249 bits (635),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KJB81136.1| hypothetical protein B456_013G131000 [Gossypium raimondii]
Length=227

 Score =   250 bits (639),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  47   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  106

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  107  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  166

Query  467  LLV  475
            LLV
Sbjct  167  LLV  169



>ref|XP_009381359.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381360.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   249 bits (635),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FT+LFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTRLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001059207.1| Os07g0223400 [Oryza sativa Japonica Group]
 ref|NP_001147310.1| ADP-ribosylation factor 1 [Zea mays]
 ref|NP_001146953.1| ADP-ribosylation factor 1 [Zea mays]
 ref|XP_002459554.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 ref|XP_004955819.1| PREDICTED: ADP-ribosylation factor 1-like [Setaria italica]
 ref|XP_006657565.1| PREDICTED: ADP-ribosylation factor 1-like [Oryza brachyantha]
 gb|AAB65432.1| ADP-ribosylation factor 1 [Oryza sativa]
 dbj|BAC06914.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAC45192.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAD31195.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 dbj|BAF21121.1| Os07g0223400 [Oryza sativa Japonica Group]
 gb|ACF83333.1| unknown [Zea mays]
 gb|ACG24722.1| ADP-ribosylation factor 1 [Zea mays]
 gb|ACG26712.1| ADP-ribosylation factor 1 [Zea mays]
 dbj|BAH01227.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01635.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81745.1| hypothetical protein OsI_25399 [Oryza sativa Indica Group]
 gb|EEC81746.1| hypothetical protein OsI_25400 [Oryza sativa Indica Group]
 gb|ACN30622.1| unknown [Zea mays]
 gb|EER96075.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 tpg|DAA60037.1| TPA: ADP-ribosylation factor 1 [Zea mays]
Length=181

 Score =   249 bits (635),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EAY92309.1| hypothetical protein OsI_14032 [Oryza sativa Indica Group]
Length=354

 Score =   254 bits (650),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>emb|CDX95712.1| BnaC03g25930D [Brassica napus]
Length=190

 Score =   249 bits (635),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AGV54289.1| ADP-ribosylation factor [Phaseolus vulgaris]
Length=209

 Score =   249 bits (637),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_006416080.1| hypothetical protein EUTSA_v10008884mg [Eutrema salsugineum]
 gb|ESQ34433.1| hypothetical protein EUTSA_v10008884mg [Eutrema salsugineum]
Length=181

 Score =   248 bits (634),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001136508.1| uncharacterized protein LOC100216623 [Zea mays]
 ref|XP_008654461.1| PREDICTED: uncharacterized protein LOC100216623 isoform X1 [Zea 
mays]
 gb|ACF82071.1| unknown [Zea mays]
 gb|AFW79616.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gb|AFW79617.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gb|AFW79618.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
Length=181

 Score =   248 bits (634),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009394868.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   248 bits (634),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FT+LFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTRLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KHG17087.1| ARF2-B: ADP-ribosylation factor 2-B [Gossypium arboreum]
Length=213

 Score =   249 bits (637),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  17   MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  76

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  77   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  136

Query  467  LLV  475
            LLV
Sbjct  137  LLV  139



>gb|EEE66819.1| hypothetical protein OsJ_23579 [Oryza sativa Japonica Group]
Length=279

 Score =   252 bits (643),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  99   MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  158

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  159  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  218

Query  467  LLV  475
            LLV
Sbjct  219  LLV  221



>ref|NP_001168955.1| uncharacterized protein LOC100382775 [Zea mays]
 gb|ACN31185.1| unknown [Zea mays]
 gb|AFW84789.1| hypothetical protein ZEAMMB73_845118 [Zea mays]
Length=181

 Score =   248 bits (634),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EMS63688.1| ADP-ribosylation factor 2 [Triticum urartu]
Length=186

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ACR37635.1| unknown [Zea mays]
 tpg|DAA57152.1| TPA: hypothetical protein ZEAMMB73_454864 [Zea mays]
Length=153

 Score =   247 bits (631),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009113207.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_009113208.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 emb|CDY53050.1| BnaA09g14150D [Brassica napus]
Length=181

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_191788.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|NP_001190161.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|NP_001190162.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 ref|XP_002880284.1| ADP-ribosylation factor A1E [Arabidopsis lyrata subsp. lyrata]
 ref|XP_009142560.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_009142561.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
 ref|XP_010523901.1| PREDICTED: ADP-ribosylation factor 1 [Tarenaya hassleriana]
 gb|AAK49618.1|AF372902_1 AT3g62290/T17J13_250 [Arabidopsis thaliana]
 emb|CAB71889.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|AAL15358.1| AT3g62290/T17J13_250 [Arabidopsis thaliana]
 gb|AAM62611.1| ADP-ribosylation factor-like protein [Arabidopsis thaliana]
 gb|ABL97964.1| ADP-ribosylation factor-like protein [Brassica rapa]
 gb|EFH56543.1| ADP-ribosylation factor A1E [Arabidopsis lyrata subsp. lyrata]
 gb|AEE80332.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 gb|AEE80333.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 gb|AEE80334.1| ADP-ribosylation factor A1E [Arabidopsis thaliana]
 emb|CDY51415.1| BnaA04g26920D [Brassica napus]
 emb|CDY37791.1| BnaC04g00340D [Brassica napus]
 emb|CDY27506.1| BnaC04g51470D [Brassica napus]
 emb|CDX89139.1| BnaA04g00470D [Brassica napus]
 emb|CDX80083.1| BnaA05g00730D [Brassica napus]
Length=181

 Score =   248 bits (634),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ACM67554.1| ADP-ribosylation factor-like protein [Musa acuminata AAA Group]
Length=181

 Score =   248 bits (633),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFIRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ABD73294.1| ADP-ribosylation factor-like protein [Panax ginseng]
Length=181

 Score =   248 bits (633),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLN DELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNGDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004970327.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Setaria 
italica]
Length=182

 Score =   248 bits (633),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004970328.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Setaria 
italica]
Length=181

 Score =   248 bits (633),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004228551.1| PREDICTED: ADP-ribosylation factor 2-like [Solanum lycopersicum]
Length=181

 Score =   248 bits (633),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ABF74733.1| ADP-ribosylation factor 1 [Nicotiana benthamiana]
Length=181

 Score =   248 bits (633),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEI TTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIGTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EAY73411.1| hypothetical protein OsI_01294 [Oryza sativa Indica Group]
 gb|EAZ11343.1| hypothetical protein OsJ_01211 [Oryza sativa Japonica Group]
Length=216

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAT08663.1| ADP-ribosylation factor [Hyacinthus orientalis]
Length=181

 Score =   248 bits (633),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F K+FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKIFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AFW79615.1| hypothetical protein ZEAMMB73_444016, partial [Zea mays]
Length=210

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001149117.1| ADP-ribosylation factor [Zea mays]
 ref|XP_002456522.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor]
 ref|XP_008672877.1| PREDICTED: ADP-ribosylation factor isoform X1 [Zea mays]
 gb|ACF83883.1| unknown [Zea mays]
 gb|ACF88010.1| unknown [Zea mays]
 gb|ACG34254.1| ADP-ribosylation factor [Zea mays]
 gb|ACG42128.1| ADP-ribosylation factor [Zea mays]
 gb|EES01642.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor]
 tpg|DAA57153.1| TPA: ADP-ribosylation factor [Zea mays]
Length=181

 Score =   248 bits (632),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009595261.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana tomentosiformis]
 ref|XP_009775097.1| PREDICTED: ADP-ribosylation factor 1-like [Nicotiana sylvestris]
 dbj|BAF34209.1| ADP ribosylation factor [Nicotiana tabacum]
Length=181

 Score =   248 bits (632),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002318934.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
 gb|EEE94857.1| hypothetical protein POPTR_0013s00690g [Populus trichocarpa]
Length=182

 Score =   248 bits (632),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 123/124 (99%), Gaps = 1/124 (1%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNE-DELRDA  463
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNE DELRDA
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEVDELRDA  120

Query  464  VLLV  475
            VLLV
Sbjct  121  VLLV  124



>ref|XP_009115521.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
 ref|XP_009115522.1| PREDICTED: ADP-ribosylation factor 2-B [Brassica rapa]
Length=181

 Score =   248 bits (632),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILM GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMGGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004158320.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus]
 ref|XP_008443537.1| PREDICTED: ADP-ribosylation factor 1-like isoform X2 [Cucumis 
melo]
 gb|KGN59683.1| hypothetical protein Csa_3G837640 [Cucumis sativus]
Length=181

 Score =   248 bits (632),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AFW78462.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=199

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  95   DI*NMGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETV  274
            D+  MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETV
Sbjct  12   DLSEMGLTFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETV  71

Query  275  EYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDEL  454
            EYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDEL
Sbjct  72   EYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDEL  131

Query  455  RDAVLLV  475
            RDAVLLV
Sbjct  132  RDAVLLV  138



>emb|CDX83340.1| BnaA03g21660D [Brassica napus]
Length=191

 Score =   248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MG+SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGVSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009420958.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009420959.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=180

 Score =   248 bits (632),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+VEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009395959.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395960.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395962.1| PREDICTED: ADP-ribosylation factor 1-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   248 bits (632),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FT+LFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTRLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR++EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIIEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_008443534.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
 ref|XP_008443535.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
 ref|XP_008443536.1| PREDICTED: ADP-ribosylation factor 1-like isoform X1 [Cucumis 
melo]
Length=186

 Score =   248 bits (632),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAO62347.1| ARF1-like GTP-binding protein [Gossypium hirsutum]
Length=181

 Score =   247 bits (631),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQD+IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLN+DELRDAV
Sbjct  61   ISFTVWDVGGQDRIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNKDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_008223454.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
 ref|XP_008223455.1| PREDICTED: ADP-ribosylation factor-like [Prunus mume]
Length=181

 Score =   247 bits (631),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDA+GKTTILYKLKLGEIVTTIPTIGFNVET+EYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDASGKTTILYKLKLGEIVTTIPTIGFNVETLEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFV+DSNDRDRVVEARDE+HRMLNEDELR+AV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVIDSNDRDRVVEARDEMHRMLNEDELREAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_011462890.1| PREDICTED: ADP-ribosylation factor-like isoform X3 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   247 bits (631),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKL SRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLLSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDE+HRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDEVHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_001776112.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ59023.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   247 bits (631),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFS+LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009133804.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
Length=181

 Score =   247 bits (631),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MG+SF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGVSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAF79587.1|AC007945_7 F28C11.12 [Arabidopsis thaliana]
Length=245

 Score =   249 bits (636),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFAKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001170436.1| uncharacterized protein LOC100384428 [Zea mays]
 ref|XP_008648189.1| PREDICTED: uncharacterized protein LOC100384428 isoform X1 [Zea 
mays]
 ref|XP_008648190.1| PREDICTED: uncharacterized protein LOC100384428 isoform X1 [Zea 
mays]
 gb|ACN36989.1| unknown [Zea mays]
 gb|AFW78458.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
 gb|AFW78459.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
 gb|AFW78460.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=184

 Score =   247 bits (630),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EMS51203.1| ADP-ribosylation factor 2 [Triticum urartu]
Length=233

 Score =   249 bits (635),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AFW78457.1| hypothetical protein ZEAMMB73_418055 [Zea mays]
Length=182

 Score =   247 bits (630),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFRRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ACG31280.1| ADP-ribosylation factor 1 [Zea mays]
Length=181

 Score =   246 bits (629),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILM GLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFGKLFSRLFAKKEMRILMFGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>sp|O23778.3|ARF1_CATRO RecName: Full=ADP-ribosylation factor 1 [Catharanthus roseus]
 gb|AAB62249.1| ADP-ribosylation factor 1 [Catharanthus roseus]
Length=181

 Score =   246 bits (629),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILY+LKLGEIVTTIPTIGFNVETVEY+ 
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYQLKLGEIVTTIPTIGFNVETVEYQY  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AFW79619.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
Length=278

 Score =   250 bits (638),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAD17207.1| ADP-ribosylation factor [Glycine max]
Length=178

 Score =   246 bits (629),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/120 (100%), Positives = 120/120 (100%), Gaps = 0/120 (0%)
 Frame = +2

Query  116  SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  295
            SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF
Sbjct  1    SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISF  60

Query  296  TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  475
            TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV
Sbjct  61   TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLV  120



>ref|XP_009138731.1| PREDICTED: ADP-ribosylation factor 1 [Brassica rapa]
Length=181

 Score =   246 bits (628),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQ+TQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQDTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_001764375.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70929.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   246 bits (628),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF++LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFTKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_001764701.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 ref|XP_001764769.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70400.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ70468.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   246 bits (628),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF++LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFTKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|NP_001237492.1| uncharacterized protein LOC100499890 [Glycine max]
 gb|ACU14076.1| unknown [Glycine max]
Length=181

 Score =   246 bits (628),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRD VVEARDELH MLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDLVVEARDELHGMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|EEE66818.1| hypothetical protein OsJ_23578 [Oryza sativa Japonica Group]
Length=241

 Score =   248 bits (634),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+F KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  61   MGLAFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  120

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  121  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  180

Query  467  LLV  475
            LLV
Sbjct  181  LLV  183



>ref|XP_003055413.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60665.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score =   246 bits (628),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFQRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|ABR17658.1| unknown [Picea sitchensis]
 gb|ACN40238.1| unknown [Picea sitchensis]
Length=181

 Score =   246 bits (627),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF R+FAK+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFQRMFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVAEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>dbj|BAB90396.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
Length=376

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  179  MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  238

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RVVEARDELHRMLNEDELRDAV
Sbjct  239  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVVEARDELHRMLNEDELRDAV  298

Query  467  LLV  475
            LLV
Sbjct  299  LLV  301



>ref|XP_001776147.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
 gb|EDQ59058.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens]
Length=181

 Score =   246 bits (627),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF +LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFQKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_009118871.1| PREDICTED: ADP-ribosylation factor 1-like [Brassica rapa]
Length=181

 Score =   245 bits (626),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF KLFS+LFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKLFSKLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLI VVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLISVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_011462888.1| PREDICTED: ADP-ribosylation factor-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=216

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKL SRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  36   MGLSFTKLLSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  95

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR VEARDE+HRMLNEDELRDAV
Sbjct  96   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRAVEARDEVHRMLNEDELRDAV  155

Query  467  LLV  475
            LLV
Sbjct  156  LLV  158



>ref|XP_005643690.1| ADP-ribosylation factor 1 [Coccomyxa subellipsoidea C-169]
 gb|EIE19146.1| ADP-ribosylation factor 1 [Coccomyxa subellipsoidea C-169]
Length=181

 Score =   245 bits (626),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF+RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLAFTKLFARLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDR+ EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIGEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_007147411.1| hypothetical protein PHAVU_006G122200g [Phaseolus vulgaris]
 gb|ESW19405.1| hypothetical protein PHAVU_006G122200g [Phaseolus vulgaris]
Length=184

 Score =   245 bits (626),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSF K+FSRL AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFGKIFSRLCAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEA+DELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAKDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|KJB09503.1| hypothetical protein B456_001G146100 [Gossypium raimondii]
Length=181

 Score =   245 bits (625),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKLFS LF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLFSWLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHR LNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRTLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_001764700.1| predicted protein [Physcomitrella patens]
 gb|EDQ70399.1| predicted protein [Physcomitrella patens]
Length=190

 Score =   245 bits (626),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF +LF+K+EMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFQKLFSKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>gb|AAP69821.1| ARF [Oryza sativa Japonica Group]
Length=181

 Score =   245 bits (625),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFSRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTV DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVRDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_004141190.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus]
Length=368

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  185  MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  244

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  245  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  304

Query  467  LLV  475
            LLV
Sbjct  305  LLV  307


 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGL+FTKLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLTFTKLFGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002312302.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_011019121.1| PREDICTED: ADP-ribosylation factor 1-like [Populus euphratica]
 gb|ABK94475.1| unknown [Populus trichocarpa]
 gb|EEE89669.1| ADP-ribosylation factor family protein [Populus trichocarpa]
Length=181

 Score =   244 bits (623),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKL  RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLLGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_002314987.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 ref|XP_006378561.1| hypothetical protein POPTR_0010s16240g [Populus trichocarpa]
 ref|XP_011011379.1| PREDICTED: ADP-ribosylation factor 1 [Populus euphratica]
 sp|O48649.3|ARF1_SALBA RecName: Full=ADP-ribosylation factor 1 [Salix bakko]
 dbj|BAA24696.1| ADP-ribosylation factor [Salix bakko]
 gb|AAO63780.1| ADP-ribosylation factor 2 [Populus tremuloides]
 gb|ABK92843.1| unknown [Populus trichocarpa]
 gb|EEF01158.1| ADP-ribosylation factor family protein [Populus trichocarpa]
 gb|ERP56358.1| hypothetical protein POPTR_0010s16240g [Populus trichocarpa]
Length=181

 Score =   244 bits (623),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MGLSFTKL  RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGLSFTKLLGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



>ref|XP_001420856.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_003082427.1| unnamed protein product [Ostreococcus tauri]
 gb|ABO99149.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=181

 Score =   244 bits (622),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/123 (95%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  286
            MG++F KLF RLF+KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
Sbjct  1    MGITFAKLFQRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN  60

Query  287  ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV  466
            ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRV EARDELHRMLNEDELRDAV
Sbjct  61   ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVSEARDELHRMLNEDELRDAV  120

Query  467  LLV  475
            LLV
Sbjct  121  LLV  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730