BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003L08

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009778598.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    180   3e-51   Nicotiana sylvestris
ref|XP_009626445.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    176   5e-50   Nicotiana tomentosiformis
ref|XP_004229832.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    173   8e-49   Solanum lycopersicum
ref|XP_006339453.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    172   2e-48   Solanum tuberosum [potatoes]
emb|CDP08874.1|  unnamed protein product                                163   6e-45   Coffea canephora [robusta coffee]
ref|XP_004147971.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    151   2e-40   
ref|XP_008448958.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    150   7e-40   Cucumis melo [Oriental melon]
ref|XP_009617349.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    149   2e-39   Nicotiana tomentosiformis
gb|EYU32071.1|  hypothetical protein MIMGU_mgv1a008136mg                146   1e-38   Erythranthe guttata [common monkey flower]
ref|XP_009762973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    144   8e-38   Nicotiana sylvestris
emb|CAN65431.1|  hypothetical protein VITISV_017099                     142   3e-37   Vitis vinifera
ref|XP_008799545.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    142   5e-37   Phoenix dactylifera
ref|XP_008799543.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    142   5e-37   Phoenix dactylifera
ref|XP_011093163.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    141   7e-37   Sesamum indicum [beniseed]
ref|XP_010255490.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    141   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_006857849.1|  hypothetical protein AMTR_s00069p00064990          141   1e-36   
ref|XP_010255491.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    141   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010255488.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    141   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010255487.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    141   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_002271651.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    140   2e-36   Vitis vinifera
ref|XP_011091747.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    139   3e-36   
emb|CBI38762.3|  unnamed protein product                                137   1e-35   Vitis vinifera
gb|KJB20721.1|  hypothetical protein B456_003G161000                    135   3e-35   Gossypium raimondii
ref|XP_009401775.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    138   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401774.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    138   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008780243.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    132   2e-34   
gb|KJB20720.1|  hypothetical protein B456_003G161000                    134   3e-34   Gossypium raimondii
gb|KJB20719.1|  hypothetical protein B456_003G161000                    134   3e-34   Gossypium raimondii
ref|XP_006477421.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    133   1e-33   Citrus sinensis [apfelsine]
ref|XP_006477422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    133   1e-33   Citrus sinensis [apfelsine]
ref|XP_006477420.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    133   1e-33   Citrus sinensis [apfelsine]
ref|XP_002509740.1|  cleavage and polyadenylation specificity fac...    133   1e-33   Ricinus communis
ref|XP_009382298.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    132   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006477419.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    132   2e-33   Citrus sinensis [apfelsine]
ref|XP_010278589.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    132   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006477418.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    132   2e-33   Citrus sinensis [apfelsine]
ref|XP_010278588.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    132   2e-33   
ref|XP_010278591.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    132   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010278590.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    132   2e-33   
ref|XP_010919264.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    132   3e-33   Elaeis guineensis
ref|XP_010919263.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    132   3e-33   Elaeis guineensis
gb|KDO63536.1|  hypothetical protein CISIN_1g020491mg                   131   3e-33   Citrus sinensis [apfelsine]
gb|KDO63537.1|  hypothetical protein CISIN_1g020491mg                   131   3e-33   Citrus sinensis [apfelsine]
gb|KDO63535.1|  hypothetical protein CISIN_1g020491mg                   131   3e-33   Citrus sinensis [apfelsine]
gb|KEH31714.1|  zinc finger, C3HC4 type (RING finger) protein           132   3e-33   Medicago truncatula
gb|EYU35067.1|  hypothetical protein MIMGU_mgv1a008119mg                132   4e-33   Erythranthe guttata [common monkey flower]
gb|KHG00577.1|  hypothetical protein F383_17805                         131   4e-33   Gossypium arboreum [tree cotton]
ref|XP_006345510.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    131   7e-33   Solanum tuberosum [potatoes]
ref|XP_010933858.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    130   1e-32   Elaeis guineensis
ref|XP_010933860.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    130   1e-32   Elaeis guineensis
ref|XP_008800795.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    130   1e-32   Phoenix dactylifera
gb|KJB25759.1|  hypothetical protein B456_004G208600                    129   2e-32   Gossypium raimondii
gb|KHG06982.1|  hypothetical protein F383_33104                         129   4e-32   Gossypium arboreum [tree cotton]
ref|XP_003550874.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    127   1e-31   Glycine max [soybeans]
gb|KHG00725.1|  hypothetical protein F383_22058                         127   1e-31   Gossypium arboreum [tree cotton]
ref|XP_004511598.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    127   2e-31   Cicer arietinum [garbanzo]
ref|XP_004240042.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    127   2e-31   Solanum lycopersicum
gb|KHG06981.1|  hypothetical protein F383_33104                         129   3e-31   Gossypium arboreum [tree cotton]
ref|XP_006440563.1|  hypothetical protein CICLE_v10020554mg             126   4e-31   Citrus clementina [clementine]
ref|XP_006440560.1|  hypothetical protein CICLE_v10020554mg             126   4e-31   Citrus clementina [clementine]
ref|XP_010458710.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    126   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006440561.1|  hypothetical protein CICLE_v10020554mg             126   4e-31   Citrus clementina [clementine]
ref|XP_006440562.1|  hypothetical protein CICLE_v10020554mg             126   4e-31   Citrus clementina [clementine]
ref|XP_010545919.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    126   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_010545936.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    126   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_010545928.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    126   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_010545944.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    126   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_008438087.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    125   6e-31   Cucumis melo [Oriental melon]
ref|XP_008438088.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    125   6e-31   
ref|XP_010476241.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    125   8e-31   Camelina sativa [gold-of-pleasure]
gb|KFK43535.1|  hypothetical protein AALP_AA1G139400                    125   8e-31   Arabis alpina [alpine rockcress]
ref|XP_004133878.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    125   9e-31   Cucumis sativus [cucumbers]
emb|CDY31275.1|  BnaC08g15700D                                          125   9e-31   Brassica napus [oilseed rape]
ref|NP_001047717.2|  Os02g0674700                                       124   1e-30   
ref|XP_010494577.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    125   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010934467.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    124   1e-30   Elaeis guineensis
dbj|BAD29468.1|  ring zinc finger protein-like                          125   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010934468.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    124   1e-30   Elaeis guineensis
ref|XP_002889965.1|  protein binding protein                            124   2e-30   
ref|XP_006304987.1|  hypothetical protein CARUB_v10009353mg             124   2e-30   Capsella rubella
ref|XP_006391773.1|  hypothetical protein EUTSA_v10023515mg             124   2e-30   Eutrema salsugineum [saltwater cress]
emb|CDY21061.1|  BnaA08g24640D                                          123   2e-30   Brassica napus [oilseed rape]
ref|XP_006391774.1|  hypothetical protein EUTSA_v10023515mg             124   2e-30   Eutrema salsugineum [saltwater cress]
ref|XP_009110629.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    124   2e-30   Brassica rapa
ref|XP_003570089.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    124   2e-30   Brachypodium distachyon [annual false brome]
ref|NP_001031032.1|  E3 ubiquitin-protein ligase                        123   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007040144.1|  Zinc finger, C3HC4 type (RING finger) family...    124   3e-30   Theobroma cacao [chocolate]
ref|XP_007040145.1|  Zinc finger, C3HC4 type (RING finger) family...    124   3e-30   Theobroma cacao [chocolate]
ref|XP_009110628.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    124   3e-30   Brassica rapa
ref|XP_006417201.1|  hypothetical protein EUTSA_v10007780mg             124   3e-30   Eutrema salsugineum [saltwater cress]
ref|NP_172736.2|  E3 ubiquitin-protein ligase                           124   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31927.1|  hypothetical protein AALP_AA6G177200                    124   3e-30   Arabis alpina [alpine rockcress]
ref|XP_010544693.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    123   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_010422123.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    124   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006396865.1|  hypothetical protein EUTSA_v10028703mg             124   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010544692.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    123   4e-30   Tarenaya hassleriana [spider flower]
ref|NP_567379.1|  E3 ubiquitin-protein ligase                           123   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004515807.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    123   5e-30   Cicer arietinum [garbanzo]
ref|XP_010434567.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    123   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010455583.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    123   6e-30   Camelina sativa [gold-of-pleasure]
emb|CAB39939.1|  putative protein                                       123   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010553507.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    122   1e-29   
ref|XP_010553508.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    122   1e-29   
ref|XP_010553509.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    122   1e-29   
ref|XP_010553504.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    122   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_010553505.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    122   2e-29   Tarenaya hassleriana [spider flower]
emb|CDY26592.1|  BnaA09g46850D                                          121   2e-29   Brassica napus [oilseed rape]
emb|CDY57781.1|  BnaCnng32440D                                          122   2e-29   Brassica napus [oilseed rape]
ref|XP_010671755.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    121   2e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF87715.1|  unknown                                                 120   2e-29   Zea mays [maize]
ref|XP_007155554.1|  hypothetical protein PHAVU_003G211600g             121   3e-29   Phaseolus vulgaris [French bean]
ref|XP_006287901.1|  hypothetical protein CARUB_v10001135mg             121   3e-29   Capsella rubella
ref|XP_003570086.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    121   3e-29   Brachypodium distachyon [annual false brome]
ref|XP_009124794.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    121   3e-29   Brassica rapa
ref|XP_001754436.1|  predicted protein                                  120   3e-29   
ref|XP_002887973.1|  zinc finger family protein                         120   4e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_002874711.1|  hypothetical protein ARALYDRAFT_327304             121   4e-29   Arabidopsis lyrata subsp. lyrata
emb|CDX86759.1|  BnaA09g21490D                                          120   4e-29   
gb|ACF78887.1|  unknown                                                 120   4e-29   Zea mays [maize]
ref|XP_010430403.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    120   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_003611137.1|  E3 ubiquitin-protein ligase                        120   5e-29   Medicago truncatula
emb|CDY66607.1|  BnaA06g38090D                                          120   5e-29   Brassica napus [oilseed rape]
ref|XP_009118058.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   5e-29   Brassica rapa
ref|XP_009148567.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   5e-29   Brassica rapa
ref|XP_007158469.1|  hypothetical protein PHAVU_002G155000g             120   5e-29   Phaseolus vulgaris [French bean]
ref|XP_010533709.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   6e-29   Tarenaya hassleriana [spider flower]
ref|XP_009411463.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009118057.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   6e-29   Brassica rapa
ref|XP_011033783.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   7e-29   Populus euphratica
ref|XP_002303571.2|  hypothetical protein POPTR_0003s12350g             120   7e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011033784.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   7e-29   Populus euphratica
ref|XP_011033785.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    120   8e-29   Populus euphratica
ref|XP_002876598.1|  hypothetical protein ARALYDRAFT_486593             119   2e-28   
dbj|BAJ98696.1|  predicted protein                                      118   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003538385.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    118   2e-28   Glycine max [soybeans]
ref|XP_006590532.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    118   2e-28   Glycine max [soybeans]
ref|XP_008389083.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    113   3e-28   
ref|XP_010092737.1|  E3 ubiquitin-protein ligase                        118   3e-28   
ref|NP_001147541.1|  protein binding protein                            117   4e-28   Zea mays [maize]
gb|KJB39631.1|  hypothetical protein B456_007G022500                    117   4e-28   Gossypium raimondii
ref|XP_002880197.1|  hypothetical protein ARALYDRAFT_322232             117   5e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_009116780.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    117   5e-28   Brassica rapa
emb|CDY16029.1|  BnaC08g40940D                                          117   5e-28   Brassica napus [oilseed rape]
ref|XP_006402511.1|  hypothetical protein EUTSA_v10006041mg             117   5e-28   
gb|EPS63490.1|  hypothetical protein M569_11294                         117   6e-28   Genlisea aurea
ref|XP_010053324.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    117   7e-28   Eucalyptus grandis [rose gum]
gb|KHG14407.1|  hypothetical protein F383_04260                         117   8e-28   Gossypium arboreum [tree cotton]
emb|CDY52328.1|  BnaA09g38770D                                          116   1e-27   Brassica napus [oilseed rape]
gb|KCW77597.1|  hypothetical protein EUGRSUZ_D01910                     116   1e-27   Eucalyptus grandis [rose gum]
gb|KCW77596.1|  hypothetical protein EUGRSUZ_D01910                     116   1e-27   Eucalyptus grandis [rose gum]
ref|XP_011463818.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    116   1e-27   Fragaria vesca subsp. vesca
ref|XP_011463819.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    116   1e-27   Fragaria vesca subsp. vesca
emb|CDX71761.1|  BnaC08g31130D                                          116   2e-27   
gb|KJB52053.1|  hypothetical protein B456_008G244300                    114   2e-27   Gossypium raimondii
ref|XP_009142362.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    115   2e-27   Brassica rapa
gb|ADK63393.1|  C3HC4 type zinc finger protein                          114   3e-27   Brassica rapa
emb|CDY37062.1|  BnaA04g26400D                                          115   3e-27   Brassica napus [oilseed rape]
ref|XP_009143169.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    115   4e-27   Brassica rapa
emb|CDX74763.1|  BnaA05g05090D                                          115   4e-27   
ref|XP_010101532.1|  hypothetical protein L484_008863                   113   4e-27   
gb|KDP25486.1|  hypothetical protein JCGZ_20642                         115   5e-27   Jatropha curcas
gb|ADK63418.1|  C3HC4 type zinc finger protein                          114   5e-27   Brassica rapa
gb|ACN40787.1|  unknown                                                 114   6e-27   Picea sitchensis
ref|XP_009788378.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    110   6e-27   Nicotiana sylvestris
emb|CDY60265.1|  BnaC05g49290D                                          114   6e-27   Brassica napus [oilseed rape]
ref|NP_001130198.1|  uncharacterized LOC100191292                       114   7e-27   Zea mays [maize]
gb|AFW59158.1|  putative RING zinc finger domain superfamily protein    113   8e-27   
emb|CAE02249.2|  OSJNBb0032E06.5                                        113   8e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_567110.1|  RING/U-box superfamily protein                        114   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KJB52054.1|  hypothetical protein B456_008G244300                    112   1e-26   Gossypium raimondii
ref|XP_009615319.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    113   1e-26   Nicotiana tomentosiformis
emb|CAB71048.1|  putative protein                                       113   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976528.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    113   2e-26   Setaria italica
ref|XP_009615318.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    113   2e-26   Nicotiana tomentosiformis
ref|XP_003525718.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    113   2e-26   Glycine max [soybeans]
ref|NP_001150553.1|  LOC100284185                                       113   2e-26   
ref|XP_008662009.1|  PREDICTED: LOC100284185 isoform X1                 113   2e-26   
gb|KJB52052.1|  hypothetical protein B456_008G244300                    113   2e-26   Gossypium raimondii
gb|KDP28678.1|  hypothetical protein JCGZ_14449                         112   3e-26   Jatropha curcas
emb|CDY70309.1|  BnaCnng67740D                                          112   3e-26   Brassica napus [oilseed rape]
ref|XP_002511805.1|  cleavage and polyadenylation specificity fac...    111   7e-26   Ricinus communis
ref|XP_008354302.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    111   1e-25   
ref|XP_006279088.1|  hypothetical protein CARUB_v10012711mg             110   1e-25   
dbj|BAK00653.1|  predicted protein                                      110   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006294289.1|  hypothetical protein CARUB_v10023298mg             111   1e-25   
dbj|BAK01729.1|  predicted protein                                      110   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009393489.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    110   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK02342.1|  predicted protein                                      110   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010940871.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    110   2e-25   Elaeis guineensis
gb|ABR17177.1|  unknown                                                 110   2e-25   Picea sitchensis
ref|XP_010940872.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    110   2e-25   Elaeis guineensis
ref|XP_010469042.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    109   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006279087.1|  hypothetical protein CARUB_v10012711mg             109   3e-25   Capsella rubella
ref|XP_008225188.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    110   3e-25   Prunus mume [ume]
ref|XP_009765931.1|  PREDICTED: cleavage and polyadenylation spec...    112   3e-25   Nicotiana sylvestris
gb|ABR18161.1|  unknown                                                 109   4e-25   Picea sitchensis
ref|XP_007211433.1|  hypothetical protein PRUPE_ppa007140mg             109   6e-25   Prunus persica
gb|KDP38117.1|  hypothetical protein JCGZ_04760                         108   6e-25   Jatropha curcas
ref|XP_010413448.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    108   7e-25   Camelina sativa [gold-of-pleasure]
gb|KFK30652.1|  hypothetical protein AALP_AA6G009800                    107   1e-24   Arabis alpina [alpine rockcress]
ref|XP_006355061.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...    110   2e-24   Solanum tuberosum [potatoes]
ref|XP_009420927.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    107   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002969635.1|  hypothetical protein SELMODRAFT_66385              107   2e-24   
ref|XP_002970900.1|  hypothetical protein SELMODRAFT_66382              107   2e-24   
ref|XP_010319559.1|  PREDICTED: cleavage and polyadenylation spec...    110   2e-24   Solanum lycopersicum
ref|XP_011070566.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    107   3e-24   Sesamum indicum [beniseed]
ref|XP_011070565.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    107   3e-24   Sesamum indicum [beniseed]
ref|XP_008780251.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    103   4e-24   Phoenix dactylifera
ref|XP_009608303.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    106   4e-24   Nicotiana tomentosiformis
emb|CDY27362.1|  BnaC04g50430D                                          109   5e-24   Brassica napus [oilseed rape]
gb|KJB30722.1|  hypothetical protein B456_005G157000                    106   5e-24   Gossypium raimondii
gb|KDO86039.1|  hypothetical protein CISIN_1g017405mg                   105   7e-24   Citrus sinensis [apfelsine]
ref|XP_006391188.1|  hypothetical protein EUTSA_v10018815mg             105   7e-24   
ref|XP_010112554.1|  E3 ubiquitin-protein ligase                        105   8e-24   Morus notabilis
ref|XP_009351549.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    105   9e-24   
gb|KDO86037.1|  hypothetical protein CISIN_1g017405mg                   105   9e-24   Citrus sinensis [apfelsine]
ref|XP_008803037.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    105   1e-23   Phoenix dactylifera
ref|XP_009346865.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    105   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_010910998.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    102   1e-23   Elaeis guineensis
ref|XP_008803038.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    105   1e-23   Phoenix dactylifera
ref|XP_008345901.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    105   1e-23   Malus domestica [apple tree]
gb|KDO86038.1|  hypothetical protein CISIN_1g017405mg                   104   1e-23   Citrus sinensis [apfelsine]
ref|NP_176974.1|  C3HC4-type RING finger domain-containing protein      104   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007045268.1|  Zinc finger isoform 2                              103   2e-23   
ref|XP_002887158.1|  hypothetical protein ARALYDRAFT_475916             104   2e-23   Arabidopsis lyrata subsp. lyrata
gb|AAM61051.1|  putative RING zinc finger protein                       104   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051906.1|  RING/U-box superfamily protein, putative           105   2e-23   Theobroma cacao [chocolate]
ref|XP_010540663.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    105   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_010540654.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    104   2e-23   Tarenaya hassleriana [spider flower]
gb|KDO86036.1|  hypothetical protein CISIN_1g017405mg                   104   2e-23   Citrus sinensis [apfelsine]
ref|XP_006445135.1|  hypothetical protein CICLE_v10020664mg             104   2e-23   Citrus clementina [clementine]
ref|XP_006491024.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    104   2e-23   Citrus sinensis [apfelsine]
ref|XP_010540680.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    104   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_010540671.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    104   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_010053666.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    104   2e-23   Eucalyptus grandis [rose gum]
ref|XP_003517458.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    104   3e-23   Glycine max [soybeans]
emb|CDY50582.1|  BnaC02g39560D                                          102   3e-23   Brassica napus [oilseed rape]
gb|ACN30552.1|  unknown                                                 100   3e-23   Zea mays [maize]
ref|XP_008381749.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        103   3e-23   
ref|XP_007045267.1|  Zinc finger, C3HC4 type (RING finger) family...    103   4e-23   
ref|XP_004295567.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    103   4e-23   Fragaria vesca subsp. vesca
ref|XP_010470747.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    103   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010529547.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    103   4e-23   Tarenaya hassleriana [spider flower]
ref|XP_010529546.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    103   5e-23   Tarenaya hassleriana [spider flower]
ref|XP_008383660.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    103   5e-23   
gb|KHG00424.1|  E3 ubiquitin ligase RIE1 -like protein                  102   5e-23   Gossypium arboreum [tree cotton]
ref|XP_008358659.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    103   5e-23   
ref|XP_010661149.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    103   8e-23   Vitis vinifera
ref|XP_008389170.1|  PREDICTED: E3 ubiquitin protein ligase RIE1        103   8e-23   Malus domestica [apple tree]
ref|XP_003631422.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    103   8e-23   Vitis vinifera
ref|XP_007160430.1|  hypothetical protein PHAVU_002G321300g             102   9e-23   Phaseolus vulgaris [French bean]
ref|XP_006302484.1|  hypothetical protein CARUB_v10020579mg             102   1e-22   Capsella rubella
ref|XP_010271358.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    102   1e-22   
ref|XP_010473550.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    102   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_001784296.1|  predicted protein                                  102   1e-22   
ref|XP_006302394.1|  hypothetical protein CARUB_v10020462mg             102   1e-22   Capsella rubella
gb|KFK37366.1|  hypothetical protein AALP_AA4G247400                    102   2e-22   Arabis alpina [alpine rockcress]
ref|XP_006364123.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    102   2e-22   Solanum tuberosum [potatoes]
gb|EYU30132.1|  hypothetical protein MIMGU_mgv1a010797mg                101   2e-22   Erythranthe guttata [common monkey flower]
ref|NP_564810.1|  zinc finger, C3HC4 type (RING finger) family pr...    102   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418331.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    102   2e-22   Camelina sativa [gold-of-pleasure]
gb|EYU30133.1|  hypothetical protein MIMGU_mgv1a010797mg                101   2e-22   Erythranthe guttata [common monkey flower]
gb|AAM63303.1|  unknown                                                 102   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24200.1|  At1g63170/F16M19_7                                      102   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525228.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    101   2e-22   Glycine max [soybeans]
ref|NP_001182980.1|  uncharacterized protein LOC100501295             99.0    2e-22   
gb|KJB41240.1|  hypothetical protein B456_007G096300                    100   2e-22   Gossypium raimondii
gb|KJB15334.1|  hypothetical protein B456_002G172200                    101   2e-22   Gossypium raimondii
gb|KJB15335.1|  hypothetical protein B456_002G172200                    101   3e-22   Gossypium raimondii
ref|XP_002459812.1|  hypothetical protein SORBIDRAFT_02g011130          101   3e-22   Sorghum bicolor [broomcorn]
gb|KFK40526.1|  hypothetical protein AALP_AA2G007300                    101   3e-22   Arabis alpina [alpine rockcress]
gb|KHN21610.1|  E3 ubiquitin protein ligase RIE1                        100   4e-22   Glycine soja [wild soybean]
ref|XP_011035074.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    100   5e-22   Populus euphratica
ref|XP_011035055.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    100   5e-22   Populus euphratica
ref|XP_011035060.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    100   5e-22   Populus euphratica
ref|XP_009127596.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    100   5e-22   Brassica rapa
ref|XP_011035066.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    100   5e-22   Populus euphratica
ref|XP_008778191.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    100   6e-22   Phoenix dactylifera
ref|XP_002320753.2|  hypothetical protein POPTR_0014s07110g             100   6e-22   
ref|XP_011023403.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    100   6e-22   
ref|XP_007223310.1|  hypothetical protein PRUPE_ppa007296mg             100   6e-22   
ref|XP_006584880.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    100   7e-22   
gb|KHN16532.1|  E3 ubiquitin protein ligase RIE1                      99.8    7e-22   
ref|XP_003630948.1|  E3 ubiquitin-protein ligase                        100   8e-22   
tpg|DAA60523.1|  TPA: putative RING zinc finger domain superfamil...  98.2    8e-22   
emb|CDY71708.1|  BnaCnng74070D                                          100   9e-22   
ref|XP_008232745.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  99.8    1e-21   
ref|XP_009352819.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  99.8    1e-21   
ref|XP_004252582.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  99.8    1e-21   
gb|KHF98416.1|  hypothetical protein F383_13016                       99.8    1e-21   
ref|XP_007220471.1|  hypothetical protein PRUPE_ppa007521mg           99.8    1e-21   
emb|CDY12686.1|  BnaA02g13540D                                        99.4    1e-21   
ref|XP_010534170.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      99.4    1e-21   
gb|KJB41241.1|  hypothetical protein B456_007G096300                  99.4    1e-21   
ref|XP_004150618.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  99.0    2e-21   
gb|KJB41239.1|  hypothetical protein B456_007G096300                  99.0    2e-21   
gb|KJB41242.1|  hypothetical protein B456_007G096300                  98.6    2e-21   
ref|XP_004503351.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  98.6    2e-21   
ref|XP_008467019.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      98.6    2e-21   
emb|CDY49194.1|  BnaA09g10840D                                        98.6    3e-21   
ref|XP_009112973.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  98.6    3e-21   
emb|CDY47347.1|  BnaCnng14840D                                        98.6    3e-21   
ref|XP_009112972.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  98.6    3e-21   
ref|XP_002526000.1|  cleavage and polyadenylation specificity fac...    101   3e-21   
ref|XP_008670056.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  97.8    4e-21   
gb|AEW07558.1|  hypothetical protein 0_5075_01                        94.0    5e-21   
gb|AEW07559.1|  hypothetical protein 0_5075_01                        93.6    1e-20   
gb|AFG60447.1|  hypothetical protein 0_5075_01                        93.6    1e-20   
ref|XP_004498249.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  96.7    1e-20   
gb|KEH40622.1|  zinc finger (C3HC4-type RING finger) family protein   96.7    1e-20   
ref|XP_010512452.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  96.7    1e-20   
ref|XP_002962655.1|  hypothetical protein SELMODRAFT_78385            96.7    1e-20   
ref|XP_002980437.1|  hypothetical protein SELMODRAFT_112292           96.7    2e-20   
ref|XP_011463168.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      96.3    2e-20   
gb|KEH40623.1|  zinc finger (C3HC4-type RING finger) family protein   96.3    2e-20   
ref|XP_008651537.1|  PREDICTED: protein binding protein isoform X2    96.3    2e-20   
ref|XP_008651536.1|  PREDICTED: protein binding protein isoform X1    95.9    2e-20   
tpg|DAA60522.1|  TPA: putative RING zinc finger domain superfamil...  95.9    2e-20   
ref|XP_010107068.1|  E3 ubiquitin protein ligase RIE1                 96.7    2e-20   
gb|ABK96450.1|  unknown                                               94.4    2e-20   
ref|NP_001151256.1|  protein binding protein                          95.9    2e-20   
ref|XP_010511779.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  95.1    4e-20   
ref|XP_004956145.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  95.1    4e-20   
ref|XP_004956144.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  95.1    4e-20   
ref|XP_003563155.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  94.7    6e-20   
ref|XP_010419065.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.4    6e-20   
emb|CAN61404.1|  hypothetical protein VITISV_014258                   94.4    7e-20   
ref|XP_010651669.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      94.4    7e-20   
emb|CDY13386.1|  BnaC06g13710D                                        90.9    8e-20   
ref|XP_003518612.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  94.0    1e-19   
ref|XP_006448160.1|  hypothetical protein CICLE_v10015731mg           92.4    1e-19   
ref|XP_003533627.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  94.0    1e-19   
ref|XP_006469322.1|  PREDICTED: cleavage and polyadenylation spec...  96.7    1e-19   
ref|XP_010932732.1|  PREDICTED: uncharacterized protein LOC105053331  96.3    2e-19   
ref|XP_006828464.1|  hypothetical protein AMTR_s00060p00138860        91.7    2e-19   
ref|XP_002312464.2|  zinc finger family protein                       92.4    3e-19   
ref|XP_008789277.1|  PREDICTED: E3 ubiquitin protein ligase RIE1 ...  92.4    4e-19   
emb|CDX71399.1|  BnaC04g16340D                                        89.0    4e-19   
ref|XP_008789278.1|  PREDICTED: E3 ubiquitin protein ligase RIE1 ...  92.4    4e-19   
ref|XP_010272924.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  92.4    4e-19   
ref|XP_010430653.1|  PREDICTED: cleavage and polyadenylation spec...  94.7    5e-19   
ref|XP_006583718.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  91.7    6e-19   
gb|KDO60761.1|  hypothetical protein CISIN_1g018193mg                 90.5    1e-18   
ref|XP_002875087.1|  hypothetical protein ARALYDRAFT_322516           94.0    1e-18   
ref|XP_011024112.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  91.3    1e-18   
ref|XP_006448161.1|  hypothetical protein CICLE_v10015731mg           90.5    1e-18   
ref|XP_009408396.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      90.9    1e-18   
ref|XP_010518550.1|  PREDICTED: cleavage and polyadenylation spec...  94.0    1e-18   
gb|KDO60760.1|  hypothetical protein CISIN_1g018193mg                 90.9    1e-18   
ref|XP_006448162.1|  hypothetical protein CICLE_v10015731mg           90.9    1e-18   
ref|XP_006583716.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  90.5    2e-18   
ref|XP_010251799.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  90.5    2e-18   
ref|XP_010676528.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  90.1    2e-18   
ref|XP_010251798.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  89.7    3e-18   
emb|CDY01880.1|  BnaC06g29200D                                        89.4    5e-18   
ref|XP_009345443.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  89.4    7e-18   
ref|XP_009345445.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  89.4    7e-18   
ref|XP_009345446.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  89.4    7e-18   
ref|XP_009345444.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  89.4    7e-18   
ref|XP_006291380.1|  hypothetical protein CARUB_v10017517mg           88.6    8e-18   
ref|XP_010502156.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      88.6    9e-18   
ref|XP_010527797.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      88.2    1e-17   
ref|NP_001059583.1|  Os07g0463400                                     88.2    1e-17   
gb|KFK33397.1|  hypothetical protein AALP_AA5G007500                  87.8    2e-17   
gb|AAD12712.1|  putative cleavage and polyadenylation specifity f...  89.7    3e-17   
ref|XP_009105357.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      87.0    3e-17   
dbj|BAE99481.1|  putative cleavage and polyadenylation specifity ...  85.5    3e-17   
gb|EEC81984.1|  hypothetical protein OsI_25906                        87.4    3e-17   
ref|XP_003552356.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  87.4    3e-17   
ref|XP_006395857.1|  hypothetical protein EUTSA_v10004486mg           87.0    4e-17   
emb|CDX96049.1|  BnaA07g26820D                                        86.7    4e-17   
ref|XP_010695901.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  86.7    4e-17   
emb|CDX68417.1|  BnaC01g24950D                                        85.5    7e-17   
ref|XP_007209235.1|  hypothetical protein PRUPE_ppa007012mg           85.9    1e-16   
ref|XP_011021770.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  84.3    1e-16   
ref|XP_010066571.1|  PREDICTED: cleavage and polyadenylation spec...  87.4    2e-16   
ref|XP_002301335.1|  zinc finger family protein                       84.7    3e-16   
ref|NP_849924.1|  E3 ubiquitin protein ligase RIE1                    84.0    4e-16   
ref|XP_009369023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.8    2e-15   
ref|XP_009369025.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.8    2e-15   
ref|XP_009369024.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.8    2e-15   
ref|XP_006658537.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  81.6    2e-15   
ref|XP_009369026.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.8    2e-15   
ref|XP_008238809.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.4    2e-15   
ref|XP_008238810.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.4    2e-15   
ref|XP_011021769.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  82.0    2e-15   
gb|KCW64497.1|  hypothetical protein EUGRSUZ_G02105                   82.0    2e-15   
ref|XP_008355581.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.0    3e-15   
ref|XP_008355582.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.0    3e-15   
ref|XP_008355580.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.0    3e-15   
ref|XP_008355584.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  82.0    3e-15   
ref|XP_009399941.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  81.3    4e-15   
ref|XP_007139958.1|  hypothetical protein PHAVU_008G073000g           80.9    6e-15   
ref|XP_008392389.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  81.3    6e-15   
ref|XP_008392391.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  81.3    6e-15   
ref|XP_008392388.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  81.3    6e-15   
ref|XP_008392390.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  81.3    6e-15   
ref|XP_009419123.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  80.5    6e-15   
ref|XP_004249338.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  80.1    7e-15   
ref|XP_010312169.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  80.1    9e-15   
ref|XP_002283980.2|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  80.5    9e-15   
ref|XP_009101309.1|  PREDICTED: E3 ubiquitin protein ligase RIE1      80.1    1e-14   
emb|CDY17638.1|  BnaA06g34570D                                        80.1    1e-14   
ref|XP_003623820.1|  E3 ubiquitin-protein ligase                      80.1    1e-14   
emb|CDY36255.1|  BnaC07g21090D                                        79.7    1e-14   
ref|XP_008455807.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  77.0    3e-14   
gb|KJB60892.1|  hypothetical protein B456_009G330000                  78.6    4e-14   
ref|XP_002314782.2|  hypothetical protein POPTR_0010s11660g           77.8    6e-14   
ref|XP_009606720.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  77.4    7e-14   
ref|XP_009606721.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  77.0    8e-14   
ref|XP_007153246.1|  hypothetical protein PHAVU_003G019100g           77.4    9e-14   
ref|XP_009773934.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  76.6    1e-13   
ref|XP_009773936.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  76.3    1e-13   
ref|XP_009773935.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  76.3    1e-13   
ref|XP_009606719.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  76.3    3e-13   
ref|XP_009773933.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  75.5    4e-13   
ref|XP_009773932.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  75.5    5e-13   
ref|XP_004144310.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  74.7    7e-13   
ref|XP_002452592.1|  hypothetical protein SORBIDRAFT_04g028660        74.3    2e-12   
ref|XP_004498315.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  73.2    2e-12   
gb|KHG10998.1|  E3 ubiquitin ligase RIE1 -like protein                73.9    2e-12   
ref|XP_006482012.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  72.8    2e-12   
ref|XP_010673203.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  72.8    2e-12   
ref|NP_001149757.1|  LOC100283384                                     73.6    3e-12   
ref|XP_006430473.1|  hypothetical protein CICLE_v10012313mg           72.4    4e-12   
dbj|BAK01779.1|  predicted protein                                    72.8    5e-12   
ref|XP_006576759.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  70.9    9e-12   
ref|XP_003553376.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  71.2    1e-11   
gb|EEC73955.1|  hypothetical protein OsI_08846                        70.9    1e-11   
ref|XP_007162014.1|  hypothetical protein PHAVU_001G116400g           70.5    2e-11   
ref|XP_003521096.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  70.1    3e-11   
gb|EPS69634.1|  hypothetical protein M569_05133                       69.7    3e-11   
ref|XP_004493023.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  69.7    5e-11   
ref|XP_004493307.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  68.9    5e-11   
ref|XP_004953845.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  69.7    5e-11   
ref|XP_008221359.1|  PREDICTED: cleavage and polyadenylation spec...  70.1    1e-10   
ref|XP_003570691.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  67.4    3e-10   
ref|XP_008679100.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  66.6    6e-10   
emb|CDP14337.1|  unnamed protein product                              66.2    8e-10   
gb|KHN35002.1|  E3 ubiquitin-protein ligase                           64.7    2e-09   
ref|XP_004136763.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  59.3    2e-07   
ref|XP_008443208.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  59.3    2e-07   
gb|AFW80142.1|  putative RING zinc finger domain superfamily protein  58.5    5e-07   
ref|XP_004306831.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  58.2    5e-07   
gb|EYU35678.1|  hypothetical protein MIMGU_mgv1a018208mg              57.4    1e-06   
ref|XP_003624869.1|  E3 ubiquitin-protein ligase                      55.5    3e-06   
ref|XP_004165340.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  54.3    6e-06   
emb|CBI32866.3|  unnamed protein product                              51.2    8e-05   
ref|NP_001053593.2|  Os04g0568900                                     50.8    1e-04   
ref|XP_011070049.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  51.2    1e-04   
gb|EMT20198.1|  E3 ubiquitin-protein ligase                           50.8    1e-04   
gb|KHG16467.1|  hypothetical protein F383_05962                       50.4    2e-04   
gb|KCW89980.1|  hypothetical protein EUGRSUZ_A02179                   50.1    2e-04   
gb|EEE69458.1|  hypothetical protein OsJ_28860                        50.4    2e-04   
ref|NP_001062870.1|  Os09g0323100                                     49.7    4e-04   
ref|XP_002439378.1|  hypothetical protein SORBIDRAFT_09g005450        49.7    4e-04   
ref|XP_004291419.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  49.7    4e-04   
ref|XP_006649025.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...  49.3    5e-04   
ref|XP_006652656.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  48.9    6e-04   
ref|XP_002517522.1|  ring finger protein, putative                    48.9    7e-04   
ref|XP_004498153.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...  48.1    0.001   



>ref|XP_009778598.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=383

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 11/162 (7%)
 Frame = +2

Query  23   ARAPDDDTTNVNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrr  202
            ARA +DD++N           GVDTTPLL DQ+F SRR  RR PSLRGAARFLRRASSRR
Sbjct  4    ARAGNDDSSN-----------GVDTTPLLTDQLFRSRRLARRAPSLRGAARFLRRASSRR  52

Query  203  mmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMP  382
            M+REPS RVRE+AAEQIEERQSDWAYSKPIV+LDL WNLAFV+VS+SVL++S DESP MP
Sbjct  53   MLREPSRRVREAAAEQIEERQSDWAYSKPIVILDLIWNLAFVIVSVSVLILSLDESPSMP  112

Query  383  LRLWIVGYDFQCVLHIVCVCLEYRRRNQLPSSPENLNSRRSS  508
            LRLWIVGY  QC+LH+VCVC+EYRRR QL +   +LNS +SS
Sbjct  113  LRLWIVGYALQCLLHMVCVCVEYRRRIQLSNPATSLNSEQSS  154



>ref|XP_009626445.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nicotiana 
tomentosiformis]
Length=383

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 132/162 (81%), Gaps = 11/162 (7%)
 Frame = +2

Query  23   ARAPDDDTTNVNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrr  202
            ARA +DD++N            VDTTPLL DQ+F SRR  RR PSLRGAARFLRRASSRR
Sbjct  4    ARAGNDDSSN-----------RVDTTPLLTDQLFRSRRLARRAPSLRGAARFLRRASSRR  52

Query  203  mmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMP  382
            MMREPS RVRE+AAEQIEERQSDWAYSKPIV+LDL WNLAFV+VS+SVL++S DESP MP
Sbjct  53   MMREPSRRVREAAAEQIEERQSDWAYSKPIVILDLIWNLAFVIVSVSVLILSLDESPSMP  112

Query  383  LRLWIVGYDFQCVLHIVCVCLEYRRRNQLPSSPENLNSRRSS  508
            LRLWIVGY  QC+LH+VCVC+EYRRR QL +   +LNS +SS
Sbjct  113  LRLWIVGYALQCLLHMVCVCVEYRRRIQLSNPATSLNSEQSS  154



>ref|XP_004229832.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Solanum lycopersicum]
Length=383

 Score =   173 bits (439),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 128/163 (79%), Gaps = 11/163 (7%)
 Frame = +2

Query  23   ARAPDDDTTNVNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrr  202
            ARA +DD++N           GVDTTPLL DQ+F SRR  RR P+LRGAARFLRRAS+ R
Sbjct  4    ARAGNDDSSN-----------GVDTTPLLTDQVFRSRRLARRAPTLRGAARFLRRASNHR  52

Query  203  mmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMP  382
            +MREPS RVRE+AAE IEERQSDWAYSKPIV+LDL WNLAFV+VS+SVL++S DE P MP
Sbjct  53   LMREPSRRVREAAAEHIEERQSDWAYSKPIVILDLIWNLAFVIVSVSVLILSHDELPSMP  112

Query  383  LRLWIVGYDFQCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSG  511
            LRLWIVGY  QC+LH+VCVC+EYRRR QL  S   LNS + + 
Sbjct  113  LRLWIVGYALQCLLHMVCVCVEYRRRIQLSDSSPILNSEQRNA  155



>ref|XP_006339453.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Solanum 
tuberosum]
Length=383

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 128/163 (79%), Gaps = 11/163 (7%)
 Frame = +2

Query  23   ARAPDDDTTNVNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrr  202
            ARA +DD++N           GVDTTPLL DQ+F SRR  RR P+LRGAARFLRRAS+ R
Sbjct  4    ARAGNDDSSN-----------GVDTTPLLTDQVFRSRRLARRAPTLRGAARFLRRASNHR  52

Query  203  mmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMP  382
            +MREPS RVRE+AAE IEERQSDWAYSKPIV+LDL WNLAFV+VS+SVL++S DE P MP
Sbjct  53   LMREPSRRVREAAAEHIEERQSDWAYSKPIVILDLIWNLAFVIVSVSVLILSLDELPSMP  112

Query  383  LRLWIVGYDFQCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSG  511
            LRLWIVGY  QC+LH+VCVC+EYRRR QL  S   LNS + + 
Sbjct  113  LRLWIVGYGLQCLLHMVCVCVEYRRRIQLSDSSPILNSEQRNA  155



>emb|CDP08874.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  89   VDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQS  268
            VDTTPLL DQIF SR F+RRPPSLRGAARFLRRASSRRM+REPSMRVRE+AAEQIEERQS
Sbjct  23   VDTTPLLRDQIFRSRPFLRRPPSLRGAARFLRRASSRRMLREPSMRVREAAAEQIEERQS  82

Query  269  DWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLE  448
            DWAYSKPIV+LDL WN+AFV+VSISVL++SR E P MPLRLW+VGY  QC+LH+VCVC+E
Sbjct  83   DWAYSKPIVILDLVWNVAFVIVSISVLILSRYEKPSMPLRLWVVGYALQCLLHMVCVCVE  142

Query  449  YRRRNQ  466
            Y++R+Q
Sbjct  143  YKKRSQ  148



>ref|XP_004147971.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cucumis 
sativus]
 gb|KGN55952.1| hypothetical protein Csa_3G038740 [Cucumis sativus]
Length=383

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 121/155 (78%), Gaps = 11/155 (7%)
 Frame = +2

Query  71   GEGNDGVDTTPLLG------DQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvr  232
            G  +D +DT+PL+G      D     RRF++R  SLR AARFLR+AS+RR MREPSM VR
Sbjct  9    GSSDDILDTSPLMGTPNRSLDDTHSGRRFVQRQ-SLRQAARFLRQASNRRTMREPSMLVR  67

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ ++LV+SR+ESP MPLRLWIVGY F
Sbjct  68   ETAAEQLEERQSDWAYSKPVVILDIVWNFAFVVVAATILVLSRNESPSMPLRLWIVGYAF  127

Query  413  QCVLHIVCVCLEYRRRNQLP----SSPENLNSRRS  505
            QC+LH+VCVC+EYRRR QL     SS E  NS RS
Sbjct  128  QCILHMVCVCVEYRRRRQLRYSAFSSMEEGNSARS  162



>ref|XP_008448958.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cucumis 
melo]
Length=383

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 116/145 (80%), Gaps = 7/145 (5%)
 Frame = +2

Query  71   GEGNDGVDTTPLLG------DQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvr  232
            G  +D +DT+PL+G      D     RRF++R  SLR AARFLR+ASSRR MREPSM VR
Sbjct  9    GSSDDILDTSPLMGTPNRSLDDTHSGRRFVQRQ-SLRQAARFLRQASSRRTMREPSMLVR  67

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ ++LV+SR+ESP MPLRLWIVGY F
Sbjct  68   ETAAEQLEERQSDWAYSKPVVILDIVWNFAFVVVAATILVLSRNESPSMPLRLWIVGYAF  127

Query  413  QCVLHIVCVCLEYRRRNQLPSSPEN  487
            QC+LH+VCVC+EYRRR QL  S  N
Sbjct  128  QCILHMVCVCVEYRRRRQLRYSAFN  152



>ref|XP_009617349.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
tomentosiformis]
Length=389

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 119/175 (68%), Gaps = 31/175 (18%)
 Frame = +2

Query  29   APDDDTTNVNVNSGGEGNDGVDTTPLLGDQ-----------IFGSRRFMRRPPSLrgaar  175
            A DD+T+N ++ S  +G  GVDT+PLL +            + G+  F+RR  S      
Sbjct  7    AADDNTSNADI-SPSDGGGGVDTSPLLTNSRSRRSFHRRPSLRGAAGFLRRASS------  59

Query  176  flrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVM  355
                   RR+MREPSMRVRE+AAEQIEERQSDWAYSKPIV+LDL WNLAFV+V+ISVL+M
Sbjct  60   -------RRLMREPSMRVREAAAEQIEERQSDWAYSKPIVILDLIWNLAFVIVAISVLIM  112

Query  356  SRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWS  520
            S++ESP MPLRLWI+GY  Q VLH+VCV +EYRRR Q        NS   SGNW+
Sbjct  113  SKNESPSMPLRLWIIGYALQSVLHMVCVFVEYRRRCQ------RRNSSSGSGNWN  161



>gb|EYU32071.1| hypothetical protein MIMGU_mgv1a008136mg [Erythranthe guttata]
Length=383

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 105/127 (83%), Gaps = 2/127 (2%)
 Frame = +2

Query  86   GVDTTPLLGDQIF-GSRRFMRRPPSLrgaarflrrassrrmmrep-smrvrESAAEQIEE  259
             VD+TPLL DQI   S +F+RR PSLRGAARFLRRASSR       S+RVRE+AAEQIEE
Sbjct  13   AVDSTPLLSDQILRSSPQFLRRTPSLRGAARFLRRASSRGRAMRDPSVRVRETAAEQIEE  72

Query  260  RQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCV  439
            RQSDWAYSKPIV+LDL WNLAF+ VSISV++MSR E P MPLRLWIVGY  QCVLH+ CV
Sbjct  73   RQSDWAYSKPIVILDLVWNLAFIAVSISVMIMSRLEKPSMPLRLWIVGYAVQCVLHMACV  132

Query  440  CLEYRRR  460
            C+EYR+R
Sbjct  133  CVEYRKR  139



>ref|XP_009762973.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=389

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 3/141 (2%)
 Frame = +2

Query  29   APDDDTTNVNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrrmm  208
            A DD+T+N +V S   G  GVDT+PLL +    S+R   R PSLRGAA FLRRASSRR+M
Sbjct  7    AADDNTSNADV-SPSNGGGGVDTSPLLTNS--RSQRSFHRRPSLRGAAGFLRRASSRRLM  63

Query  209  repsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLR  388
            REPSMRVRE+AAEQIEERQSDWAYSKPIV+LDL WNLAFV+V+ISVL+MS++ESP MPLR
Sbjct  64   REPSMRVREAAAEQIEERQSDWAYSKPIVILDLVWNLAFVIVAISVLIMSKNESPSMPLR  123

Query  389  LWIVGYDFQCVLHIVCVCLEY  451
            LWI+GY  Q VLH+VCV +EY
Sbjct  124  LWIIGYALQSVLHMVCVFVEY  144



>emb|CAN65431.1| hypothetical protein VITISV_017099 [Vitis vinifera]
Length=342

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 107/157 (68%), Gaps = 30/157 (19%)
 Frame = +2

Query  59   VNSGGEGNDGVDTTPLL----GDQ-------------IFGSRRFMRRPPSLrgaarflrr  187
            +++     D  DTTPLL     DQ             + G+ RF+RR  S          
Sbjct  1    MSTARSSADATDTTPLLHASVSDQILRSRRLIRRPPSLRGAARFLRRASS----------  50

Query  188  assrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDE  367
               RR+MREPSMRVRE+AAEQ+EERQSDWAYSKPIV+LD+ WNLAFV+V+++VLVMSRDE
Sbjct  51   ---RRIMREPSMRVRETAAEQLEERQSDWAYSKPIVILDIVWNLAFVVVAMTVLVMSRDE  107

Query  368  SPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQLPSS  478
            +P  PLRLWI+GY  QCVLH+VC+C+EY+RR  L SS
Sbjct  108  TPSTPLRLWIIGYGLQCVLHMVCICVEYKRRRHLASS  144



>ref|XP_008799545.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Phoenix dactylifera]
Length=377

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 109/130 (84%), Gaps = 2/130 (2%)
 Frame = +2

Query  77   GNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIE  256
            G+  VD  PLLG +  G RR  RRP SLRGAARFLRRASSRRMMREPSM VRE+AAEQ+E
Sbjct  11   GDAAVDPAPLLGTR-GGDRRLARRP-SLRGAARFLRRASSRRMMREPSMLVRETAAEQLE  68

Query  257  ERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVC  436
            ERQSDWAYS+P+V LD+ WNLAFV V+  VLVMSRDE P MPLRLWIVGY  QCVLH++C
Sbjct  69   ERQSDWAYSRPVVFLDILWNLAFVSVAAGVLVMSRDEKPSMPLRLWIVGYALQCVLHMMC  128

Query  437  VCLEYRRRNQ  466
            VC+EYRRR++
Sbjct  129  VCIEYRRRHR  138



>ref|XP_008799543.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Phoenix dactylifera]
Length=378

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 109/130 (84%), Gaps = 2/130 (2%)
 Frame = +2

Query  77   GNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIE  256
            G+  VD  PLLG +  G RR  RRP SLRGAARFLRRASSRRMMREPSM VRE+AAEQ+E
Sbjct  11   GDAAVDPAPLLGTR-GGDRRLARRP-SLRGAARFLRRASSRRMMREPSMLVRETAAEQLE  68

Query  257  ERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVC  436
            ERQSDWAYS+P+V LD+ WNLAFV V+  VLVMSRDE P MPLRLWIVGY  QCVLH++C
Sbjct  69   ERQSDWAYSRPVVFLDILWNLAFVSVAAGVLVMSRDEKPSMPLRLWIVGYALQCVLHMMC  128

Query  437  VCLEYRRRNQ  466
            VC+EYRRR++
Sbjct  129  VCIEYRRRHR  138



>ref|XP_011093163.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Sesamum 
indicum]
Length=376

 Score =   141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 103/127 (81%), Gaps = 3/127 (2%)
 Frame = +2

Query  89   VDTTPLLGDQIFGSRR--FMRRPPSLrgaarflrrassrrmmrep-smrvrESAAEQIEE  259
            VDTTPLLG QIF +RR  F+R  PSLRGAA+FLRRASSR       S+ VR +AAEQIEE
Sbjct  10   VDTTPLLGHQIFRARRPRFLRPAPSLRGAAQFLRRASSRGGAMREPSVLVRAAAAEQIEE  69

Query  260  RQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCV  439
            RQSDWAYSKPIV+LDL WN+AFV+VS+SVL+MSRDE+P  PLRLWIV Y  QCVL  VCV
Sbjct  70   RQSDWAYSKPIVILDLVWNVAFVIVSVSVLIMSRDETPSTPLRLWIVVYALQCVLRGVCV  129

Query  440  CLEYRRR  460
            C EY++R
Sbjct  130  CTEYKKR  136



>ref|XP_010255490.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Nelumbo nucifera]
Length=382

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 119/145 (82%), Gaps = 10/145 (7%)
 Frame = +2

Query  44   TTNVNVNSGGEGNDGVDTTPLLGDQIF-----GSRRFMRRPPSLrgaarflrrassrrmm  208
            T + N N G    + +D+TPLLG+         SRR  RRP SLRGAARFLRRASSRRMM
Sbjct  4    TRSSNSNPG----EAIDSTPLLGNAAGIRDEDRSRRAGRRP-SLRGAARFLRRASSRRMM  58

Query  209  repsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLR  388
            REPSM VRE+AAEQ+EERQSDWAYS+P+V+LD+ WN+AFV+V++SVL++SR+ESP MPLR
Sbjct  59   REPSMLVRETAAEQLEERQSDWAYSRPVVILDIIWNMAFVIVAVSVLILSRNESPSMPLR  118

Query  389  LWIVGYDFQCVLHIVCVCLEYRRRN  463
            LWIVGY  QC+LH+VCVC+EYRRR+
Sbjct  119  LWIVGYAVQCILHMVCVCVEYRRRH  143



>ref|XP_006857849.1| hypothetical protein AMTR_s00069p00064990 [Amborella trichopoda]
 gb|ERN19316.1| hypothetical protein AMTR_s00069p00064990 [Amborella trichopoda]
Length=383

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = +2

Query  41   DTTNVNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrrmmreps  220
            DT     +S    +  +DTTPLLG       R   R PS+RGAARFLRRASSRRMMREPS
Sbjct  2    DTATTTRSSNPSTDVVIDTTPLLGS---SPERRPFRGPSIRGAARFLRRASSRRMMREPS  58

Query  221  mrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIV  400
            M VRE+AAEQ+EERQSDWAYS+P+V+LD+ WNLAFV+V+++VL++SRDE+P MPLRLWIV
Sbjct  59   MLVRETAAEQLEERQSDWAYSRPVVVLDIIWNLAFVVVAMAVLLLSRDENPSMPLRLWIV  118

Query  401  GYDFQCVLHIVCVCLEYRRRNQLPSSPEN  487
            GY FQC+LHI+CVC+EYRRR+    S E+
Sbjct  119  GYAFQCLLHIICVCVEYRRRHGSRDSLEH  147



>ref|XP_010255491.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Nelumbo nucifera]
Length=381

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 119/145 (82%), Gaps = 10/145 (7%)
 Frame = +2

Query  44   TTNVNVNSGGEGNDGVDTTPLLGDQIF-----GSRRFMRRPPSLrgaarflrrassrrmm  208
            T + N N G    + +D+TPLLG+         SRR  RRP SLRGAARFLRRASSRRMM
Sbjct  4    TRSSNSNPG----EAIDSTPLLGNAAGIRDEDRSRRAGRRP-SLRGAARFLRRASSRRMM  58

Query  209  repsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLR  388
            REPSM VRE+AAEQ+EERQSDWAYS+P+V+LD+ WN+AFV+V++SVL++SR+ESP MPLR
Sbjct  59   REPSMLVRETAAEQLEERQSDWAYSRPVVILDIIWNMAFVIVAVSVLILSRNESPSMPLR  118

Query  389  LWIVGYDFQCVLHIVCVCLEYRRRN  463
            LWIVGY  QC+LH+VCVC+EYRRR+
Sbjct  119  LWIVGYAVQCILHMVCVCVEYRRRH  143



>ref|XP_010255488.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Nelumbo nucifera]
Length=444

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 119/145 (82%), Gaps = 10/145 (7%)
 Frame = +2

Query  44   TTNVNVNSGGEGNDGVDTTPLLGDQIF-----GSRRFMRRPPSLrgaarflrrassrrmm  208
            T + N N G    + +D+TPLLG+         SRR  RRP SLRGAARFLRRASSRRMM
Sbjct  4    TRSSNSNPG----EAIDSTPLLGNAAGIRDEDRSRRAGRRP-SLRGAARFLRRASSRRMM  58

Query  209  repsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLR  388
            REPSM VRE+AAEQ+EERQSDWAYS+P+V+LD+ WN+AFV+V++SVL++SR+ESP MPLR
Sbjct  59   REPSMLVRETAAEQLEERQSDWAYSRPVVILDIIWNMAFVIVAVSVLILSRNESPSMPLR  118

Query  389  LWIVGYDFQCVLHIVCVCLEYRRRN  463
            LWIVGY  QC+LH+VCVC+EYRRR+
Sbjct  119  LWIVGYAVQCILHMVCVCVEYRRRH  143



>ref|XP_010255487.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nelumbo nucifera]
Length=445

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 119/145 (82%), Gaps = 10/145 (7%)
 Frame = +2

Query  44   TTNVNVNSGGEGNDGVDTTPLLGDQIF-----GSRRFMRRPPSLrgaarflrrassrrmm  208
            T + N N G    + +D+TPLLG+         SRR  RRP SLRGAARFLRRASSRRMM
Sbjct  4    TRSSNSNPG----EAIDSTPLLGNAAGIRDEDRSRRAGRRP-SLRGAARFLRRASSRRMM  58

Query  209  repsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLR  388
            REPSM VRE+AAEQ+EERQSDWAYS+P+V+LD+ WN+AFV+V++SVL++SR+ESP MPLR
Sbjct  59   REPSMLVRETAAEQLEERQSDWAYSRPVVILDIIWNMAFVIVAVSVLILSRNESPSMPLR  118

Query  389  LWIVGYDFQCVLHIVCVCLEYRRRN  463
            LWIVGY  QC+LH+VCVC+EYRRR+
Sbjct  119  LWIVGYAVQCILHMVCVCVEYRRRH  143



>ref|XP_002271651.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Vitis vinifera]
Length=382

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 108/157 (69%), Gaps = 30/157 (19%)
 Frame = +2

Query  59   VNSGGEGNDGVDTTPLL----GDQ-------------IFGSRRFMRRPPSLrgaarflrr  187
            +++     D  DTTPLL     DQ             + G+ RF+RR  S          
Sbjct  1    MSTARSSADATDTTPLLHASVSDQILRSRRLIRRPPSLRGAARFLRRASS----------  50

Query  188  assrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDE  367
               RR+MREPSMRVRE+AAEQ+EERQSDWAYSKPIV+LD+ WNLAFV+V+++VLVMSRDE
Sbjct  51   ---RRIMREPSMRVRETAAEQLEERQSDWAYSKPIVILDIVWNLAFVVVAMTVLVMSRDE  107

Query  368  SPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQLPSS  478
            +P  PLRLWI+GY  QCVLH+VCVC+EY+RR +L SS
Sbjct  108  TPSTPLRLWIIGYGLQCVLHMVCVCVEYKRRRRLVSS  144



>ref|XP_011091747.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
Length=329

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQSDWAYSKPIV+LDL WNLAFV+VSISVL+MSR E P MPLRLWIVGYD 
Sbjct  10   EAAAEQIEERQSDWAYSKPIVILDLVWNLAFVIVSISVLIMSRHEDPSMPLRLWIVGYDL  69

Query  413  QCVLHIVCVCLEYRRR  460
            QC+LH+VCVC EY++R
Sbjct  70   QCILHMVCVCAEYKKR  85



>emb|CBI38762.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKPIV+LD+ WNLAFV+V+++VLVMSRDE+P  PLRLWI+GY  
Sbjct  10   ETAAEQLEERQSDWAYSKPIVILDIVWNLAFVVVAMTVLVMSRDETPSTPLRLWIIGYGL  69

Query  413  QCVLHIVCVCLEYRRRNQLPSS  478
            QCVLH+VCVC+EY+RR +L SS
Sbjct  70   QCVLHMVCVCVEYKRRRRLVSS  91



>gb|KJB20721.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=283

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 107/169 (63%), Gaps = 20/169 (12%)
 Frame = +2

Query  2    LLAITPMARAPDDDTTN----VNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrga  169
            + + TP  R+  DD TN    ++  +    +D      +    +  + RFMRR  S    
Sbjct  1    MTSTTPTNRSSADDITNTTPFLSSTTTVSRSDSATRPSVRRQSLREAARFMRRATS----  56

Query  170  arflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVL  349
                     RR MREPSM VRE+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V++ VL
Sbjct  57   ---------RRTMREPSMLVRETAAEQLEERQSDWAYSKPVVILDVIWNFAFVAVAVGVL  107

Query  350  VMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY---RRRNQLPSSPEN  487
             +SRDE+P MPLRLWI+GY FQC+LH+VCVC+EY   RRR  +  SP N
Sbjct  108  FLSRDENPEMPLRLWIIGYAFQCLLHMVCVCVEYKRRRRRQSMDYSPFN  156



>ref|XP_009401775.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=451

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 108/132 (82%), Gaps = 7/132 (5%)
 Frame = +2

Query  68   GGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAE  247
            GGEG+  VD  PLLG    G+ R   R PSLR AA FLRRAS RRMMREPSM VRE+AAE
Sbjct  91   GGEGS--VDPAPLLG----GAGR-SGRGPSLRSAAWFLRRASGRRMMREPSMMVRETAAE  143

Query  248  QIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLH  427
             +EERQ+DWAYSKP+V LD+ WNLAFV V++ VL++SRDE+P MPLRLWIVGY FQC+LH
Sbjct  144  HLEERQNDWAYSKPVVFLDILWNLAFVGVAVGVLILSRDETPSMPLRLWIVGYAFQCLLH  203

Query  428  IVCVCLEYRRRN  463
            +VCVC+EYRRR+
Sbjct  204  MVCVCIEYRRRH  215



>ref|XP_009401774.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=452

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 108/132 (82%), Gaps = 7/132 (5%)
 Frame = +2

Query  68   GGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAE  247
            GGEG+  VD  PLLG    G+ R   R PSLR AA FLRRAS RRMMREPSM VRE+AAE
Sbjct  91   GGEGS--VDPAPLLG----GAGR-SGRGPSLRSAAWFLRRASGRRMMREPSMMVRETAAE  143

Query  248  QIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLH  427
             +EERQ+DWAYSKP+V LD+ WNLAFV V++ VL++SRDE+P MPLRLWIVGY FQC+LH
Sbjct  144  HLEERQNDWAYSKPVVFLDILWNLAFVGVAVGVLILSRDETPSMPLRLWIVGYAFQCLLH  203

Query  428  IVCVCLEYRRRN  463
            +VCVC+EYRRR+
Sbjct  204  MVCVCIEYRRRH  215



>ref|XP_008780243.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Phoenix 
dactylifera]
Length=227

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 95/141 (67%), Gaps = 24/141 (17%)
 Frame = +2

Query  77   GNDGVDTTPLLGDQ-----------IFGSRRFMRRPPSLrgaarflrrassrrmmrepsm  223
            G+  VD+ PLLG             + G+ RF+RR  S             RR+MREPS+
Sbjct  57   GDAAVDSAPLLGPHGAGRGLPGRASLRGAARFLRRASS-------------RRLMREPSV  103

Query  224  rvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVG  403
             VRE+A EQ+EERQSDWAYS+P++ LD+ WNLAFV V+  VLV SRDE P MPLRLWIVG
Sbjct  104  VVRETAVEQLEERQSDWAYSRPVMFLDILWNLAFVSVAAGVLVRSRDERPSMPLRLWIVG  163

Query  404  YDFQCVLHIVCVCLEYRRRNQ  466
            Y  QC LH++C+C+EYRRR++
Sbjct  164  YALQCALHVICMCIEYRRRHR  184



>gb|KJB20720.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=381

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 107/169 (63%), Gaps = 20/169 (12%)
 Frame = +2

Query  2    LLAITPMARAPDDDTTN----VNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrga  169
            + + TP  R+  DD TN    ++  +    +D      +    +  + RFMRR  S    
Sbjct  1    MTSTTPTNRSSADDITNTTPFLSSTTTVSRSDSATRPSVRRQSLREAARFMRRATS----  56

Query  170  arflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVL  349
                     RR MREPSM VRE+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V++ VL
Sbjct  57   ---------RRTMREPSMLVRETAAEQLEERQSDWAYSKPVVILDVIWNFAFVAVAVGVL  107

Query  350  VMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY---RRRNQLPSSPEN  487
             +SRDE+P MPLRLWI+GY FQC+LH+VCVC+EY   RRR  +  SP N
Sbjct  108  FLSRDENPEMPLRLWIIGYAFQCLLHMVCVCVEYKRRRRRQSMDYSPFN  156



>gb|KJB20719.1| hypothetical protein B456_003G161000 [Gossypium raimondii]
Length=389

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 107/169 (63%), Gaps = 20/169 (12%)
 Frame = +2

Query  2    LLAITPMARAPDDDTTN----VNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrga  169
            + + TP  R+  DD TN    ++  +    +D      +    +  + RFMRR  S    
Sbjct  1    MTSTTPTNRSSADDITNTTPFLSSTTTVSRSDSATRPSVRRQSLREAARFMRRATS----  56

Query  170  arflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVL  349
                     RR MREPSM VRE+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V++ VL
Sbjct  57   ---------RRTMREPSMLVRETAAEQLEERQSDWAYSKPVVILDVIWNFAFVAVAVGVL  107

Query  350  VMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY---RRRNQLPSSPEN  487
             +SRDE+P MPLRLWI+GY FQC+LH+VCVC+EY   RRR  +  SP N
Sbjct  108  FLSRDENPEMPLRLWIIGYAFQCLLHMVCVCVEYKRRRRRQSMDYSPFN  156



>ref|XP_006477421.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Citrus sinensis]
Length=381

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 115/158 (73%), Gaps = 14/158 (9%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFG-SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
            +D VDTTP L       D     SRR +RR   LR AARFLR ASSRR MREPSM VRE+
Sbjct  10   DDIVDTTPFLSSNSSHDDSTHSQSRRSIRRQ-GLREAARFLRHASSRRTMREPSMMVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+S++E P MPLRLWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQC  128

Query  419  VLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            VLH+VCVC+EY+RR++   S        NLNS  + G+
Sbjct  129  VLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGD  166



>ref|XP_006477422.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Citrus sinensis]
Length=380

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 115/158 (73%), Gaps = 14/158 (9%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFG-SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
            +D VDTTP L       D     SRR +RR   LR AARFLR ASSRR MREPSM VRE+
Sbjct  10   DDIVDTTPFLSSNSSHDDSTHSQSRRSIRRQ-GLREAARFLRHASSRRTMREPSMMVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+S++E P MPLRLWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQC  128

Query  419  VLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            VLH+VCVC+EY+RR++   S        NLNS  + G+
Sbjct  129  VLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGD  166



>ref|XP_006477420.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Citrus sinensis]
Length=382

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 115/158 (73%), Gaps = 14/158 (9%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFG-SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
            +D VDTTP L       D     SRR +RR   LR AARFLR ASSRR MREPSM VRE+
Sbjct  10   DDIVDTTPFLSSNSSHDDSTHSQSRRSIRRQ-GLREAARFLRHASSRRTMREPSMMVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+S++E P MPLRLWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQC  128

Query  419  VLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            VLH+VCVC+EY+RR++   S        NLNS  + G+
Sbjct  129  VLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGD  166



>ref|XP_002509740.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
 gb|EEF51127.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
Length=383

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  80   NDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEE  259
            +D VDTTPLL     G      R  SLR AARFLRRASSRRMMREPSM VRE+AAEQ+EE
Sbjct  17   DDIVDTTPLLSSGSQGESNSSSRRQSLREAARFLRRASSRRMMREPSMLVRETAAEQLEE  76

Query  260  RQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCV  439
            RQSDWAYSKP+V+LD+ WN AFV V+I VL+MSR E P MPLRLWIVGY  QCVLH+VCV
Sbjct  77   RQSDWAYSKPVVILDILWNFAFVAVAIGVLIMSRKEDPSMPLRLWIVGYGLQCVLHMVCV  136

Query  440  CLEY  451
            C+EY
Sbjct  137  CVEY  140



>ref|XP_009382298.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 74/97 (76%), Gaps = 3/97 (3%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQSDWAYSKP+V LD+ WNLAFV V+  VL++SRDE P MPLRLWIVGY  
Sbjct  61   ETAAEHLEERQSDWAYSKPVVFLDILWNLAFVGVAFGVLILSRDEMPSMPLRLWIVGYAL  120

Query  413  QCVLHIVCVCLEYRRRNQLPS---SPENLNSRRSSGN  514
            QCVLH+VCVC+EYRRR+ L       E   S RSS +
Sbjct  121  QCVLHMVCVCIEYRRRHPLAGPLLDEEEGGSGRSSAS  157



>ref|XP_006477419.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Citrus sinensis]
Length=386

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 115/158 (73%), Gaps = 14/158 (9%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFG-SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
            +D VDTTP L       D     SRR +RR   LR AARFLR ASSRR MREPSM VRE+
Sbjct  10   DDIVDTTPFLSSNSSHDDSTHSQSRRSIRRQ-GLREAARFLRHASSRRTMREPSMMVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+S++E P MPLRLWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQC  128

Query  419  VLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            VLH+VCVC+EY+RR++   S        NLNS  + G+
Sbjct  129  VLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGD  166



>ref|XP_010278589.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Nelumbo 
nucifera]
Length=387

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 112/133 (84%), Gaps = 6/133 (5%)
 Frame = +2

Query  80   NDGVDTTPLLGDQIFG-----SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAA  244
            +D VD+TPLLG+         SRR  RRP SLRGAARFL+RASSRRM+REPSM VRE+AA
Sbjct  12   DDIVDSTPLLGNSDRSGDEDRSRRIGRRP-SLRGAARFLQRASSRRMLREPSMLVRETAA  70

Query  245  EQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVL  424
            EQ+EERQSDWAYS+P+V+LD+ WN+AFV+V+++ L++SR+ESP MPLRLWI+GY  QC+L
Sbjct  71   EQLEERQSDWAYSRPVVVLDMVWNMAFVIVAVAFLILSRNESPSMPLRLWIMGYAVQCIL  130

Query  425  HIVCVCLEYRRRN  463
            H+VCV  EYRRR+
Sbjct  131  HMVCVYAEYRRRH  143



>ref|XP_006477418.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Citrus sinensis]
Length=387

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 115/158 (73%), Gaps = 14/158 (9%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFG-SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
            +D VDTTP L       D     SRR +RR   LR AARFLR ASSRR MREPSM VRE+
Sbjct  10   DDIVDTTPFLSSNSSHDDSTHSQSRRSIRRQ-GLREAARFLRHASSRRTMREPSMMVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+S++E P MPLRLWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQC  128

Query  419  VLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            VLH+VCVC+EY+RR++   S        NLNS  + G+
Sbjct  129  VLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGD  166



>ref|XP_010278588.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Nelumbo 
nucifera]
Length=388

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 112/133 (84%), Gaps = 6/133 (5%)
 Frame = +2

Query  80   NDGVDTTPLLGDQIFG-----SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAA  244
            +D VD+TPLLG+         SRR  RRP SLRGAARFL+RASSRRM+REPSM VRE+AA
Sbjct  12   DDIVDSTPLLGNSDRSGDEDRSRRIGRRP-SLRGAARFLQRASSRRMLREPSMLVRETAA  70

Query  245  EQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVL  424
            EQ+EERQSDWAYS+P+V+LD+ WN+AFV+V+++ L++SR+ESP MPLRLWI+GY  QC+L
Sbjct  71   EQLEERQSDWAYSRPVVVLDMVWNMAFVIVAVAFLILSRNESPSMPLRLWIMGYAVQCIL  130

Query  425  HIVCVCLEYRRRN  463
            H+VCV  EYRRR+
Sbjct  131  HMVCVYAEYRRRH  143



>ref|XP_010278591.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X4 [Nelumbo 
nucifera]
Length=386

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 112/133 (84%), Gaps = 6/133 (5%)
 Frame = +2

Query  80   NDGVDTTPLLGDQIFG-----SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAA  244
            +D VD+TPLLG+         SRR  RRP SLRGAARFL+RASSRRM+REPSM VRE+AA
Sbjct  12   DDIVDSTPLLGNSDRSGDEDRSRRIGRRP-SLRGAARFLQRASSRRMLREPSMLVRETAA  70

Query  245  EQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVL  424
            EQ+EERQSDWAYS+P+V+LD+ WN+AFV+V+++ L++SR+ESP MPLRLWI+GY  QC+L
Sbjct  71   EQLEERQSDWAYSRPVVVLDMVWNMAFVIVAVAFLILSRNESPSMPLRLWIMGYAVQCIL  130

Query  425  HIVCVCLEYRRRN  463
            H+VCV  EYRRR+
Sbjct  131  HMVCVYAEYRRRH  143



>ref|XP_010278590.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X3 [Nelumbo 
nucifera]
Length=387

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 112/133 (84%), Gaps = 6/133 (5%)
 Frame = +2

Query  80   NDGVDTTPLLGDQIFG-----SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAA  244
            +D VD+TPLLG+         SRR  RRP SLRGAARFL+RASSRRM+REPSM VRE+AA
Sbjct  12   DDIVDSTPLLGNSDRSGDEDRSRRIGRRP-SLRGAARFLQRASSRRMLREPSMLVRETAA  70

Query  245  EQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVL  424
            EQ+EERQSDWAYS+P+V+LD+ WN+AFV+V+++ L++SR+ESP MPLRLWI+GY  QC+L
Sbjct  71   EQLEERQSDWAYSRPVVVLDMVWNMAFVIVAVAFLILSRNESPSMPLRLWIMGYAVQCIL  130

Query  425  HIVCVCLEYRRRN  463
            H+VCV  EYRRR+
Sbjct  131  HMVCVYAEYRRRH  143



>ref|XP_010919264.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Elaeis 
guineensis]
Length=378

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+P+V LD+ WNLAFV V+  VLV+SRDE P MPLRLWIVGY  
Sbjct  61   ETAAEQLEERQSDWAYSRPVVFLDILWNLAFVSVAAGVLVLSRDEKPSMPLRLWIVGYAL  120

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QCVLH++CVC+EYRRR  
Sbjct  121  QCVLHMICVCIEYRRRQH  138



>ref|XP_010919263.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+P+V LD+ WNLAFV V+  VLV+SRDE P MPLRLWIVGY  
Sbjct  61   ETAAEQLEERQSDWAYSRPVVFLDILWNLAFVSVAAGVLVLSRDEKPSMPLRLWIVGYAL  120

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QCVLH++CVC+EYRRR  
Sbjct  121  QCVLHMICVCIEYRRRQH  138



>gb|KDO63536.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=324

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+S++E P MPLRLWIVGY  
Sbjct  10   ETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAI  69

Query  413  QCVLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            QCVLH+VCVC+EY+RR++   S        NLNS  + G+
Sbjct  70   QCVLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGD  109



>gb|KDO63537.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=325

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+S++E P MPLRLWIVGY  
Sbjct  10   ETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAI  69

Query  413  QCVLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            QCVLH+VCVC+EY+RR++   S        NLNS  + G+
Sbjct  70   QCVLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGD  109



>gb|KDO63535.1| hypothetical protein CISIN_1g020491mg [Citrus sinensis]
Length=323

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 6/100 (6%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+S++E P MPLRLWIVGY  
Sbjct  10   ETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAI  69

Query  413  QCVLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            QCVLH+VCVC+EY+RR++   S        NLNS  + G+
Sbjct  70   QCVLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGD  109



>gb|KEH31714.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=371

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = +2

Query  92   DTTPLLG---DQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEER  262
            D TPL+G   D+    RR +R  PSLR AARFLR+AS RR+MREPSM VRE+AAEQ+EER
Sbjct  5    DPTPLIGNSSDESNSGRRVLR-APSLRQAARFLRQASGRRLMREPSMMVRETAAEQLEER  63

Query  263  QSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVC  442
            QSDWAYSKP+V+LD+ WN  F++ +++VL++SR+ESP  PLRLWI+GY  QCVLH+VCVC
Sbjct  64   QSDWAYSKPVVILDILWNFVFIIAAVTVLILSRNESPSSPLRLWILGYALQCVLHVVCVC  123

Query  443  LEYRRRNQL  469
             EYRRR ++
Sbjct  124  FEYRRRVRM  132



>gb|EYU35067.1| hypothetical protein MIMGU_mgv1a008119mg [Erythranthe guttata]
Length=384

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = +2

Query  98   TPLLGDQIFGSRR--FMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSD  271
            TPLLGDQIF +         P  R        A+  R +REPS+RVRE+A EQIEERQSD
Sbjct  16   TPLLGDQIFSASAAPLSAGLPVSRRRQISAAPAAGSRALREPSVRVREAATEQIEERQSD  75

Query  272  WAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            WAYSKPIV+LDL WNLAF++V+ISV++MS+ E P MPLRLWIVGY  QCVLH+VCVC E 
Sbjct  76   WAYSKPIVILDLVWNLAFIVVAISVMIMSKTERPSMPLRLWIVGYALQCVLHVVCVCTEC  135

Query  452  RRR  460
            R+R
Sbjct  136  RKR  138



>gb|KHG00577.1| hypothetical protein F383_17805 [Gossypium arboreum]
 gb|KHG12148.1| hypothetical protein F383_00012 [Gossypium arboreum]
Length=382

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 102/163 (63%), Gaps = 18/163 (11%)
 Frame = +2

Query  2    LLAITPMARAPDDDTTNV-----NVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrg  166
            + + TP  R+  DD TN      +  +     D      +    +  + RFMRR  S   
Sbjct  1    MTSTTPTNRSSADDITNTTPFLSSTTTTVSRPDSATRPSVRRQSLREAARFMRRATS---  57

Query  167  aarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISV  346
                      RR MREPSM VRE+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V+  V
Sbjct  58   ----------RRSMREPSMLVRETAAEQLEERQSDWAYSKPVVILDVIWNFAFVAVAAGV  107

Query  347  LVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQLPS  475
            L +SRDE+P MPLRLWI+GY FQC+LH+VCVC+EY+RR +  S
Sbjct  108  LFLSRDENPEMPLRLWIIGYAFQCLLHMVCVCVEYKRRRRRQS  150



>ref|XP_006345510.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Solanum 
tuberosum]
Length=396

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = +2

Query  23   ARAPDDDTTNVNVNSGGEGNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrr  202
            A A +D+  N +V S  +G  G+DTTP L  Q   +RR  RRPPSLRGAA FLRRASSRR
Sbjct  4    ATAANDNIPNTDV-SPSDGV-GIDTTPFLTSQNSRNRRSFRRPPSLRGAAGFLRRASSRR  61

Query  203  mmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMP  382
            +MREPSMRVRE+AAEQIEERQSDWAYSKPIV++DL WNLAFV+VSISVLV+SR+ESP MP
Sbjct  62   LMREPSMRVREAAAEQIEERQSDWAYSKPIVIIDLLWNLAFVIVSISVLVLSRNESPSMP  121

Query  383  LRLWIVGYDFQCVLHIVCVCLEY  451
            LRLWIVGY  Q VLH+VCV +EY
Sbjct  122  LRLWIVGYALQSVLHMVCVFVEY  144



>ref|XP_010933858.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Elaeis guineensis]
Length=378

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DWAYS+P+V LD+ WNLAFV V+  VLV+SRDE P MPLRLWIVGY  
Sbjct  61   ETAAEQLEERQTDWAYSRPVVFLDILWNLAFVSVAAGVLVLSRDERPSMPLRLWIVGYVL  120

Query  413  QCVLHIVCVCLEYRRRN  463
            QCVLH++CVC+EYRRR+
Sbjct  121  QCVLHVICVCIEYRRRH  137



>ref|XP_010933860.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=377

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DWAYS+P+V LD+ WNLAFV V+  VLV+SRDE P MPLRLWIVGY  
Sbjct  61   ETAAEQLEERQTDWAYSRPVVFLDILWNLAFVSVAAGVLVLSRDERPSMPLRLWIVGYVL  120

Query  413  QCVLHIVCVCLEYRRRN  463
            QCVLH++CVC+EYRRR+
Sbjct  121  QCVLHVICVCIEYRRRH  137



>ref|XP_008800795.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Phoenix 
dactylifera]
Length=384

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 104/135 (77%), Gaps = 5/135 (4%)
 Frame = +2

Query  77   GNDGVDTTPLLGDQIFGS----RRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAA  244
            G   +D  PLLG +  G     RR  RRP SLRGAARF RRA SRRM+REPSM VRE+AA
Sbjct  11   GGATMDPGPLLGTRSGGGEDRGRRNGRRP-SLRGAARFFRRAGSRRMLREPSMLVREAAA  69

Query  245  EQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVL  424
            EQ+EERQ DWAYS+P+V LD+ WNLAFV  S +VLV+SR+E P MPLRLWI GY  QCVL
Sbjct  70   EQLEERQRDWAYSRPVVFLDILWNLAFVAASAAVLVLSREERPSMPLRLWIGGYVLQCVL  129

Query  425  HIVCVCLEYRRRNQL  469
            H+VCVC+EYRRR+ L
Sbjct  130  HMVCVCIEYRRRHPL  144



>gb|KJB25759.1| hypothetical protein B456_004G208600 [Gossypium raimondii]
 gb|KJB25760.1| hypothetical protein B456_004G208600 [Gossypium raimondii]
Length=381

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 107/136 (79%), Gaps = 7/136 (5%)
 Frame = +2

Query  62   NSGGEGNDGVDTTPLLG------DQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsm  223
             S    +D  DTTP L       +    +RR +RR  SLR AARFLRRASSRRMMREPSM
Sbjct  7    TSRSSSDDITDTTPFLSPTSNASNDDSSTRRTVRRQ-SLRDAARFLRRASSRRMMREPSM  65

Query  224  rvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVG  403
             VRE+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV+V++ VL++SR+ESP MPLRLWI+G
Sbjct  66   LVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVVVAVGVLILSRNESPDMPLRLWIIG  125

Query  404  YDFQCVLHIVCVCLEY  451
            Y FQC LHIVCVC+EY
Sbjct  126  YAFQCFLHIVCVCVEY  141



>gb|KHG06982.1| hypothetical protein F383_33104 [Gossypium arboreum]
Length=381

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV+V++ +L++SR+ESP MPLRLWI+GY F
Sbjct  69   ETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVVVAVGILILSRNESPDMPLRLWIIGYAF  128

Query  413  QCVLHIVCVCLEY  451
            QC LHIVCVC+EY
Sbjct  129  QCFLHIVCVCVEY  141



>ref|XP_003550874.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=379

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 3/97 (3%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV  + +VLV+SR+E+P MPLRLWIVGY  
Sbjct  68   EAAAEQLEERQSDWAYSKPVVVLDILWNCAFVAAAATVLVLSRNENPNMPLRLWIVGYAL  127

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            Q VLH+ CVC+EYRRR +     E+ N+   SG+ SG
Sbjct  128  QSVLHVACVCVEYRRRLR---HREHSNAAAVSGDGSG  161



>gb|KHG00725.1| hypothetical protein F383_22058 [Gossypium arboreum]
Length=381

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 106/138 (77%), Gaps = 7/138 (5%)
 Frame = +2

Query  80   NDGVDTTPLLGDQIFGSR------RFMRRPPSLrgaarflrrassrrmmrepsmrvrESA  241
            +D +D TPLL      SR      R +RR  SLR AARFLRRASSRRMMREPSM VRE+A
Sbjct  13   DDIIDVTPLLSSTSNASRDESNPRRSVRRQ-SLREAARFLRRASSRRMMREPSMLVRETA  71

Query  242  AEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCV  421
            AEQ+EERQSDWAYSKP+V+LD+ WN AFV VSI VL+ SR+E P  PLRLWI+GY  QC+
Sbjct  72   AEQLEERQSDWAYSKPVVVLDIIWNFAFVAVSIGVLLSSREERPDTPLRLWIIGYALQCL  131

Query  422  LHIVCVCLEYRRRNQLPS  475
            LH+VCVC+EYRRR +  S
Sbjct  132  LHMVCVCVEYRRRRRQQS  149



>ref|XP_004511598.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=393

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 99/131 (76%), Gaps = 7/131 (5%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESA  241
             D VD+TP +       D+I   RRF RR   L  AARFLR+AS RRMMREPS+ VRE+A
Sbjct  12   EDIVDSTPFIANSGGSSDEINAGRRFARRQ-RLLQAARFLRQASGRRMMREPSVVVREAA  70

Query  242  AEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCV  421
            AEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ +VL +SR E P MPLRLWI GY  QC+
Sbjct  71   AEQLEERQSDWAYSKPVVILDIVWNFAFVVVAATVLFLSRSEVPEMPLRLWIAGYVLQCI  130

Query  422  LHIVCVCLEYR  454
            LH+VCVC EY+
Sbjct  131  LHMVCVCFEYK  141



>ref|XP_004240042.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
lycopersicum]
Length=396

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 103/154 (67%), Gaps = 28/154 (18%)
 Frame = +2

Query  29   APDDDTTNVNVNSGGEGNDGVDTTPLLGDQ-------------IFGSRRFMRRPPSLrga  169
            A +D+  N +V+       G+DTTP L  Q             + G+  F+RR  S    
Sbjct  6    AANDNIPNADVSPSN--GVGIDTTPFLTSQNSRSRRSFRRPPSLRGAAGFLRRASS----  59

Query  170  arflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVL  349
                     RR+MREPSMRVRE+AAEQIEERQSDWAYSKPIV++DL WNLAFV+VSISVL
Sbjct  60   ---------RRLMREPSMRVREAAAEQIEERQSDWAYSKPIVIIDLLWNLAFVIVSISVL  110

Query  350  VMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            V+SR+ESP MPLRLWIVGY  Q VLH+VCV +EY
Sbjct  111  VLSRNESPSMPLRLWIVGYASQSVLHMVCVFVEY  144



>gb|KHG06981.1| hypothetical protein F383_33104 [Gossypium arboreum]
Length=686

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV+V++ +L++SR+ESP MPLRLWI+GY F
Sbjct  69   ETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVVVAVGILILSRNESPDMPLRLWIIGYAF  128

Query  413  QCVLHIVCVCLEY  451
            QC LHIVCVC+EY
Sbjct  129  QCFLHIVCVCVEY  141



>ref|XP_006440563.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53803.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=382

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 113/158 (72%), Gaps = 14/158 (9%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFG-SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
            +D VDTTP L       D     SRR +RR   LR AARFLR ASSRR MREPSM VRE+
Sbjct  10   DDIVDTTPFLSSNSSHDDSTHSQSRRSIRRQ-GLREAARFLRHASSRRTMREPSMMVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+SR+E P MPL LWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSRNERPNMPLGLWIVGYAIQC  128

Query  419  VLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            VLH+VCVC+EY+RR +   S        NLNS  + G+
Sbjct  129  VLHMVCVCVEYKRRRRRRVSAFGGAEEGNLNSGTTRGD  166



>ref|XP_006440560.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53800.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=380

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 113/158 (72%), Gaps = 14/158 (9%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFG-SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
            +D VDTTP L       D     SRR +RR   LR AARFLR ASSRR MREPSM VRE+
Sbjct  10   DDIVDTTPFLSSNSSHDDSTHSQSRRSIRRQ-GLREAARFLRHASSRRTMREPSMMVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+SR+E P MPL LWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSRNERPNMPLGLWIVGYAIQC  128

Query  419  VLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            VLH+VCVC+EY+RR +   S        NLNS  + G+
Sbjct  129  VLHMVCVCVEYKRRRRRRVSAFGGAEEGNLNSGTTRGD  166



>ref|XP_010458710.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Camelina sativa]
Length=408

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLVMSRDE P+MPLR+W++GY  
Sbjct  81   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAVLVMSRDEHPIMPLRVWLLGYAL  140

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC EY
Sbjct  141  QCVLHMVCVCFEY  153



>ref|XP_006440561.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53801.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=381

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 113/158 (72%), Gaps = 14/158 (9%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFG-SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
            +D VDTTP L       D     SRR +RR   LR AARFLR ASSRR MREPSM VRE+
Sbjct  10   DDIVDTTPFLSSNSSHDDSTHSQSRRSIRRQ-GLREAARFLRHASSRRTMREPSMMVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+SR+E P MPL LWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSRNERPNMPLGLWIVGYAIQC  128

Query  419  VLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            VLH+VCVC+EY+RR +   S        NLNS  + G+
Sbjct  129  VLHMVCVCVEYKRRRRRRVSAFGGAEEGNLNSGTTRGD  166



>ref|XP_006440562.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
 gb|ESR53802.1| hypothetical protein CICLE_v10020554mg [Citrus clementina]
Length=386

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 113/158 (72%), Gaps = 14/158 (9%)
 Frame = +2

Query  80   NDGVDTTPLLG------DQIFG-SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
            +D VDTTP L       D     SRR +RR   LR AARFLR ASSRR MREPSM VRE+
Sbjct  10   DDIVDTTPFLSSNSSHDDSTHSQSRRSIRRQ-GLREAARFLRHASSRRTMREPSMMVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ SV+V+SR+E P MPL LWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSRNERPNMPLGLWIVGYAIQC  128

Query  419  VLHIVCVCLEYRRRNQLPSSP------ENLNSRRSSGN  514
            VLH+VCVC+EY+RR +   S        NLNS  + G+
Sbjct  129  VLHMVCVCVEYKRRRRRRVSAFGGAEEGNLNSGTTRGD  166



>ref|XP_010545919.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Tarenaya hassleriana]
Length=413

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLV+SRDE P MPLR+WIVGY  
Sbjct  92   ETAAEQLEERQSDWAYSKPVVVLDILWNLAFVSVAAAVLVLSRDEKPNMPLRVWIVGYAL  151

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  152  QCVLHMVCVCVEY  164



>ref|XP_010545936.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X3 [Tarenaya hassleriana]
Length=412

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLV+SRDE P MPLR+WIVGY  
Sbjct  92   ETAAEQLEERQSDWAYSKPVVVLDILWNLAFVSVAAAVLVLSRDEKPNMPLRVWIVGYAL  151

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  152  QCVLHMVCVCVEY  164



>ref|XP_010545928.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Tarenaya hassleriana]
Length=412

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLV+SRDE P MPLR+WIVGY  
Sbjct  92   ETAAEQLEERQSDWAYSKPVVVLDILWNLAFVSVAAAVLVLSRDEKPNMPLRVWIVGYAL  151

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  152  QCVLHMVCVCVEY  164



>ref|XP_010545944.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X4 [Tarenaya hassleriana]
Length=411

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLV+SRDE P MPLR+WIVGY  
Sbjct  92   ETAAEQLEERQSDWAYSKPVVVLDILWNLAFVSVAAAVLVLSRDEKPNMPLRVWIVGYAL  151

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  152  QCVLHMVCVCVEY  164



>ref|XP_008438087.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Cucumis 
melo]
Length=385

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 103/152 (68%), Gaps = 9/152 (6%)
 Frame = +2

Query  86   GVDTTPLLGDQI----FGSRRFMRRPPS--LrgaarflrrassrrmmrepsmrvrESAAE  247
             VD +PLLG  +    F SR F+RR P           R +  + M+REPS+RVRE+AAE
Sbjct  14   AVDNSPLLGHSVTNGLFRSRGFIRRSPQPLRGAVRLLRRASGRQMMLREPSVRVRETAAE  73

Query  248  QIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLH  427
            Q+EERQSDWAYSKPI+LLDL WNLAFV++S +VL +S  E+P +PLR WI+GY  QC++H
Sbjct  74   QLEERQSDWAYSKPIILLDLLWNLAFVIISFTVLGLSTRENPSVPLRFWIIGYALQCIIH  133

Query  428  IVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            + CV +EY+RR    S+ E     R+SG  SG
Sbjct  134  MSCVAVEYKRRR---STREPAGLDRNSGWTSG  162



>ref|XP_008438088.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Cucumis 
melo]
Length=384

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 103/152 (68%), Gaps = 9/152 (6%)
 Frame = +2

Query  86   GVDTTPLLGDQI----FGSRRFMRRPPS--LrgaarflrrassrrmmrepsmrvrESAAE  247
             VD +PLLG  +    F SR F+RR P           R +  + M+REPS+RVRE+AAE
Sbjct  14   AVDNSPLLGHSVTNGLFRSRGFIRRSPQPLRGAVRLLRRASGRQMMLREPSVRVRETAAE  73

Query  248  QIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLH  427
            Q+EERQSDWAYSKPI+LLDL WNLAFV++S +VL +S  E+P +PLR WI+GY  QC++H
Sbjct  74   QLEERQSDWAYSKPIILLDLLWNLAFVIISFTVLGLSTRENPSVPLRFWIIGYALQCIIH  133

Query  428  IVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            + CV +EY+RR    S+ E     R+SG  SG
Sbjct  134  MSCVAVEYKRRR---STREPAGLDRNSGWTSG  162



>ref|XP_010476241.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=405

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLVMS+DE P+MPLR+W++GY  
Sbjct  82   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAVLVMSKDEHPIMPLRVWLLGYAL  141

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC EY
Sbjct  142  QCVLHMVCVCFEY  154



>gb|KFK43535.1| hypothetical protein AALP_AA1G139400 [Arabis alpina]
Length=397

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLVMSR+E P+MPLR+WI+GY  
Sbjct  75   ETAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAVLVMSRNEHPIMPLRVWILGYAL  134

Query  413  QCVLHIVCVCLEY  451
            QCVLH++CVC+EY
Sbjct  135  QCVLHMICVCVEY  147



>ref|XP_004133878.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 ref|XP_004155812.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 gb|KGN56546.1| hypothetical protein Csa_3G123190 [Cucumis sativus]
Length=385

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 93/131 (71%), Gaps = 6/131 (5%)
 Frame = +2

Query  86   GVDTTPLLGDQI----FGSRRFMRRPPS--LrgaarflrrassrrmmrepsmrvrESAAE  247
             VD +PLLG  +    F SR F+RR P           R +  + M+REPS+RVRE+AAE
Sbjct  14   AVDNSPLLGHSVTNGLFRSRGFIRRSPQPLRGAVRLLRRASGRQMMLREPSVRVRETAAE  73

Query  248  QIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLH  427
            Q+EERQSDWAYSKPI+LLDL WNLAFV++S +VL +S  E P +PLR WI+GY  QC++H
Sbjct  74   QLEERQSDWAYSKPIILLDLLWNLAFVIISFTVLGLSTSEKPSVPLRFWIIGYALQCIIH  133

Query  428  IVCVCLEYRRR  460
            + CV +EY+RR
Sbjct  134  MSCVAVEYKRR  144



>emb|CDY31275.1| BnaC08g15700D [Brassica napus]
Length=394

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKPIV+LD+ WNLAFV V+ +VLVMSR+E P+MPLR+W++GY  
Sbjct  82   EAAAEQLEERQSDWAYSKPIVVLDIVWNLAFVSVAAAVLVMSRNEHPIMPLRVWLLGYAL  141

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  142  QCVLHMVCVCVEY  154



>ref|NP_001047717.2| Os02g0674700 [Oryza sativa Japonica Group]
 dbj|BAF09631.2| Os02g0674700 [Oryza sativa Japonica Group]
Length=379

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+Q+EERQ+DWAYS+P+V LDL WNLAF+LV+ +VL +SR+ESP MPLRLWIVGY  
Sbjct  65   EAAADQLEERQADWAYSRPVVALDLLWNLAFILVAAAVLALSREESPSMPLRLWIVGYAV  124

Query  413  QCVLHIVCVCLEYR-RRNQLPSSP  481
            QCVLH+ CV +EYR RR Q   SP
Sbjct  125  QCVLHMACVAIEYRMRRGQSGESP  148



>ref|XP_010494577.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=399

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VL+MS+DE P+MPLR+W++GY  
Sbjct  80   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAVLIMSKDEHPIMPLRVWLLGYAL  139

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC EY
Sbjct  140  QCVLHMVCVCFEY  152



>ref|XP_010934467.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Elaeis guineensis]
Length=384

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ DWAYS+P+V LD+ WNLAFV  +  VLV+SR E P MPLRLWI GY  
Sbjct  66   EAAAEQLEERQRDWAYSRPVVFLDILWNLAFVAAAAGVLVLSRQERPSMPLRLWIGGYAL  125

Query  413  QCVLHIVCVCLEYRRRNQLPSSPEN  487
            QCVLH+VCVC+EYRRR+  PS  E 
Sbjct  126  QCVLHVVCVCIEYRRRH--PSQREE  148



>dbj|BAD29468.1| ring zinc finger protein-like [Oryza sativa Japonica Group]
Length=399

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+Q+EERQ+DWAYS+P+V LDL WNLAF+LV+ +VL +SR+ESP MPLRLWIVGY  
Sbjct  65   EAAADQLEERQADWAYSRPVVALDLLWNLAFILVAAAVLALSREESPSMPLRLWIVGYAV  124

Query  413  QCVLHIVCVCLEYR-RRNQLPSSP  481
            QCVLH+ CV +EYR RR Q   SP
Sbjct  125  QCVLHMACVAIEYRMRRGQSGESP  148



>ref|XP_010934468.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=383

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ DWAYS+P+V LD+ WNLAFV  +  VLV+SR E P MPLRLWI GY  
Sbjct  66   EAAAEQLEERQRDWAYSRPVVFLDILWNLAFVAAAAGVLVLSRQERPSMPLRLWIGGYAL  125

Query  413  QCVLHIVCVCLEYRRRNQLPSSPEN  487
            QCVLH+VCVC+EYRRR+  PS  E 
Sbjct  126  QCVLHVVCVCIEYRRRH--PSQREE  148



>ref|XP_002889965.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66224.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=335

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ ++LVMSR+E P+MPLR+W++GY  
Sbjct  10   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAILVMSRNEHPIMPLRVWLLGYAL  69

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  70   QCVLHMVCVCVEY  82



>ref|XP_006304987.1| hypothetical protein CARUB_v10009353mg [Capsella rubella]
 gb|EOA37885.1| hypothetical protein CARUB_v10009353mg [Capsella rubella]
Length=397

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLVMSR+E P+MPLR+W++GY  
Sbjct  74   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAVLVMSRNEHPIMPLRVWLLGYAL  133

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  134  QCVLHMVCVCVEY  146



>ref|XP_006391773.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
 gb|ESQ29059.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
Length=388

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            ESAAEQ+EERQSDWAYSKP+V+LD  WNLAFV V+ +VLV+S DE P MPLR+WI+GY  
Sbjct  77   ESAAEQLEERQSDWAYSKPVVVLDFVWNLAFVAVATAVLVLSSDEKPNMPLRVWIIGYGL  136

Query  413  QCVLHIVCVCLEYRR  457
            QC++H++CVC+EYR+
Sbjct  137  QCMMHMLCVCVEYRK  151



>emb|CDY21061.1| BnaA08g24640D [Brassica napus]
Length=324

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+PIV+LD+ WNLAFV V+ +VLVMSR+E P+MPLR+W++GY  
Sbjct  10   EAAAEQLEERQSDWAYSRPIVVLDIVWNLAFVSVAGAVLVMSRNEHPIMPLRVWLLGYAL  69

Query  413  QCVLHIVCVCLEYR  454
            QCVLH+VCVC+EY+
Sbjct  70   QCVLHMVCVCVEYK  83



>ref|XP_006391774.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
 gb|ESQ29060.1| hypothetical protein EUTSA_v10023515mg [Eutrema salsugineum]
Length=389

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            ESAAEQ+EERQSDWAYSKP+V+LD  WNLAFV V+ +VLV+S DE P MPLR+WI+GY  
Sbjct  77   ESAAEQLEERQSDWAYSKPVVVLDFVWNLAFVAVATAVLVLSSDEKPNMPLRVWIIGYGL  136

Query  413  QCVLHIVCVCLEYRR  457
            QC++H++CVC+EYR+
Sbjct  137  QCMMHMLCVCVEYRK  151



>ref|XP_009110629.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Brassica rapa]
Length=389

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+PIV+LD+ WNLAFV V+ +VLVMSR+E P+MPLR+W++GY  
Sbjct  75   EAAAEQLEERQSDWAYSRPIVVLDIVWNLAFVSVAGAVLVMSRNEHPIMPLRVWLLGYAL  134

Query  413  QCVLHIVCVCLEYR  454
            QCVLH+VCVC+EY+
Sbjct  135  QCVLHMVCVCVEYK  148



>ref|XP_003570089.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brachypodium 
distachyon]
 ref|XP_010235813.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brachypodium 
distachyon]
Length=374

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = +2

Query  77   GNDGVDTTPLLGDQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIE  256
            G+  +D+ PLLG      RR + R PSLRG AR LR+   R M     +   E+AAEQ+E
Sbjct  11   GDALLDSAPLLGGGT--RRRGVLRRPSLRGTARLLRQGGRRAMREPSLLVR-ETAAEQLE  67

Query  257  ERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVC  436
            ERQ+DWAYS+P+V LDL WNLAF+LVS  VLV S DE+P +PLR+WI GY  QCVLHIVC
Sbjct  68   ERQADWAYSRPVVALDLLWNLAFILVSAVVLVFSSDENPSVPLRIWIAGYAVQCVLHIVC  127

Query  437  VCLEYRRRNQLPSSP  481
            V +EYR R++    P
Sbjct  128  VAIEYRFRHRQRGGP  142



>ref|NP_001031032.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 dbj|BAH20087.1| AT1G12760 [Arabidopsis thaliana]
 gb|AEE28925.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=337

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ ++LVMSR E P+MPLR+W++GY  
Sbjct  10   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAILVMSRKEHPIMPLRVWLLGYAL  69

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  70   QCVLHMVCVCVEY  82



>ref|XP_007040144.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
 gb|EOY24645.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
Length=381

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 107/142 (75%), Gaps = 10/142 (7%)
 Frame = +2

Query  44   TTNVNVNSGGEGNDGVDTTPLLGDQIF------GSRRFMRRPPSLrgaarflrrassrrm  205
            TT  N +S    +D +DTTP L            +RR +RR  SLR AARFLRRASSRRM
Sbjct  4    TTPTNRSSS---DDIIDTTPFLSSSSSVSRDESTTRRSVRRQ-SLREAARFLRRASSRRM  59

Query  206  mrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPL  385
            MREPSM VRE+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V++ VLV SRDE P MPL
Sbjct  60   MREPSMLVRETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAVGVLVWSRDERPNMPL  119

Query  386  RLWIVGYDFQCVLHIVCVCLEY  451
            RLWI+GY  QC+LH+VCVC+EY
Sbjct  120  RLWIIGYALQCLLHMVCVCVEY  141



>ref|XP_007040145.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
2 [Theobroma cacao]
 gb|EOY24646.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
2 [Theobroma cacao]
Length=380

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 107/142 (75%), Gaps = 10/142 (7%)
 Frame = +2

Query  44   TTNVNVNSGGEGNDGVDTTPLLGDQIF------GSRRFMRRPPSLrgaarflrrassrrm  205
            TT  N +S    +D +DTTP L            +RR +RR  SLR AARFLRRASSRRM
Sbjct  4    TTPTNRSSS---DDIIDTTPFLSSSSSVSRDESTTRRSVRRQ-SLREAARFLRRASSRRM  59

Query  206  mrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPL  385
            MREPSM VRE+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V++ VLV SRDE P MPL
Sbjct  60   MREPSMLVRETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAVGVLVWSRDERPNMPL  119

Query  386  RLWIVGYDFQCVLHIVCVCLEY  451
            RLWI+GY  QC+LH+VCVC+EY
Sbjct  120  RLWIIGYALQCLLHMVCVCVEY  141



>ref|XP_009110628.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Brassica rapa]
Length=390

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+PIV+LD+ WNLAFV V+ +VLVMSR+E P+MPLR+W++GY  
Sbjct  75   EAAAEQLEERQSDWAYSRPIVVLDIVWNLAFVSVAGAVLVMSRNEHPIMPLRVWLLGYAL  134

Query  413  QCVLHIVCVCLEYR  454
            QCVLH+VCVC+EY+
Sbjct  135  QCVLHMVCVCVEYK  148



>ref|XP_006417201.1| hypothetical protein EUTSA_v10007780mg [Eutrema salsugineum]
 gb|ESQ35554.1| hypothetical protein EUTSA_v10007780mg [Eutrema salsugineum]
Length=408

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLVMSR+E P+MPLR+W++GY  
Sbjct  86   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVASAVLVMSRNEHPIMPLRVWLLGYAL  145

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  146  QCVLHMVCVCVEY  158



>ref|NP_172736.2| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 sp|Q9LN71.1|RING1_ARATH RecName: Full=E3 ubiquitin-protein ligase At1g12760; AltName: 
Full=RING finger protein At1g12760 [Arabidopsis thaliana]
 gb|AAF88088.1|AC025417_16 T12C24.29 [Arabidopsis thaliana]
 gb|AAM97036.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15598.1| unknown protein [Arabidopsis thaliana]
 gb|AAY63561.1| RING domain protein [Arabidopsis thaliana]
 gb|AEE28924.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=408

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ ++LVMSR E P+MPLR+W++GY  
Sbjct  81   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAILVMSRKEHPIMPLRVWLLGYAL  140

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  141  QCVLHMVCVCVEY  153



>gb|KFK31927.1| hypothetical protein AALP_AA6G177200 [Arabis alpina]
Length=389

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 71/109 (65%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  66   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  103

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P MPLR+WIVGY  QC LH+ CVC+EY
Sbjct  104  ILWNLAFVAIGVAVLILSRDEMPNMPLRVWIVGYGVQCGLHMACVCVEY  152



>ref|XP_010544693.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Tarenaya 
hassleriana]
Length=375

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 107/156 (69%), Gaps = 9/156 (6%)
 Frame = +2

Query  65   SGGEGNDGVDTTPLLGDQIFGSRRFMRRPPS---LrgaarflrrassrrmmrepsmrvrE  235
            S     D VD +PLLG     +RR + RP        A    R +S R M+REPS+RVRE
Sbjct  10   SSSPAMDAVDVSPLLGR----NRRILPRPSQPLRGAAARLLRRASSRRMMLREPSVRVRE  65

Query  236  SAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQ  415
            +AAEQIEERQS+WAYS+PI++LD+ WNLAFV+VSI+VL  S +E P +PLRLWI+GY+FQ
Sbjct  66   NAAEQIEERQSEWAYSRPIIVLDVLWNLAFVIVSIAVLGFSLEEKPDVPLRLWIIGYNFQ  125

Query  416  CVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            C+ H+ CV  EYRRR +     E  +S  +SG++SG
Sbjct  126  CLFHVGCVIAEYRRRREGNHPAE--DSASNSGSFSG  159



>ref|XP_010422123.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=391

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 72/109 (66%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  71   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  108

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P +PLR+W+VGY FQC LH+ CVC+EY
Sbjct  109  ILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGFQCGLHMACVCVEY  157



>ref|XP_006396865.1| hypothetical protein EUTSA_v10028703mg [Eutrema salsugineum]
 gb|ESQ38318.1| hypothetical protein EUTSA_v10028703mg [Eutrema salsugineum]
Length=402

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 108/159 (68%), Gaps = 11/159 (7%)
 Frame = +2

Query  5    LAITPMARAPDDDTTNVNVNSGGEGNDGV-DTTPLLG---------DQIFGSRRFMRRPP  154
            ++ T  A   + D  ++    G   +DG+ DTTPLL          D+  G  R  RR  
Sbjct  1    MSATTTANTTEPDLASLPSRVGRANSDGIIDTTPLLPSGVSRTVSVDEDNGIHRSARRQ-  59

Query  155  SLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLV  334
             LR AARFLR A SRRMMREPSM VRE+AAEQ+EERQSDWAYSKP+V LD+ WNLAFV +
Sbjct  60   GLREAARFLRHAGSRRMMREPSMLVRETAAEQLEERQSDWAYSKPVVFLDILWNLAFVAI  119

Query  335  SISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
             ++VL++SRDE P MPLR+W+VGY  QC LH+ CVC EY
Sbjct  120  GVAVLILSRDERPNMPLRVWVVGYGIQCGLHMACVCFEY  158



>ref|XP_010544692.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Tarenaya 
hassleriana]
Length=379

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 107/156 (69%), Gaps = 9/156 (6%)
 Frame = +2

Query  65   SGGEGNDGVDTTPLLGDQIFGSRRFMRRPPS---LrgaarflrrassrrmmrepsmrvrE  235
            S     D VD +PLLG     +RR + RP        A    R +S R M+REPS+RVRE
Sbjct  10   SSSPAMDAVDVSPLLGR----NRRILPRPSQPLRGAAARLLRRASSRRMMLREPSVRVRE  65

Query  236  SAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQ  415
            +AAEQIEERQS+WAYS+PI++LD+ WNLAFV+VSI+VL  S +E P +PLRLWI+GY+FQ
Sbjct  66   NAAEQIEERQSEWAYSRPIIVLDVLWNLAFVIVSIAVLGFSLEEKPDVPLRLWIIGYNFQ  125

Query  416  CVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            C+ H+ CV  EYRRR +     E  +S  +SG++SG
Sbjct  126  CLFHVGCVIAEYRRRREGNHPAE--DSASNSGSFSG  159



>ref|NP_567379.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
 sp|Q93Z92.1|RING4_ARATH RecName: Full=E3 ubiquitin-protein ligase At4g11680; AltName: 
Full=RING finger protein At4g11680 [Arabidopsis thaliana]
 gb|AAL15343.1| AT4g11680/T5C23_110 [Arabidopsis thaliana]
 gb|AAR23720.1| At4g11680/T5C23_110 [Arabidopsis thaliana]
 gb|AAY57607.1| RING finger family protein [Arabidopsis thaliana]
 gb|AEE83038.1| E3 ubiquitin-protein ligase [Arabidopsis thaliana]
Length=390

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 71/109 (65%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  76   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  113

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P MPLR+W+VGY  QC LH+ CVC+EY
Sbjct  114  ILWNLAFVAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEY  162



>ref|XP_004515807.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=379

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 113/154 (73%), Gaps = 8/154 (5%)
 Frame = +2

Query  80   NDGVDTTPLLG---DQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQ  250
            ++  D TPL+G   D+    RR +R  PSLR AARFLR+AS RR+MREPSM VRE+AAEQ
Sbjct  12   DETTDPTPLIGSSSDESNSGRRVIR-APSLRQAARFLRQASGRRLMREPSMMVRETAAEQ  70

Query  251  IEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHI  430
            +EERQSDWAYSKP+V+LD+ WN AFV+ +++VL++S +ESP  PLRLWI+GY  QCV+H+
Sbjct  71   LEERQSDWAYSKPVVILDILWNFAFVVAAVTVLILSPNESPSTPLRLWILGYALQCVVHV  130

Query  431  VCVCLEY----RRRNQLPSSPENLNSRRSSGNWS  520
            +CVC E+    R R Q  ++  N    R SG+ S
Sbjct  131  LCVCFEFRRRRRVREQSNATAANAVEGRGSGDLS  164



>ref|XP_010434567.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=391

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 72/109 (66%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  71   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  108

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P +PLR+W+VGY FQC LH+ CVC+EY
Sbjct  109  ILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGFQCGLHMACVCVEY  157



>ref|XP_010455583.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=392

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 72/109 (66%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  71   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  108

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P +PLR+W+VGY FQC LH+ CVC+EY
Sbjct  109  ILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGFQCGLHMACVCVEY  157



>emb|CAB39939.1| putative protein [Arabidopsis thaliana]
 emb|CAB78211.1| putative protein [Arabidopsis thaliana]
Length=419

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 71/109 (65%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  76   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  113

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P MPLR+W+VGY  QC LH+ CVC+EY
Sbjct  114  ILWNLAFVAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEY  162



>ref|XP_010553507.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Tarenaya hassleriana]
Length=399

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+E RQSDWAYSKP+V+LD+ WNLAFV V+ +V+V+SRDE P MPLR+WIVGY  
Sbjct  89   ETAAEQLEVRQSDWAYSKPVVVLDIVWNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYAL  148

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  149  QCVLHMVCVCVEY  161



>ref|XP_010553508.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X4 [Tarenaya hassleriana]
Length=399

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+E RQSDWAYSKP+V+LD+ WNLAFV V+ +V+V+SRDE P MPLR+WIVGY  
Sbjct  89   ETAAEQLEVRQSDWAYSKPVVVLDIVWNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYAL  148

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  149  QCVLHMVCVCVEY  161



>ref|XP_010553509.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X5 [Tarenaya hassleriana]
Length=398

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+E RQSDWAYSKP+V+LD+ WNLAFV V+ +V+V+SRDE P MPLR+WIVGY  
Sbjct  89   ETAAEQLEVRQSDWAYSKPVVVLDIVWNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYAL  148

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  149  QCVLHMVCVCVEY  161



>ref|XP_010553504.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Tarenaya hassleriana]
Length=414

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+E RQSDWAYSKP+V+LD+ WNLAFV V+ +V+V+SRDE P MPLR+WIVGY  
Sbjct  89   ETAAEQLEVRQSDWAYSKPVVVLDIVWNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYAL  148

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  149  QCVLHMVCVCVEY  161



>ref|XP_010553505.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Tarenaya hassleriana]
Length=413

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+E RQSDWAYSKP+V+LD+ WNLAFV V+ +V+V+SRDE P MPLR+WIVGY  
Sbjct  89   ETAAEQLEVRQSDWAYSKPVVVLDIVWNLAFVAVATAVIVLSRDEKPNMPLRVWIVGYAL  148

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  149  QCVLHMVCVCVEY  161



>emb|CDY26592.1| BnaA09g46850D [Brassica napus]
Length=384

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+  VLVMSRDE+P+MPLR+W++GY  
Sbjct  68   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVAAGVLVMSRDENPIMPLRVWLLGYAL  127

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCV +EY
Sbjct  128  QCVLHMVCVGIEY  140



>emb|CDY57781.1| BnaCnng32440D [Brassica napus]
Length=391

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  74   GSRRMMREPSVLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  111

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P +PLR+W+VGY  QC LH+ CVC+EY
Sbjct  112  ILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGVQCGLHMACVCVEY  160



>ref|XP_010671755.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Beta vulgaris 
subsp. vulgaris]
Length=404

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            ESAA+QIEERQSDWAYS PIV+LDL WN  FV V+I ++++S DE   +PLRLW+VGY F
Sbjct  63   ESAAQQIEERQSDWAYSTPIVVLDLLWNTIFVFVAIVMMIVSGDEKTQVPLRLWLVGYGF  122

Query  413  QCVLHIVCVCLEYRRRNQL  469
            QC+LH+VCVC+E++RR ++
Sbjct  123  QCILHMVCVCVEFKRRREI  141



>gb|ACF87715.1| unknown [Zea mays]
 gb|ACF88243.1| unknown [Zea mays]
Length=324

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DWAYS+P+V LD  WNLAF+LVS  VLV+S  ESP MPLR WI GY  
Sbjct  10   EAAAEQLEERQADWAYSRPVVALDFLWNLAFILVSAVVLVLSHHESPSMPLRFWIAGYTA  69

Query  413  QCVLHIVCVCLEYR-RRNQLPSSP  481
            QCV+H+VCV +EYR R  QL  SP
Sbjct  70   QCVVHMVCVAIEYRLRYGQLGGSP  93



>ref|XP_007155554.1| hypothetical protein PHAVU_003G211600g [Phaseolus vulgaris]
 gb|ESW27548.1| hypothetical protein PHAVU_003G211600g [Phaseolus vulgaris]
Length=378

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+ + +VL++ R+E+P MPLRLWIVGY  
Sbjct  65   EAAAEQLEERQSDWAYSKPVVVLDILWNFAFVVAAATVLILGRNENPNMPLRLWIVGYAM  124

Query  413  QCVLHIVCVCLEY  451
            QCVLH+ CVC+EY
Sbjct  125  QCVLHVACVCVEY  137



>ref|XP_006287901.1| hypothetical protein CARUB_v10001135mg [Capsella rubella]
 gb|EOA20799.1| hypothetical protein CARUB_v10001135mg [Capsella rubella]
Length=395

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  73   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  110

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P +PLR+W+VGY  QC LH+ CVC+EY
Sbjct  111  ILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGIQCWLHMACVCVEY  159



>ref|XP_003570086.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brachypodium 
distachyon]
Length=374

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DWAYS+P+V LDL WNLAF+LV+  VLV+S DESP +PLR+WI GY  
Sbjct  60   ETAAEQLEERQADWAYSRPVVALDLLWNLAFILVAAVVLVLSSDESPSVPLRVWIAGYAV  119

Query  413  QCVLHIVCVCLEYRRRNQLPSSP  481
            QCVLH+VCV +EYR R+     P
Sbjct  120  QCVLHMVCVAIEYRVRHGQRGGP  142



>ref|XP_009124794.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=387

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 71/109 (65%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  +                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  70   GSRRMMREPSVMVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  107

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P +PLR+W+VGY  QC LH+ CVC+EY
Sbjct  108  ILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGVQCGLHMACVCVEY  156



>ref|XP_001754436.1| predicted protein [Physcomitrella patens]
 gb|EDQ80886.1| predicted protein, partial [Physcomitrella patens]
Length=338

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 73/114 (64%), Gaps = 22/114 (19%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        ESAAEQ+E RQSDWAYSKP+V+LD
Sbjct  15   GSRRLMREPSMLVR----------------------ESAAEQLEVRQSDWAYSKPVVVLD  52

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEYRRRNQ  466
            L WNLAFV VS++VLV+S+ E+    LR+WI+GY  QCV+H++CVC EY RR Q
Sbjct  53   LIWNLAFVQVSLAVLVLSKKETNCNELRIWIIGYALQCVVHMLCVCCEYLRRQQ  106



>ref|XP_002887973.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64232.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=373

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD  WNLAFV V+ +VLV+S DE+P MPLR+W++GY  
Sbjct  55   EAAAEQLEERQSDWAYSKPVVVLDFVWNLAFVAVATAVLVLSSDENPNMPLRVWVIGYGL  114

Query  413  QCVLHIVCVCLEY  451
            QC++H+VCVC+EY
Sbjct  115  QCMMHMVCVCVEY  127



>ref|XP_002874711.1| hypothetical protein ARALYDRAFT_327304 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50970.1| hypothetical protein ARALYDRAFT_327304 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR +R P  L                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  75   GSRRMVREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  112

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P MPLR+W+VGY  QC LH+ CVC+EY
Sbjct  113  ILWNLAFVAIGVAVLILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEY  161



>emb|CDX86759.1| BnaA09g21490D [Brassica napus]
Length=411

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 71/109 (65%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  +                        E+AAEQ+EERQSDWAYSKP+V LD
Sbjct  70   GSRRMMREPSVMVR----------------------ETAAEQLEERQSDWAYSKPVVFLD  107

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WNLAFV + ++VL++SRDE P +PLR+W+VGY  QC LH+ CVC+EY
Sbjct  108  ILWNLAFVAIGVAVLILSRDERPNVPLRVWVVGYGVQCGLHMACVCVEY  156



>gb|ACF78887.1| unknown [Zea mays]
 gb|AFW63359.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=375

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DWAYS+P+V LD  WNLAF+LVS  VLV+S  ESP MPLR WI GY  
Sbjct  61   EAAAEQLEERQADWAYSRPVVALDFLWNLAFILVSAVVLVLSHHESPSMPLRFWIAGYTA  120

Query  413  QCVLHIVCVCLEYR-RRNQLPSSP  481
            QCV+H+VCV +EYR R  QL  SP
Sbjct  121  QCVVHMVCVAIEYRLRYGQLGGSP  144



>ref|XP_010430403.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Camelina sativa]
Length=383

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD  WNLAFV V+ +VLV+S DE P MPLR+WI+GY  
Sbjct  55   EAAAEQLEERQSDWAYSKPVVVLDFVWNLAFVAVASAVLVLSSDEKPNMPLRVWIIGYGL  114

Query  413  QCVLHIVCVCLEY  451
            QC++H+VCVC+EY
Sbjct  115  QCMMHMVCVCVEY  127



>ref|XP_003611137.1| E3 ubiquitin-protein ligase [Medicago truncatula]
 gb|AES94095.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
 gb|AFK41451.1| unknown [Medicago truncatula]
Length=387

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ + L +SR+E+P MPLRLWI GY  
Sbjct  66   EAAAEQLEERQSDWAYSKPVVILDIVWNFAFVIVAGTALFLSRNEAPEMPLRLWIAGYVL  125

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC EY
Sbjct  126  QCVLHMVCVCFEY  138



>emb|CDY66607.1| BnaA06g38090D [Brassica napus]
Length=399

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKPIV+LD+ WNLAFV V+ +VLVM+R+E PMMPLR+W++GY  
Sbjct  80   EAAAEQLEERQSDWAYSKPIVVLDIVWNLAFVSVAGAVLVMARNEHPMMPLRVWLLGYAL  139

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCV +EY
Sbjct  140  QCVLHMVCVLVEY  152



>ref|XP_009118058.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Brassica 
rapa]
Length=382

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+  VLVMSRDE+P+MPLR+W++GY  
Sbjct  68   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVAAGVLVMSRDENPIMPLRVWLLGYAL  127

Query  413  QCVLHIVCVCLEY  451
            QCV+H+VCV +EY
Sbjct  128  QCVVHMVCVGIEY  140



>ref|XP_009148567.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Brassica rapa]
Length=400

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKPIV+LD+ WNLAFV V+ +VLVM+R+E PMMPLR+W++GY  
Sbjct  82   EAAAEQLEERQSDWAYSKPIVVLDIVWNLAFVSVAGAVLVMARNEHPMMPLRVWLLGYAL  141

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCV +EY
Sbjct  142  QCVLHMVCVLVEY  154



>ref|XP_007158469.1| hypothetical protein PHAVU_002G155000g [Phaseolus vulgaris]
 gb|ESW30463.1| hypothetical protein PHAVU_002G155000g [Phaseolus vulgaris]
Length=390

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ +VLV+S  E+P MPLRLWI+GY  
Sbjct  69   EAAAEQLEERQSDWAYSKPVVVLDIVWNFAFVIVAGTVLVLSASEAPGMPLRLWILGYAL  128

Query  413  QCVLHIVCVCLEY  451
            QC+LH+VCVC+EY
Sbjct  129  QCILHMVCVCVEY  141



>ref|XP_010533709.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Tarenaya hassleriana]
Length=401

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EE QS+WAYSKP+V+LD+ WNLAFV V+ ++LV+SRDE P MPLR+WI+GY  
Sbjct  83   ETAAEQLEESQSNWAYSKPVVVLDIVWNLAFVAVAAAILVLSRDEKPNMPLRVWIIGYAL  142

Query  413  QCVLHIVCVCLEY  451
            QCVLH+ CVC+EY
Sbjct  143  QCVLHMACVCVEY  155



>ref|XP_009411463.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 86/149 (58%), Gaps = 42/149 (28%)
 Frame = +2

Query  77   GNDGVDTTPLLGDQ-----------------IF---GSRRFMRRPPSLrgaarflrrass  196
            GN  VD  PLLG Q                  F    SR+ MR P  +            
Sbjct  11   GNASVDAAPLLGTQNGGRRSGRRGGLLRAAWFFRRTSSRQMMREPSMMVR----------  60

Query  197  rrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPM  376
                        E+AAE +EERQ+DWAYSKP+V LD+ WNLAFV V++ VLV+SR+E+P+
Sbjct  61   ------------ETAAEHLEERQTDWAYSKPVVFLDILWNLAFVGVAVGVLVLSRNETPL  108

Query  377  MPLRLWIVGYDFQCVLHIVCVCLEYRRRN  463
            MPLR WIVGY  QCVLH+VCVC+EYRRR+
Sbjct  109  MPLRAWIVGYALQCVLHMVCVCIEYRRRH  137



>ref|XP_009118057.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Brassica 
rapa]
Length=383

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+  VLVMSRDE+P+MPLR+W++GY  
Sbjct  68   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVAAGVLVMSRDENPIMPLRVWLLGYAL  127

Query  413  QCVLHIVCVCLEY  451
            QCV+H+VCV +EY
Sbjct  128  QCVVHMVCVGIEY  140



>ref|XP_011033783.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Populus euphratica]
Length=395

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V+  VLV+SR E+P +PLRLWI+GY  
Sbjct  78   ETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAAGVLVLSRKENPGVPLRLWILGYGL  137

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  138  QCVLHMVCVCVEY  150



>ref|XP_002303571.2| hypothetical protein POPTR_0003s12350g [Populus trichocarpa]
 gb|EEE78550.2| hypothetical protein POPTR_0003s12350g [Populus trichocarpa]
Length=397

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V+  VLV+SR E+P +PLRLWI+GY  
Sbjct  79   ETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAAGVLVLSRKENPGVPLRLWILGYGL  138

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  139  QCVLHMVCVCVEY  151



>ref|XP_011033784.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Populus euphratica]
Length=395

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V+  VLV+SR E+P +PLRLWI+GY  
Sbjct  78   ETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAAGVLVLSRKENPGVPLRLWILGYGL  137

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  138  QCVLHMVCVCVEY  150



>ref|XP_011033785.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X3 [Populus euphratica]
Length=394

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V+  VLV+SR E+P +PLRLWI+GY  
Sbjct  78   ETAAEQLEERQSDWAYSKPVVILDIIWNFAFVAVAAGVLVLSRKENPGVPLRLWILGYGL  137

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  138  QCVLHMVCVCVEY  150



>ref|XP_002876598.1| hypothetical protein ARALYDRAFT_486593 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52857.1| hypothetical protein ARALYDRAFT_486593 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 72/97 (74%), Gaps = 3/97 (3%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E AAEQ+EERQS WAYSKPI++LD+ WN  FV+VSI++L  S +E P +PLRLWI+GY+F
Sbjct  65   EVAAEQLEERQSQWAYSKPIIVLDILWNFVFVIVSIAILGFSSEEDPDVPLRLWIIGYNF  124

Query  413  QCVLHIVCVCLEYRRR---NQLPSSPENLNSRRSSGN  514
            QC+LH+ CV  EY+RR   N  PS  ++ N    SG+
Sbjct  125  QCLLHVGCVIAEYKRRREANSPPSGEDSSNHESLSGS  161



>dbj|BAJ98696.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DWAYS+P+V LDL WNLAF+L +  VLV+S DESP +PLR+WI GY  
Sbjct  60   ETAAEQLEERQADWAYSRPVVALDLLWNLAFILTTAVVLVLSGDESPSVPLRIWIAGYAV  119

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H+VCV +EYR R+
Sbjct  120  QCVVHMVCVAIEYRVRH  136



>ref|XP_003538385.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Glycine max]
Length=387

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV+V+ +VLV+S  E+P MPLRLWIVGY  
Sbjct  65   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVVVAGTVLVLSASEAPGMPLRLWIVGYAM  124

Query  413  QCVLHIVCVCLEY  451
            QCVLH+V VC+EY
Sbjct  125  QCVLHMVFVCVEY  137



>ref|XP_006590532.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Glycine max]
Length=388

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV+V+ +VLV+S  E+P MPLRLWIVGY  
Sbjct  65   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVVVAGTVLVLSASEAPGMPLRLWIVGYAM  124

Query  413  QCVLHIVCVCLEY  451
            QCVLH+V VC+EY
Sbjct  125  QCVLHMVFVCVEY  137



>ref|XP_008389083.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Malus domestica]
Length=140

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = +2

Query  83   DGVDTTPLLG----DQIFGSRRFMRR--PPSLrgaarflrrassrrmmrepsmrvrESAA  244
            + VDT PL+G    D++F +RR MR   PP         R +  R  +REPS+RVRE+A 
Sbjct  2    NSVDTHPLIGYSFGDELFQNRRLMRHGPPPLRGAMRILSRVSGRRMRLREPSVRVRENAV  61

Query  245  EQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVL  424
            E++EERQ+ WAYSKP ++LDL WNL FV+V  +VL +S +E P++P+R+W+VGY   CV+
Sbjct  62   EELEERQNFWAYSKPAIILDLLWNLVFVIVGFTVLGLSVEEKPLVPIRVWVVGYILLCVV  121

Query  425  HIVCVCLEYRRRNQ  466
            H+ CV  +YRRR +
Sbjct  122  HVGCVVAQYRRRRE  135



>ref|XP_010092737.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXB52082.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=393

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 96/144 (67%), Gaps = 6/144 (4%)
 Frame = +2

Query  89   VDTTPLLG----DQIFGSRRFMRR--PPSLrgaarflrrassrrmmrepsmrvrESAAEQ  250
            +D +PLLG    D +  SRR +RR  PP  R A    R +  R M+RE S++VRESAAE+
Sbjct  1    MDESPLLGNSMADHLIRSRRLVRRTTPPLRRAARMLRRASGRRMMLRESSVQVRESAAEE  60

Query  251  IEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHI  430
            +EERQS WAYSKP+++LD+ WNLAFV   + VL +S DE P +PLRLW+VGY  QC++H+
Sbjct  61   LEERQSGWAYSKPVIVLDVLWNLAFVGTGVVVLALSLDEKPSVPLRLWVVGYALQCLVHV  120

Query  431  VCVCLEYRRRNQLPSSPENLNSRR  502
             CV  EY RR +     ++  S R
Sbjct  121  GCVVAEYVRRREEVGGGDSAESDR  144



>ref|NP_001147541.1| protein binding protein [Zea mays]
 gb|ACG27868.1| protein binding protein [Zea mays]
Length=375

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DWAYS+P+V LD  WNLAF+LVS  VLV+S  ESP MPLR WI GY  
Sbjct  61   EAAAEQLEERQADWAYSRPVVALDFLWNLAFILVSAVVLVLSHHESPSMPLRFWIAGYTA  120

Query  413  QCVLHIVCVCLEY-RRRNQLPSSP  481
            QCV+H+VCV +EY  R  QL  SP
Sbjct  121  QCVVHMVCVAIEYCLRYGQLGGSP  144



>gb|KJB39631.1| hypothetical protein B456_007G022500 [Gossypium raimondii]
Length=381

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 69/108 (64%), Gaps = 22/108 (20%)
 Frame = +2

Query  128  SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDL  307
            SRR MR P  L                        E+AAEQ+EER SDWAYSKP+V+LD+
Sbjct  57   SRRLMREPSMLVR----------------------ETAAEQLEERHSDWAYSKPVVVLDI  94

Query  308  FWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
             WN AFV  ++ VLV+S +E P MPLRLWI+GY  QC+LH+VCVC+EY
Sbjct  95   IWNFAFVAAAVGVLVLSWNERPSMPLRLWIIGYALQCLLHMVCVCVEY  142



>ref|XP_002880197.1| hypothetical protein ARALYDRAFT_322232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56456.1| hypothetical protein ARALYDRAFT_322232 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WAYSKP+++LD+ WNLAFV V+I++L  S DE+P +PLR WI+GY+ 
Sbjct  65   ENAAEQIEERQSEWAYSKPVIVLDVLWNLAFVFVTIAILGFSSDENPHVPLRFWIIGYNL  124

Query  413  QCVLHIVCVCLEYRRRNQLPS  475
            QC+ H+ CV  EYRRR++  S
Sbjct  125  QCLFHVGCVIAEYRRRHRRQS  145



>ref|XP_009116780.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Brassica rapa]
Length=373

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E AAEQ+EERQS WAYSKPI+ LD+ WN AFV+VSI++L  S +E P +PLRLWIVGY  
Sbjct  62   EVAAEQLEERQSQWAYSKPIIALDILWNFAFVVVSIAILGFSPEEHPEVPLRLWIVGYSL  121

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC+ H+ CV  EYRRR +  ++P++     + G++SG
Sbjct  122  QCLFHVGCVIAEYRRRRR-QANPQSEEGSENHGSFSG  157



>emb|CDY16029.1| BnaC08g40940D [Brassica napus]
Length=380

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WNLAFV V+ +VLVMSR+E+P+MPLR+W++GY  
Sbjct  67   EAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVAATVLVMSRNENPIMPLRVWLLGYAL  126

Query  413  QCVLHIVCVCLE  448
            QCVLH+VCV +E
Sbjct  127  QCVLHMVCVGIE  138



>ref|XP_006402511.1| hypothetical protein EUTSA_v10006041mg [Eutrema salsugineum]
 gb|ESQ43964.1| hypothetical protein EUTSA_v10006041mg [Eutrema salsugineum]
Length=374

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E AAEQ+EERQS+WAYSKPI+ LD+ WN  FV+VSI +L  S +E+P +PLRLW++GY+F
Sbjct  62   EVAAEQLEERQSEWAYSKPIIALDILWNFVFVIVSIGILGFSSEENPDVPLRLWVIGYNF  121

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC+ H+ CV  EY+RR +  S  E+ +S  + G+ SG
Sbjct  122  QCLFHVGCVIAEYKRRREANSRSED-DSSSNHGSLSG  157



>gb|EPS63490.1| hypothetical protein M569_11294, partial [Genlisea aurea]
Length=347

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+A E+IEERQSD AYSKPIV+LD+ WN+ F++V++SVLV+SR E+P MPLR+WIVGY  
Sbjct  28   EAATEEIEERQSDLAYSKPIVILDIVWNVLFLIVAVSVLVVSRFETPSMPLRMWIVGYAL  87

Query  413  QCVLHIVCVCLEYRRR  460
            QC+LH+ CVC+EY++R
Sbjct  88   QCLLHMFCVCVEYKKR  103



>ref|XP_010053324.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Eucalyptus 
grandis]
 gb|KCW77595.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=406

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V++ VL++SR E+P MPLR+WIVGY  
Sbjct  88   ETAAEQLEERQSDWAYSKPVVVLDVLWNFAFVAVAVGVLIVSRGENPTMPLRVWIVGYGL  147

Query  413  QCVLHIVCVCLEY  451
            QCVLH+ CV  EY
Sbjct  148  QCVLHVACVVDEY  160



>gb|KHG14407.1| hypothetical protein F383_04260 [Gossypium arboreum]
Length=381

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 69/108 (64%), Gaps = 22/108 (20%)
 Frame = +2

Query  128  SRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDL  307
            SRR MR P  L                        E+AAEQ+EER SDWAYSKP+V+LD+
Sbjct  57   SRRLMREPSMLVR----------------------ETAAEQLEERHSDWAYSKPVVVLDI  94

Query  308  FWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
             WN AFV  ++ VL++S +E P MPLRLWI+GY  QC+LH+VCVC+EY
Sbjct  95   IWNFAFVAAAVGVLILSWNERPSMPLRLWIIGYALQCLLHMVCVCVEY  142



>emb|CDY52328.1| BnaA09g38770D [Brassica napus]
Length=373

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E AAEQ+EERQS WAYSKPI+ LD+ WN AFV+VSI++L  S +E P +PLRLWIVGY  
Sbjct  62   EVAAEQLEERQSQWAYSKPIIALDILWNFAFVVVSIAILGFSPEEHPEVPLRLWIVGYSL  121

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC+ H+ CV  EYRRR +   +P+      + G++SG
Sbjct  122  QCLFHVGCVIAEYRRRRR-QGNPQGEEGSENHGSFSG  157



>gb|KCW77597.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=329

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V++ VL++SR E+P MPLR+WIVGY  
Sbjct  11   ETAAEQLEERQSDWAYSKPVVVLDVLWNFAFVAVAVGVLIVSRGENPTMPLRVWIVGYGL  70

Query  413  QCVLHIVCVCLEY  451
            QCVLH+ CV  EY
Sbjct  71   QCVLHVACVVDEY  83



>gb|KCW77596.1| hypothetical protein EUGRSUZ_D01910 [Eucalyptus grandis]
Length=328

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV V++ VL++SR E+P MPLR+WIVGY  
Sbjct  11   ETAAEQLEERQSDWAYSKPVVVLDVLWNFAFVAVAVGVLIVSRGENPTMPLRVWIVGYGL  70

Query  413  QCVLHIVCVCLEY  451
            QCVLH+ CV  EY
Sbjct  71   QCVLHVACVVDEY  83



>ref|XP_011463818.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=387

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 110/135 (81%), Gaps = 7/135 (5%)
 Frame = +2

Query  77   GNDGVDTTPLLG------DQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
             +D VDT+PLL       D+    RR++R+  SLR AARFLR+ASSRR+MREPSM VRE+
Sbjct  10   ADDIVDTSPLLASSGGSSDESNSGRRYLRQQ-SLRQAARFLRQASSRRLMREPSMLVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ +VLV+SR ESP MPLRLWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRSESPEMPLRLWIVGYAMQC  128

Query  419  VLHIVCVCLEYRRRN  463
            +LH+VCVC+E++RR 
Sbjct  129  LLHMVCVCVEFKRRQ  143



>ref|XP_011463819.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 110/135 (81%), Gaps = 7/135 (5%)
 Frame = +2

Query  77   GNDGVDTTPLLG------DQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
             +D VDT+PLL       D+    RR++R+  SLR AARFLR+ASSRR+MREPSM VRE+
Sbjct  10   ADDIVDTSPLLASSGGSSDESNSGRRYLRQQ-SLRQAARFLRQASSRRLMREPSMLVRET  68

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ +VLV+SR ESP MPLRLWIVGY  QC
Sbjct  69   AAEQLEERQSDWAYSKPVVVLDIIWNFAFVVVAATVLVLSRSESPEMPLRLWIVGYAMQC  128

Query  419  VLHIVCVCLEYRRRN  463
            +LH+VCVC+E++RR 
Sbjct  129  LLHMVCVCVEFKRRQ  143



>emb|CDX71761.1| BnaC08g31130D [Brassica napus]
Length=370

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E AAEQ+EERQS WAYSKPI+ LD+ WN AFV+VSI++L  S +E P +PLRLWI GY  
Sbjct  59   EVAAEQLEERQSQWAYSKPIIALDILWNFAFVIVSIAILGFSPEEHPEVPLRLWIAGYSL  118

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC+ H+ CV  EYRRR +  S+P       + G++SG
Sbjct  119  QCLFHVGCVIAEYRRRRR-QSNPTTEEGSENHGSFSG  154



>gb|KJB52053.1| hypothetical protein B456_008G244300 [Gossypium raimondii]
Length=236

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 107/139 (77%), Gaps = 7/139 (5%)
 Frame = +2

Query  77   GNDGVDTTPLLGDQIFGSR------RFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
             +D +D TPLL      SR      R +RR  SLR AARFLRRASSRRMMREPS+ VRE+
Sbjct  12   SDDIIDVTPLLSSTSNASRDESNPRRSVRRQ-SLREAARFLRRASSRRMMREPSVLVRET  70

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+VS+ VL+ S +E P  PLRLWI+GY FQC
Sbjct  71   AAEQLEERQSDWAYSKPVVVLDIIWNFAFVVVSVGVLLSSWEERPDTPLRLWIIGYAFQC  130

Query  419  VLHIVCVCLEYRRRNQLPS  475
            +LH+VCVC+EYRRR +  S
Sbjct  131  LLHMVCVCVEYRRRRRQQS  149



>ref|XP_009142362.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brassica 
rapa]
 ref|XP_009142363.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Brassica 
rapa]
Length=367

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WAYSKP+++LD+ WNLAFV V++ VL  S +E+P +PLR WIV Y+ 
Sbjct  60   ETAAEQIEERQSEWAYSKPVIVLDVVWNLAFVFVTVGVLWFSSEENPRVPLRFWIVVYNL  119

Query  413  QCVLHIVCVCLEYRRRN  463
            QC+LH+VCV  EYRRR+
Sbjct  120  QCLLHVVCVISEYRRRH  136



>gb|ADK63393.1| C3HC4 type zinc finger protein [Brassica rapa]
Length=313

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WAYSKP+++LD+ WNLAFV V++ V   S +E P  PLR WIVGY+ 
Sbjct  12   ETAAEQIEERQSEWAYSKPVIVLDVLWNLAFVFVTVGVSWFSSEEDPRAPLRFWIVGYNL  71

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC++HI CV  EYRRR         L+S + S +  G
Sbjct  72   QCLIHIACVIAEYRRRESNRDLDSGLSSVQGSSDGYG  108



>emb|CDY37062.1| BnaA04g26400D [Brassica napus]
Length=367

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WAYSKP+++LD+ WNLAFVLV++ VL  S +E+P +PLR WI  Y+ 
Sbjct  60   ETAAEQIEERQSEWAYSKPVIVLDVVWNLAFVLVTVGVLWFSSEENPRVPLRFWIAVYNL  119

Query  413  QCVLHIVCVCLEYRRRN  463
            QC+LH+VCV  EYRRR+
Sbjct  120  QCLLHVVCVISEYRRRH  136



>ref|XP_009143169.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=364

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WAYSKP+++LD+ WNLAFV V++ V   S +E P  PLR WIVGY+ 
Sbjct  63   ETAAEQIEERQSEWAYSKPVIVLDVLWNLAFVFVTVGVSWFSSEEDPRAPLRFWIVGYNL  122

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC++HI CV  EYRRR         L+S + S +  G
Sbjct  123  QCLIHIACVIAEYRRRESNRDLDSGLSSVQGSSDGYG  159



>emb|CDX74763.1| BnaA05g05090D [Brassica napus]
Length=363

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WAYSKP+++LD+ WNLAFV V++ V   S +E P  PLR WIVGY+ 
Sbjct  62   ETAAEQIEERQSEWAYSKPVIVLDVLWNLAFVFVTVGVSWFSSEEDPRAPLRFWIVGYNL  121

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC++HI CV  EYRRR         L+S + S +  G
Sbjct  122  QCLIHIACVIAEYRRRESNRDLDSGLSSVQGSSDGYG  158



>ref|XP_010101532.1| hypothetical protein L484_008863 [Morus notabilis]
 gb|EXB88544.1| hypothetical protein L484_008863 [Morus notabilis]
Length=268

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+Q+EERQSDWAYSKP++ LD+ WN AFV ++I+VL +S  E P +PLR+WI+GY F
Sbjct  11   EAAAQQLEERQSDWAYSKPVIALDMLWNAAFVGIAIAVLALSAAEDPSVPLRVWIIGYAF  70

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSR  499
            QC +H+ CV  EYRRR       E   SR
Sbjct  71   QCAVHMACVVAEYRRRLHEARLAEMEASR  99



>gb|KDP25486.1| hypothetical protein JCGZ_20642 [Jatropha curcas]
Length=389

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 5/129 (4%)
 Frame = +2

Query  80   NDGVDTTPLL--GDQIFGSRRFMRRP---PSLrgaarflrrassrrmmrepsmrvrESAA  244
            +D VDTTPLL  G  +  +    RRP   P+LR AARF+RRASSRRMMREPSM VRE+AA
Sbjct  20   DDIVDTTPLLSSGSNVESNSNNGRRPVRRPTLRDAARFVRRASSRRMMREPSMLVRETAA  79

Query  245  EQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVL  424
            EQ+EERQSDWAYSKP+V+LD+ WN AFV V+++VL++SR+E P MPLRLWI+GY FQCVL
Sbjct  80   EQLEERQSDWAYSKPVVILDIIWNFAFVAVAVAVLILSREEHPSMPLRLWIIGYGFQCVL  139

Query  425  HIVCVCLEY  451
            H+VCV +EY
Sbjct  140  HMVCVFVEY  148



>gb|ADK63418.1| C3HC4 type zinc finger protein [Brassica rapa]
Length=363

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WAYSKP+++LD+ WNLAFV V++ V   S +E P  PLR WIVGY+ 
Sbjct  62   ETAAEQIEERQSEWAYSKPVIVLDVLWNLAFVFVTVGVSWFSSEEDPRAPLRFWIVGYNL  121

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC++HI CV  EYRRR         L+S + S +  G
Sbjct  122  QCLIHIACVIAEYRRRESNRDLDSGLSSVQGSSDGYG  158



>gb|ACN40787.1| unknown [Picea sitchensis]
Length=397

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 121/169 (72%), Gaps = 15/169 (9%)
 Frame = +2

Query  41   DTTNVNVNSGGEGNDGVDTTPLLGDQIF-------GSRRFMRRPPSLrgaarflrrassr  199
            D T V   S    +  VDTTPLLG+          G+R   RR  S++GAARFLRRASSR
Sbjct  2    DRTRVVRQSDSSPDVAVDTTPLLGNGTGSPNASDDGARSLSRRA-SIQGAARFLRRASSR  60

Query  200  rmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMM  379
            R+MREPSM VRE+AAEQ+EERQSDWAYS+P+V+LD+ WNLAFV+V+  VLV+SR E+P M
Sbjct  61   RIMREPSMLVRETAAEQLEERQSDWAYSRPVVVLDIIWNLAFVVVATVVLVLSRHENPNM  120

Query  380  PLRLWIVGYDFQCVLHIVCVCLEYRRRNQLPSSPENLNSRRS-SGNWSG  523
            P+R+W+VGY  QC+LH++CVC EYRRR+       N   +RS SG  SG
Sbjct  121  PVRVWVVGYALQCLLHMICVCFEYRRRHS------NAQQQRSNSGGQSG  163



>ref|XP_009788378.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=171

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E + +Q+ +RQS+WAYSKP+V++DL WN A+++V+  VL  SR+E P MPLR+WIVGY  
Sbjct  51   EPSDQQVNDRQSNWAYSKPVVIIDLLWNFAYIIVACFVLFFSREEDPEMPLRIWIVGYSL  110

Query  413  QCVLHIVCVCLEYRRR  460
             CVLHIVCV LEYRRR
Sbjct  111  LCVLHIVCVFLEYRRR  126



>emb|CDY60265.1| BnaC05g49290D [Brassica napus]
Length=359

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKPIV+LD+ WNLAFV V+ ++LVM+R+E P+MPLR+W++GY  
Sbjct  78   EAAAEQLEERQSDWAYSKPIVVLDIVWNLAFVSVAGAILVMARNEHPIMPLRVWLLGYAL  137

Query  413  QCVLHIVCV  439
            QCVLH+VCV
Sbjct  138  QCVLHMVCV  146



>ref|NP_001130198.1| uncharacterized LOC100191292 [Zea mays]
 gb|ACF78345.1| unknown [Zea mays]
 gb|ACF85407.1| unknown [Zea mays]
 gb|AFW59269.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=380

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYS+P+V LDL WNLAF+ V+  VLV+SRDE   MPLR W+ GY  
Sbjct  65   EAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRDEDSPMPLRTWVAGYAL  124

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H+VCV +EYR R+
Sbjct  125  QCVIHMVCVAIEYRMRH  141



>gb|AFW59158.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=291

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYS+P+V LDL WNLAF+ V+  VLV+SRDE   MPLR W+ GY  
Sbjct  65   EAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRDEDSPMPLRTWVAGYAL  124

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H++CV +EYR R+
Sbjct  125  QCVVHMICVAIEYRMRH  141



>emb|CAE02249.2| OSJNBb0032E06.5 [Oryza sativa Japonica Group]
 emb|CAH67032.1| OSIGBa0139P06.5 [Oryza sativa Indica Group]
Length=324

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYS+P+V LDL WNLAF+ V+  VLV+SR E   MPLR W+ GY  
Sbjct  10   EAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRGEDSPMPLRTWVAGYAL  69

Query  413  QCVLHIVCVCLEYR-RRNQLPSSPENLNSRR  502
            QCV+H+VCV +EYR RR Q   +P + +  R
Sbjct  70   QCVVHMVCVAIEYRMRRGQRDRAPASADEER  100



>ref|NP_567110.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 gb|AAL24312.1| putative protein [Arabidopsis thaliana]
 gb|AAL47351.1| putative protein [Arabidopsis thaliana]
 gb|AEE80168.1| RING/U-box superfamily protein [Arabidopsis thaliana]
Length=379

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E AAEQ+EERQS WAYSKPI++LD+ WN  FV+VSI++L  S DE P +PLRLWI+GY+ 
Sbjct  65   EVAAEQLEERQSQWAYSKPIIVLDILWNFLFVIVSIAILGFSSDEDPDVPLRLWIIGYNV  124

Query  413  QCVLHIVCVCLEYRRR---NQLPSSPENLNSRRS  505
            QC+ H+ CV  EY+RR   N  P S E+ ++  S
Sbjct  125  QCLFHVGCVIAEYKRRRVANSPPPSGEDSSNHES  158



>gb|KJB52054.1| hypothetical protein B456_008G244300 [Gossypium raimondii]
Length=297

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 107/139 (77%), Gaps = 7/139 (5%)
 Frame = +2

Query  77   GNDGVDTTPLLGDQIFGSR------RFMRRPPSLrgaarflrrassrrmmrepsmrvrES  238
             +D +D TPLL      SR      R +RR  SLR AARFLRRASSRRMMREPS+ VRE+
Sbjct  12   SDDIIDVTPLLSSTSNASRDESNPRRSVRRQ-SLREAARFLRRASSRRMMREPSVLVRET  70

Query  239  AAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQC  418
            AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+VS+ VL+ S +E P  PLRLWI+GY FQC
Sbjct  71   AAEQLEERQSDWAYSKPVVVLDIIWNFAFVVVSVGVLLSSWEERPDTPLRLWIIGYAFQC  130

Query  419  VLHIVCVCLEYRRRNQLPS  475
            +LH+VCVC+EYRRR +  S
Sbjct  131  LLHMVCVCVEYRRRRRQQS  149



>ref|XP_009615319.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Nicotiana tomentosiformis]
Length=357

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E + +QI +RQS+WAYSKP+V++DL WN A+++V+  VL  SR+E P MPLR+WIVGY  
Sbjct  51   EPSDQQINDRQSNWAYSKPVVIIDLLWNFAYIIVACFVLFFSREEDPEMPLRIWIVGYSL  110

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENL-----NSRRSSG  511
             C+LHIVCV LEYRRR    S+ E        SR SSG
Sbjct  111  LCLLHIVCVFLEYRRRGYGQSAEEAFGSSAEGSRGSSG  148



>emb|CAB71048.1| putative protein [Arabidopsis thaliana]
Length=362

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E AAEQ+EERQS WAYSKPI++LD+ WN  FV+VSI++L  S DE P +PLRLWI+GY+ 
Sbjct  48   EVAAEQLEERQSQWAYSKPIIVLDILWNFLFVIVSIAILGFSSDEDPDVPLRLWIIGYNV  107

Query  413  QCVLHIVCVCLEYRRR---NQLPSSPENLNSRRS  505
            QC+ H+ CV  EY+RR   N  P S E+ ++  S
Sbjct  108  QCLFHVGCVIAEYKRRRVANSPPPSGEDSSNHES  141



>ref|XP_004976528.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Setaria 
italica]
Length=379

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYS+P+V LDL WNLAF+ V+  VLV+SRDE   MPLR W+ GY  
Sbjct  65   EAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRDEDSPMPLRTWVAGYAL  124

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H+VCV +EYR R+
Sbjct  125  QCVVHMVCVAIEYRMRH  141



>ref|XP_009615318.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Nicotiana tomentosiformis]
Length=360

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E + +QI +RQS+WAYSKP+V++DL WN A+++V+  VL  SR+E P MPLR+WIVGY  
Sbjct  51   EPSDQQINDRQSNWAYSKPVVIIDLLWNFAYIIVACFVLFFSREEDPEMPLRIWIVGYSL  110

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENL-----NSRRSSG  511
             C+LHIVCV LEYRRR    S+ E        SR SSG
Sbjct  111  LCLLHIVCVFLEYRRRGYGQSAEEAFGSSAEGSRGSSG  148



>ref|XP_003525718.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=380

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV  + +V ++SR+E+P MPLRLWIVGY  
Sbjct  66   EAAAEQLEERQSDWAYSKPVVVLDILWNFAFVAAAATVFILSRNENPNMPLRLWIVGYAL  125

Query  413  QCVLHIVCVCLEYRRR  460
            QCVLH+ CVC+EY+RR
Sbjct  126  QCVLHVACVCVEYQRR  141



>ref|NP_001150553.1| LOC100284185 [Zea mays]
 gb|ACG39542.1| protein binding protein [Zea mays]
Length=375

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYS+P+V LDL WNLAF+ V+  VLV+SRDE   MPLR W+ GY  
Sbjct  65   EAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRDEDSPMPLRTWVAGYAL  124

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H++CV +EYR R+
Sbjct  125  QCVVHMICVAIEYRMRH  141



>ref|XP_008662009.1| PREDICTED: LOC100284185 isoform X1 [Zea mays]
 gb|ACL52451.1| unknown [Zea mays]
 gb|AFW59157.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=382

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYS+P+V LDL WNLAF+ V+  VLV+SRDE   MPLR W+ GY  
Sbjct  65   EAAAEHLEERQADWAYSRPVVALDLLWNLAFITVAAVVLVLSRDEDSPMPLRTWVAGYAL  124

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H++CV +EYR R+
Sbjct  125  QCVVHMICVAIEYRMRH  141



>gb|KJB52052.1| hypothetical protein B456_008G244300 [Gossypium raimondii]
Length=381

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 107/138 (78%), Gaps = 7/138 (5%)
 Frame = +2

Query  80   NDGVDTTPLLGDQIFGSR------RFMRRPPSLrgaarflrrassrrmmrepsmrvrESA  241
            +D +D TPLL      SR      R +RR  SLR AARFLRRASSRRMMREPS+ VRE+A
Sbjct  13   DDIIDVTPLLSSTSNASRDESNPRRSVRRQ-SLREAARFLRRASSRRMMREPSVLVRETA  71

Query  242  AEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCV  421
            AEQ+EERQSDWAYSKP+V+LD+ WN AFV+VS+ VL+ S +E P  PLRLWI+GY FQC+
Sbjct  72   AEQLEERQSDWAYSKPVVVLDIIWNFAFVVVSVGVLLSSWEERPDTPLRLWIIGYAFQCL  131

Query  422  LHIVCVCLEYRRRNQLPS  475
            LH+VCVC+EYRRR +  S
Sbjct  132  LHMVCVCVEYRRRRRQQS  149



>gb|KDP28678.1| hypothetical protein JCGZ_14449 [Jatropha curcas]
Length=329

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 13/99 (13%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DW+YSKPI++LD+ WN AFV +++ V+V+S  E   +PLRLWI+GY  
Sbjct  12   ENAAEQLEERQTDWSYSKPIIVLDVLWNFAFVGIAVVVMVLSVKEETEVPLRLWIIGYAL  71

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRR----SSGNW  517
            QCV HI CV  EYRRR         LN R     +SG+W
Sbjct  72   QCVFHIACVIFEYRRR---------LNERNVGLGASGSW  101



>emb|CDY70309.1| BnaCnng67740D [Brassica napus]
Length=366

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WA+SKP+++LD+ WNLAFV V++ V   S  E P +PLR WIVGY+ 
Sbjct  61   ETAAEQIEERQSEWAHSKPVIVLDVLWNLAFVFVTVGVAWFSSGEDPGVPLRFWIVGYNL  120

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSS  508
            QC++H+ CV  EY RR     S  +L+S  SS
Sbjct  121  QCLIHVACVVAEYCRRRGYDQSNRDLDSGLSS  152



>ref|XP_002511805.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
 gb|EEF50474.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
Length=375

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DWAYSKPI+ LD+ WNLAFV + + VL +S  E P +PLR+WI+GY  
Sbjct  64   ENAAEQLEERQTDWAYSKPIIFLDVLWNLAFVGIGVVVLGLSVKEEPQLPLRVWIIGYSL  123

Query  413  QCVLHIVCVCLEYRRR  460
            QC+ HI CV  EY+RR
Sbjct  124  QCLFHIGCVIFEYKRR  139



>ref|XP_008354302.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Malus 
domestica]
Length=365

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = +2

Query  83   DGVDTTPLLG----DQIFGSRRFMRR--PPSLrgaarflrrassrrmmrepsmrvrESAA  244
            + VDT PL+G    D++F +RR MR   PP         R +  R  +REPS+RVRE+A 
Sbjct  2    NSVDTHPLIGYSFGDELFQNRRLMRHGPPPLRGAMRILSRVSGRRMRLREPSVRVRENAV  61

Query  245  EQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVL  424
            E++EERQ+ WAYSKP ++LDL WNL FV+V  +VL +S +E P++P+R+W+VGY   CV+
Sbjct  62   EELEERQNFWAYSKPAIILDLLWNLVFVIVGFTVLGLSVEEKPLVPIRVWVVGYILLCVV  121

Query  425  HIVCVCLEYRRRNQ  466
            H+ CV  +YRRR +
Sbjct  122  HVGCVVAQYRRRRE  135



>ref|XP_006279088.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
 gb|EOA11986.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
Length=319

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E AAEQ+EERQS WAYSKPI++LD+ WN  FV+VS+++L  S  E P +PLR+WI+GY+ 
Sbjct  48   EVAAEQLEERQSQWAYSKPIIVLDILWNFVFVIVSLAILGFSSGEDPDVPLRVWIIGYNL  107

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC+ H+ CV  EYRRR +  S     +   + G+ SG
Sbjct  108  QCLFHVGCVIAEYRRRLEANSPSSGGDDSSNHGSLSG  144



>dbj|BAK00653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYS+P+V LDL WN++F+ V+  VLV+SR+E+  MPLR W+ GY  
Sbjct  63   EAAAEHLEERQADWAYSRPVVALDLLWNISFITVAAVVLVLSRNENSPMPLRTWVAGYAL  122

Query  413  QCVLHIVCVCLEYR-RRNQLPSSP  481
            QC++H+VCV +EYR RR+Q    P
Sbjct  123  QCIVHMVCVAVEYRMRRSQRGGGP  146



>ref|XP_006294289.1| hypothetical protein CARUB_v10023298mg, partial [Capsella rubella]
 gb|EOA27187.1| hypothetical protein CARUB_v10023298mg, partial [Capsella rubella]
Length=417

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WAYSKP+++LD+ WNL+FVLV+I++L  S DE+P +PLR WI+GY+ 
Sbjct  102  ENAAEQIEERQSEWAYSKPVIVLDVLWNLSFVLVTIAILGFSSDENPDVPLRFWILGYNL  161

Query  413  QCVLHIVCVCLEYRRR  460
            QC+ H+ CV  E RRR
Sbjct  162  QCLFHVGCVIAECRRR  177



>dbj|BAK01729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYS+P+V LDL WN++F+ V+  VLV+SR+E+  MPLR W+ GY  
Sbjct  63   EAAAEHLEERQADWAYSRPVVALDLLWNISFITVAAVVLVLSRNENSPMPLRTWVAGYAL  122

Query  413  QCVLHIVCVCLEYR-RRNQLPSSP  481
            QC++H+VCV +EYR RR+Q    P
Sbjct  123  QCIVHMVCVAVEYRMRRSQRGGGP  146



>ref|XP_009393489.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=384

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 98/132 (74%), Gaps = 2/132 (2%)
 Frame = +2

Query  71   GEGNDGVDTTPLL--GDQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAA  244
            G G   +D +PL+  GD     R    R PSLRGAARFLRRA SRR MREPS+ VRE+AA
Sbjct  13   GGGGASIDPSPLVAGGDDRVRLRGGGPRRPSLRGAARFLRRAGSRRGMREPSLLVREAAA  72

Query  245  EQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVL  424
            EQ++ERQS WA S+P+V LD  WNLAFV  +  VLV+SR+E+P MPLRLWI GY  QCVL
Sbjct  73   EQLQERQSGWAQSRPVVFLDALWNLAFVAAAGGVLVLSREETPSMPLRLWIGGYALQCVL  132

Query  425  HIVCVCLEYRRR  460
            HI+CV +++++R
Sbjct  133  HIICVSVQFQQR  144



>dbj|BAK02342.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYS+P+V LDL WN++F+ V+  VLV+SR+E+  MPLR W+ GY  
Sbjct  63   EAAAEHLEERQADWAYSRPVVALDLLWNISFITVAAVVLVLSRNENSPMPLRTWVAGYAL  122

Query  413  QCVLHIVCVCLEYR-RRNQLPSSPENLNSRR  502
            QC++H+VCV +EYR RR+Q    P   +  R
Sbjct  123  QCIVHMVCVAVEYRMRRSQRGGGPVPADEER  153



>ref|XP_010940871.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Elaeis guineensis]
Length=383

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+P+V LD+ WNLAFV  + +VL++S +E P +PLRLWI GY  
Sbjct  66   EAAAEQLEERQSDWAYSRPVVFLDILWNLAFVAAAAAVLILSWEERPSVPLRLWIGGYAL  125

Query  413  QCVLHIVCVCLEYRRRNQL  469
            QCVLH+VCVC+EY+RR+ L
Sbjct  126  QCVLHMVCVCIEYQRRHPL  144



>gb|ABR17177.1| unknown [Picea sitchensis]
Length=373

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+Q+EERQSDWAYSKP+V+LDL WNL+FV+VS+ +L  + +E P  PLR+WI GY  
Sbjct  55   ENAAQQLEERQSDWAYSKPVVMLDLLWNLSFVVVSVVILTSTLEERPTTPLRVWIAGYAL  114

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC+LH++ V  EY RRN+
Sbjct  115  QCLLHMIYVAYEYTRRNR  132



>ref|XP_010940872.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Elaeis guineensis]
Length=382

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+P+V LD+ WNLAFV  + +VL++S +E P +PLRLWI GY  
Sbjct  66   EAAAEQLEERQSDWAYSRPVVFLDILWNLAFVAAAAAVLILSWEERPSVPLRLWIGGYAL  125

Query  413  QCVLHIVCVCLEYRRRNQL  469
            QCVLH+VCVC+EY+RR+ L
Sbjct  126  QCVLHMVCVCIEYQRRHPL  144



>ref|XP_010469042.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=360

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 70/97 (72%), Gaps = 5/97 (5%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVL-VMSRDESPMMPLRLWIVGYD  409
            E AAEQ+EERQS WAYSKPI++LD+ WN  FV+VS+++L   S+ E P++PLR+WIVGY+
Sbjct  45   EVAAEQLEERQSQWAYSKPIIVLDILWNFVFVVVSVAILGFTSQQEDPLVPLRVWIVGYN  104

Query  410  FQCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWS  520
             QC+ H+ CV  EY+RR +      N+N   SS + S
Sbjct  105  LQCLFHVACVIAEYKRRRR----EANINDDDSSNHGS  137



>ref|XP_006279087.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
 gb|EOA11985.1| hypothetical protein CARUB_v10012711mg [Capsella rubella]
Length=362

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E AAEQ+EERQS WAYSKPI++LD+ WN  FV+VS+++L  S  E P +PLR+WI+GY+ 
Sbjct  48   EVAAEQLEERQSQWAYSKPIIVLDILWNFVFVIVSLAILGFSSGEDPDVPLRVWIIGYNL  107

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWSG  523
            QC+ H+ CV  EYRRR +  S     +   + G+ SG
Sbjct  108  QCLFHVGCVIAEYRRRLEANSPSSGGDDSSNHGSLSG  144



>ref|XP_008225188.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Prunus 
mume]
Length=380

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+PI++LDL WN   + ++I VL +SR+ESP++PLR WIVGY F
Sbjct  67   EAAAEQLEERQSDWAYSRPIIVLDLLWNAGLLGIAIGVLWLSREESPLVPLRTWIVGYAF  126

Query  413  QCVLHIVCVCLEYRRRNQL  469
            QC++H+ CV +E  RR ++
Sbjct  127  QCLVHMACVGVECTRRRRV  145



>ref|XP_009765931.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
3-II [Nicotiana sylvestris]
Length=938

 Score =   112 bits (281),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA +++ER++DW YSKP+V LD+ WNL FV+VS+ +L  + DESP +P+R+W+ GY  
Sbjct  648  ETAARELDERRADWGYSKPVVALDMMWNLGFVIVSVVILSCTFDESPNVPIRIWVCGYAL  707

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H+V V LEYRRRN
Sbjct  708  QCVVHVVLVWLEYRRRN  724



>gb|ABR18161.1| unknown [Picea sitchensis]
Length=373

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+Q+EERQSDWAYSKP+V+LDL WNL+FV+VS+ +L  + +E P  P+R+WI GY  
Sbjct  55   ENAAQQLEERQSDWAYSKPVVMLDLLWNLSFVVVSVVILTSTLEERPTTPMRVWIAGYAL  114

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC+LH++ V  EY RRN+
Sbjct  115  QCLLHMIYVAYEYTRRNR  132



>ref|XP_007211433.1| hypothetical protein PRUPE_ppa007140mg [Prunus persica]
 gb|EMJ12632.1| hypothetical protein PRUPE_ppa007140mg [Prunus persica]
Length=380

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQ+DWAYS+PI++LDL WN   + ++I VL +SR+ESP++PLR WIVGY F
Sbjct  67   EAAAEQLEERQTDWAYSRPIIVLDLLWNAGLLGIAIGVLWLSREESPLVPLRTWIVGYAF  126

Query  413  QCVLHIVCVCLEYRRRNQL  469
            QC++H+ CV +E  RR ++
Sbjct  127  QCLVHMACVGVECTRRRRV  145



>gb|KDP38117.1| hypothetical protein JCGZ_04760 [Jatropha curcas]
Length=365

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA ++EER++DW YSKP+V LD+ WN AFV+VSI++L+++ DE P  P+R+WI GY  
Sbjct  58   ETAARELEERRADWGYSKPVVALDMLWNTAFVVVSITMLILTADEKPNTPVRIWICGYAL  117

Query  413  QCVLHIVCVCLEYRRRN  463
            QC++H+V V LEYRRRN
Sbjct  118  QCLVHVVLVWLEYRRRN  134



>ref|XP_010413448.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Camelina 
sativa]
Length=359

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 5/97 (5%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVL-VMSRDESPMMPLRLWIVGYD  409
            E AAEQ+EERQS WAYSKPI++LD+ WN  FV+VS+++L   S+ E P++PLR+WI+GY+
Sbjct  45   EVAAEQLEERQSQWAYSKPIIVLDILWNFVFVVVSVAILGFTSQQEDPIVPLRVWILGYN  104

Query  410  FQCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWS  520
             QC+ H+ CV  EY+RR +      N+N   SS + S
Sbjct  105  LQCLFHVACVIAEYKRRRR----EANINGDDSSNHGS  137



>gb|KFK30652.1| hypothetical protein AALP_AA6G009800 [Arabis alpina]
Length=343

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+++E+R++DW YSKP+V LD+ WN AFV V++ +L++S+DE P +P+R+WI GY  
Sbjct  49   ETAAQELEDRRADWGYSKPVVALDMLWNTAFVAVAVVMLLLSKDEKPNVPIRIWICGYAI  108

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGNWS  520
            QC++H+V V +E+R+RN +  S + L + + SGN S
Sbjct  109  QCLVHVVLVWIEFRKRNTIRPSGD-LEAAQGSGNGS  143



>ref|XP_006355061.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation 
specificity factor subunit 3-II-like [Solanum tuberosum]
Length=948

 Score =   110 bits (276),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA +++ER++DW YSKP+V LD+ WNL FV+VS+ +L  + DESP +P+R+WI GY  
Sbjct  654  ETAARELDERRADWGYSKPVVALDMMWNLGFVIVSVVILSCAVDESPNVPIRVWICGYAL  713

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H+V V LEYRRR+
Sbjct  714  QCVVHVVLVWLEYRRRS  730



>ref|XP_009420927.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Musa acuminata 
subsp. malaccensis]
Length=329

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+  EQ+EERQSDWAYS+ +V LD   NLAFV  +  VLV+SRDE+P MPLRLWI GY  
Sbjct  35   EAFTEQLEERQSDWAYSRTVVFLDTLLNLAFVAAAAGVLVLSRDEAPSMPLRLWIGGYAL  94

Query  413  QCVLHIVCVCLEYRRRN  463
            QCVL IVCVC+ ++RR+
Sbjct  95   QCVLFIVCVCVRFQRRH  111



>ref|XP_002969635.1| hypothetical protein SELMODRAFT_66385, partial [Selaginella moellendorffii]
 gb|EFJ29723.1| hypothetical protein SELMODRAFT_66385, partial [Selaginella moellendorffii]
Length=321

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+A EQ++ERQSDWAYS+P+V+LDL WNLAFV V++ VLV+S+ E P  PLR+W++GY  
Sbjct  10   ETAVEQLDERQSDWAYSRPVVVLDLIWNLAFVTVALVVLVISQSEQPCTPLRIWVLGYAL  69

Query  413  QCVLHIVCVCLEYRRRNQLPSS  478
            QCVLH+ CV  EYRRR +  SS
Sbjct  70   QCVLHMSCVVSEYRRRRRRRSS  91



>ref|XP_002970900.1| hypothetical protein SELMODRAFT_66382, partial [Selaginella moellendorffii]
 gb|EFJ28226.1| hypothetical protein SELMODRAFT_66382, partial [Selaginella moellendorffii]
Length=321

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+A EQ++ERQSDWAYS+P+V+LDL WNLAFV V++ VLV+S+ E P  PLR+W++GY  
Sbjct  10   ETAVEQLDERQSDWAYSRPVVVLDLIWNLAFVTVALVVLVISQSEQPCTPLRIWVLGYAL  69

Query  413  QCVLHIVCVCLEYRRRNQLPSS  478
            QCVLH+ CV  EYRRR +  SS
Sbjct  70   QCVLHMSCVVSEYRRRRRRRSS  91



>ref|XP_010319559.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
3-II [Solanum lycopersicum]
Length=1059

 Score =   110 bits (275),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA +++ER++DW YSKP+V LD+ WNL FV+VS  +L  + DESP +P+RLWI GY  
Sbjct  765  ETAARELDERRADWGYSKPVVALDMMWNLGFVIVSFVILSCAVDESPNVPIRLWICGYAL  824

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H+V V LEYRRR+
Sbjct  825  QCVVHVVLVWLEYRRRS  841



>ref|XP_011070566.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like isoform X2 [Sesamum 
indicum]
Length=357

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA ++EER++DW YSKP+V LD+ WNLAFV+VSI +L+ + +E P +P+R+W+ GY F
Sbjct  53   ETAARELEERRADWGYSKPVVALDIMWNLAFVIVSIVMLICTTNEKPNVPIRVWVCGYAF  112

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLN  493
            QC++H+V V +EY+RRN   S   NL+
Sbjct  113  QCLVHVVLVWVEYKRRNS--SQERNLD  137



>ref|XP_011070565.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like isoform X1 [Sesamum 
indicum]
Length=358

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA ++EER++DW YSKP+V LD+ WNLAFV+VSI +L+ + +E P +P+R+W+ GY F
Sbjct  53   ETAARELEERRADWGYSKPVVALDIMWNLAFVIVSIVMLICTTNEKPNVPIRVWVCGYAF  112

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLN  493
            QC++H+V V +EY+RRN   S   NL+
Sbjct  113  QCLVHVVLVWVEYKRRNS--SQERNLD  137



>ref|XP_008780251.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Phoenix dactylifera]
Length=164

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA Q+EER++DWAYS+P+V LD+ WNLAF  VS++VL  +  E P  P+R+WI GY  
Sbjct  48   ETAALQLEERRADWAYSRPVVALDIAWNLAFAAVSVAVLGATTGERPNTPVRVWIAGYAV  107

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H+  V  EYRRR+
Sbjct  108  QCVVHVALVWAEYRRRS  124



>ref|XP_009608303.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Nicotiana tomentosiformis]
Length=345

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA +++ER++DW YSKP+V LD+ WNL FV+VS+ +L  + DESP +P+R+W+ GY  
Sbjct  55   ETAARELDERRADWGYSKPVVALDMMWNLGFVIVSVVILSCTFDESPNVPIRIWVCGYAL  114

Query  413  QCVLHIVCVCLEYRRRN  463
            QCV+H+V V LEYRRRN
Sbjct  115  QCVVHVVLVWLEYRRRN  131



>emb|CDY27362.1| BnaC04g50430D [Brassica napus]
Length=1009

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQIEERQS+WAYSKP+++LD+ WNLAFV V++ VL    +E+P +PLR WIV Y+ 
Sbjct  702  ETAAEQIEERQSEWAYSKPVIVLDVVWNLAFVFVTVGVLWFRSEENPRVPLRFWIVVYNL  761

Query  413  QCVLHIVCVCLEYRRRN  463
            QC+LH+ CV  EY RR+
Sbjct  762  QCLLHVACVVSEYCRRH  778



>gb|KJB30722.1| hypothetical protein B456_005G157000 [Gossypium raimondii]
Length=348

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA ++EER++DW YSKP+V LD+ WN AFV+VS+ +L+ + DE+P  P+RLWI  Y  
Sbjct  45   ETAARELEERRADWGYSKPVVALDMLWNTAFVVVSVVMLISTADETPNTPIRLWICAYAL  104

Query  413  QCVLHIVCVCLEYRRRN  463
            QC+LH+V V LEYRRRN
Sbjct  105  QCLLHVVLVWLEYRRRN  121



>gb|KDO86039.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=270

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQS WAYS+PI++LD+ WNL FV+V+ +VL +S +E P +PLRL IVGY  
Sbjct  65   ETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLGVSINEKPEVPLRLRIVGYAL  124

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC+ H+ CV LE++RR +
Sbjct  125  QCLFHVFCVSLEFKRRRR  142



>ref|XP_006391188.1| hypothetical protein EUTSA_v10018815mg [Eutrema salsugineum]
 gb|ESQ28474.1| hypothetical protein EUTSA_v10018815mg [Eutrema salsugineum]
Length=342

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+++E+R++DW YSKP+V LD+ WN AFV+V+I +L++S+DE+P +P+R+WI GY  
Sbjct  42   ETAAQELEDRRADWGYSKPVVALDMLWNTAFVVVAIVMLLVSKDENPNVPIRVWICGYAL  101

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSS  508
            QC++H+V V LE+R+RN       +L +   S
Sbjct  102  QCLVHVVLVWLEFRKRNNTSRRGGDLEAGEGS  133



>ref|XP_010112554.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXC34101.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=378

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 91/116 (78%), Gaps = 5/116 (4%)
 Frame = +2

Query  80   NDGVDTTPLLG----DQIFGSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAE  247
             D VDTTP LG    D    SRRF++R  SLR AARFLR+ASSRR+MREPSM VRE+AAE
Sbjct  12   EDIVDTTPFLGGSSEDGNSASRRFVQRQ-SLRQAARFLRQASSRRLMREPSMLVREAAAE  70

Query  248  QIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQ  415
            Q+EERQ DWAYSKP+V+LD+ WN AFV+ + +VLV+S  ESP MPLRLWIVGY  Q
Sbjct  71   QLEERQGDWAYSKPVVILDVIWNFAFVVAAATVLVLSHRESPEMPLRLWIVGYALQ  126



>ref|XP_009351549.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Pyrus x bretschneideri]
Length=371

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA +++ER++DW YSKP+V LD+ WN AFV+VS+ +L+ ++DE P  P+RLWI GY  
Sbjct  63   ETAARELDERRADWGYSKPVVALDMMWNTAFVVVSVVMLLWTKDEQPNTPIRLWICGYAL  122

Query  413  QCVLHIVCVCLEYRRRNQL  469
            QC++H+V V +EYRRRN +
Sbjct  123  QCIVHVVLVWVEYRRRNNI  141



>gb|KDO86037.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=294

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQS WAYS+PI++LD+ WNL FV+V+ +VL +S +E P +PLRL IVGY  
Sbjct  65   ETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLGVSINEKPEVPLRLRIVGYAL  124

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC+ H+ CV LE++RR +
Sbjct  125  QCLFHVFCVSLEFKRRRR  142



>ref|XP_008803037.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Phoenix dactylifera]
Length=385

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+P+V LD+ WNLAFV  +++VL++S +E P  PLRLWI GY  
Sbjct  67   EAAAEQLEERQSDWAYSRPVVFLDILWNLAFVAAAVAVLILSWEERPSTPLRLWIGGYAL  126

Query  413  QCVLHIVCVCLEYRRRN  463
            QCVLH+VCV +EYRRR+
Sbjct  127  QCVLHMVCVRIEYRRRH  143



>ref|XP_009346865.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Pyrus 
x bretschneideri]
Length=380

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+PI++LDL WN   + +++ VL MS  E+P +PLR WI GY F
Sbjct  68   EAAAEQLEERQSDWAYSRPIIVLDLLWNAGLLGIAVGVLSMSWKEAPSVPLRTWIGGYAF  127

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC++H+VCV +E +RR +
Sbjct  128  QCLVHMVCVGVECKRRRR  145



>ref|XP_010910998.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Elaeis guineensis]
Length=163

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA Q+EER++DWAYS+P+V LD+ WNLAFV VS++VL  + DE P   +RLWI GY  
Sbjct  47   ETAALQLEERRADWAYSRPVVALDIAWNLAFVAVSVAVLGATIDEQPNTRVRLWIAGYAV  106

Query  413  QCVLHIVCVCLEYRRRN  463
            QC++H+  V  EYRRR+
Sbjct  107  QCLVHVALVWTEYRRRS  123



>ref|XP_008803038.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Phoenix dactylifera]
Length=384

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYS+P+V LD+ WNLAFV  +++VL++S +E P  PLRLWI GY  
Sbjct  67   EAAAEQLEERQSDWAYSRPVVFLDILWNLAFVAAAVAVLILSWEERPSTPLRLWIGGYAL  126

Query  413  QCVLHIVCVCLEYRRRN  463
            QCVLH+VCV +EYRRR+
Sbjct  127  QCVLHMVCVRIEYRRRH  143



>ref|XP_008345901.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=380

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 75/126 (60%), Gaps = 25/126 (20%)
 Frame = +2

Query  101  PLLGDQIF----GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQS  268
            PL G   F     SRR M R PS+R                       E+AAEQ+EERQS
Sbjct  41   PLRGAARFLRRASSRRMMLREPSVRVR---------------------EAAAEQLEERQS  79

Query  269  DWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLE  448
            DWAYS+PI++LDL WN   + +++ VL MS  E+P +PLR WI GY FQC++H+VCV +E
Sbjct  80   DWAYSRPIIVLDLLWNAGLLGIAVGVLSMSWKEAPSVPLRTWIGGYAFQCLVHMVCVGVE  139

Query  449  YRRRNQ  466
             +RR +
Sbjct  140  CKRRRR  145



>gb|KDO86038.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=325

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQS WAYS+PI++LD+ WNL FV+V+ +VL +S +E P +PLRL IVGY  
Sbjct  65   ETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLGVSINEKPEVPLRLRIVGYAL  124

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC+ H+ CV LE++RR +
Sbjct  125  QCLFHVFCVSLEFKRRRR  142



>ref|NP_176974.1| C3HC4-type RING finger domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG52017.1|AC012563_27 putative RING zinc finger protein; 27623-28978 [Arabidopsis thaliana]
 gb|ABD85151.1| At1g68070 [Arabidopsis thaliana]
 gb|AEE34743.1| C3HC4-type RING finger domain-containing protein [Arabidopsis 
thaliana]
Length=343

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+++EER++DW YSKP+V LD+ WN AFVLV+I +L++ ++E P +P+R+WI GY  
Sbjct  49   ETAAQELEERRADWGYSKPVVALDMLWNTAFVLVAIVMLLVFKEEKPNVPIRIWICGYAI  108

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSS  508
            QC++H+V V LE+R+RN   S P +L + +++
Sbjct  109  QCLVHVVLVWLEFRKRNA-RSRPGDLEAAQAT  139



>ref|XP_007045268.1| Zinc finger isoform 2 [Theobroma cacao]
 gb|EOY01100.1| Zinc finger isoform 2 [Theobroma cacao]
Length=256

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA ++EER++DW YSKP+V LD+ WN AFV VS+++L+ + DE    P+RLWI GY  
Sbjct  55   ETAARELEERRADWGYSKPVVALDMLWNTAFVAVSVAMLICTVDERTNTPIRLWICGYAL  114

Query  413  QCVLHIVCVCLEYRRRNQLPSSPEN  487
            QC++H+V V LEYRRRN   +S  +
Sbjct  115  QCLVHVVLVWLEYRRRNVRRTSARD  139



>ref|XP_002887158.1| hypothetical protein ARALYDRAFT_475916 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63417.1| hypothetical protein ARALYDRAFT_475916 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+++EER++DW YSKP+V LD+ WN AFV+V+I +L++ ++E P +P+R+WI GY  
Sbjct  49   ETAAQELEERRADWGYSKPVVALDMLWNTAFVVVAIVMLLVFKEEKPNVPIRVWICGYAI  108

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSGN  514
            QC++H+V V LE+R+RN   +   +L + + SGN
Sbjct  109  QCLVHVVLVWLEFRKRNA-RTRTGDLEAAQGSGN  141



>gb|AAM61051.1| putative RING zinc finger protein [Arabidopsis thaliana]
Length=343

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+++EER++DW YSKP+V LD+ WN AFVLV+I +L++ ++E P +P+R+WI GY  
Sbjct  49   ETAAQELEERRADWGYSKPVVALDMLWNTAFVLVAIVMLLVFKEEKPNVPIRIWICGYAI  108

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSS  508
            QC++H+V V LE+R+RN   S P +L + +++
Sbjct  109  QCLVHVVLVWLEFRKRNA-RSRPGDLEAAQAT  139



>ref|XP_007051906.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX96063.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=389

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKPI++LD+ WN+AFV++++ VL +S DE P +PLRLWI GY  
Sbjct  72   ETAAEQLEERQSDWAYSKPIIVLDILWNMAFVVMAVVVLGLSLDEKPTVPLRLWISGYGL  131

Query  413  QCVLHIVCVCLEYRRRN  463
            QC+ H+ CV +EY+RRN
Sbjct  132  QCLFHVACVVVEYKRRN  148



>ref|XP_010540663.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X2 [Tarenaya hassleriana]
Length=404

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V+LD
Sbjct  74   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVVLD  111

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WN+AFV V+++ LV+SR+E P MPLR+W+VGY  QC+LH+ CVC+EY
Sbjct  112  IVWNVAFVAVAVAALVLSRNERPNMPLRVWVVGYALQCLLHMACVCVEY  160



>ref|XP_010540654.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Tarenaya hassleriana]
Length=405

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V+LD
Sbjct  74   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVVLD  111

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WN+AFV V+++ LV+SR+E P MPLR+W+VGY  QC+LH+ CVC+EY
Sbjct  112  IVWNVAFVAVAVAALVLSRNERPNMPLRVWVVGYALQCLLHMACVCVEY  160



>gb|KDO86036.1| hypothetical protein CISIN_1g017405mg [Citrus sinensis]
Length=372

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQS WAYS+PI++LD+ WNL FV+V+ +VL +S +E P +PLRL IVGY  
Sbjct  65   ETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLGVSINEKPEVPLRLRIVGYAL  124

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC+ H+ CV LE++RR +
Sbjct  125  QCLFHVFCVSLEFKRRRR  142



>ref|XP_006445135.1| hypothetical protein CICLE_v10020664mg [Citrus clementina]
 gb|ESR58375.1| hypothetical protein CICLE_v10020664mg [Citrus clementina]
Length=372

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQS WAYS+PI++LD+ WNL FV+V+ +VL +S +E P +PLRL IVGY  
Sbjct  65   ETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLGVSINEKPEVPLRLRIVGYAL  124

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC+ H+ CV LE++RR +
Sbjct  125  QCLFHVFCVSLEFKRRRR  142



>ref|XP_006491024.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Citrus 
sinensis]
Length=365

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQS WAYS+PI++LD+ WNL FV+V+ +VL +S +E P +PLRL IVGY  
Sbjct  58   ETAAEQLEERQSYWAYSRPIIVLDVLWNLVFVIVAFAVLGVSINEKPEVPLRLRIVGYAL  117

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC+ H+ CV LE++RR +
Sbjct  118  QCLFHVFCVSLEFKRRRR  135



>ref|XP_010540680.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X4 [Tarenaya hassleriana]
Length=403

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V+LD
Sbjct  74   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVVLD  111

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WN+AFV V+++ LV+SR+E P MPLR+W+VGY  QC+LH+ CVC+EY
Sbjct  112  IVWNVAFVAVAVAALVLSRNERPNMPLRVWVVGYALQCLLHMACVCVEY  160



>ref|XP_010540671.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X3 [Tarenaya hassleriana]
Length=404

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V+LD
Sbjct  74   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVVLD  111

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WN+AFV V+++ LV+SR+E P MPLR+W+VGY  QC+LH+ CVC+EY
Sbjct  112  IVWNVAFVAVAVAALVLSRNERPNMPLRVWVVGYALQCLLHMACVCVEY  160



>ref|XP_010053666.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Eucalyptus 
grandis]
 gb|KCW78019.1| hypothetical protein EUGRSUZ_D02250 [Eucalyptus grandis]
Length=401

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+E RQSDWAYS PIV LD+ WNLAFV V++ V+ +S +E P +PLRLWIV Y  
Sbjct  76   ENAAEQLETRQSDWAYSTPIVALDILWNLAFVGVALGVVALSPNERPEVPLRLWIVVYAL  135

Query  413  QCVLHIVCVCLEYRRR  460
            QC+ H+ CV  E++RR
Sbjct  136  QCLFHVACVVAEFKRR  151



>ref|XP_003517458.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=385

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ +VLV+S  E+P MPLRLWIVGY  
Sbjct  65   EAAAEQLEERQSDWAYSKPVVVLDIVWNFAFVVVAGAVLVLSASEAPGMPLRLWIVGYAM  124

Query  413  QCVLHIVCVCLEY  451
            QCVLH+VCVC+EY
Sbjct  125  QCVLHMVCVCVEY  137



>emb|CDY50582.1| BnaC02g39560D [Brassica napus]
Length=238

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            ESA EQ+EERQ+DWA SK +V+LD   NLAFV V   V+V+S DE    PLR+ I+GY  
Sbjct  10   ESAVEQLEERQNDWADSKSVVVLDFVCNLAFVSVDAFVIVLSSDEKSNTPLRVLIIGYGL  69

Query  413  QCVLHIVCVCLEYRRR-NQLPSSPENL  490
            QCV+H+ CVC+EYR+R N++ SSP ++
Sbjct  70   QCVMHMFCVCVEYRKRSNRIQSSPYSM  96



>gb|ACN30552.1| unknown [Zea mays]
Length=166

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAE +EERQ+DWAYSKP+V++D+ WN+AFV ++ +VL  S  ESP +PLR+WI GY  
Sbjct  68   ETAAEHLEERQTDWAYSKPVVVVDMLWNVAFVAIAAAVLAASLGESPAVPLRVWIAGYVL  127

Query  413  QCVLHIVCVCLEYRRRNQ  466
            QC+LHI+CV +EYRRR +
Sbjct  128  QCLLHILCVTVEYRRRRR  145



>ref|XP_008381749.1| PREDICTED: E3 ubiquitin protein ligase RIE1 [Malus domestica]
Length=371

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA +++ER++DW YSKP+V LD+ WN AFV+VS+ +L  ++DE P  P+RLWI GY  
Sbjct  63   ETAARELDERRADWGYSKPVVALDMMWNTAFVVVSVVMLFWTKDERPNTPIRLWICGYVL  122

Query  413  QCVLHIVCVCLEYRRRNQL  469
            QC++H+V V +EYRRRN +
Sbjct  123  QCIVHVVLVWVEYRRRNNI  141



>ref|XP_007045267.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
 gb|EOY01099.1| Zinc finger, C3HC4 type (RING finger) family protein isoform 
1 [Theobroma cacao]
Length=360

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA ++EER++DW YSKP+V LD+ WN AFV VS+++L+ + DE    P+RLWI GY  
Sbjct  55   ETAARELEERRADWGYSKPVVALDMLWNTAFVAVSVAMLICTVDERTNTPIRLWICGYAL  114

Query  413  QCVLHIVCVCLEYRRRN  463
            QC++H+V V LEYRRRN
Sbjct  115  QCLVHVVLVWLEYRRRN  131



>ref|XP_004295567.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Fragaria 
vesca subsp. vesca]
Length=418

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = +2

Query  50   NVNVNSGGEGNDGVDTTPLL----GDQIFGSRRFMRRPPS--Lrgaarflrrassrrmmr  211
            +V +N          ++PLL     D +  SRR +R+PP      A    R +  R  +R
Sbjct  33   HVQLNPTPPSPSDAASSPLLSTSIADNLLRSRRLIRQPPRPLRGAARFLRRASGRRMRLR  92

Query  212  epsmrvrESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRL  391
            EPS+RVRESAAEQ+EERQSDWAYS+PIV+LDL WN   ++++++VL  S +ESP +PLR+
Sbjct  93   EPSVRVRESAAEQLEERQSDWAYSRPIVVLDLLWNAVLLVIALAVLWFSYEESPEVPLRV  152

Query  392  WIVGYDFQCVLHIVCVCLEYRRRNQL  469
            WI GY  QC +H+ CV +E  RR ++
Sbjct  153  WIGGYALQCAVHMFCVGVECTRRRRV  178



>ref|XP_010470747.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Camelina sativa]
Length=348

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA+++EER++DW YSKP+V LD+ WN AFV+V+ ++L++ +DE P +P+R+WI GY  
Sbjct  52   ETAAQELEERRADWGYSKPVVALDMLWNSAFVVVAAAMLLVFKDEKPNVPIRIWICGYAI  111

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNS  496
            QC++H+V V LE+R+RN   S P +L S
Sbjct  112  QCLVHVVLVWLEFRKRNA-RSRPGDLES  138



>ref|XP_010529547.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Tarenaya 
hassleriana]
Length=400

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V+LD
Sbjct  71   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVVLD  108

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WN+AFV V+++VLV+SRDE P MPLR+W+VGY  QC++H+ CVC+EY
Sbjct  109  IVWNVAFVAVAVAVLVLSRDELPNMPLRVWVVGYALQCLIHMACVCVEY  157



>ref|XP_010529546.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Tarenaya 
hassleriana]
Length=401

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 22/109 (20%)
 Frame = +2

Query  125  GSRRFMRRPPSLrgaarflrrassrrmmrepsmrvrESAAEQIEERQSDWAYSKPIVLLD  304
            GSRR MR P  L                        E+AAEQ+EERQSDWAYSKP+V+LD
Sbjct  71   GSRRMMREPSMLVR----------------------ETAAEQLEERQSDWAYSKPVVVLD  108

Query  305  LFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVCVCLEY  451
            + WN+AFV V+++VLV+SRDE P MPLR+W+VGY  QC++H+ CVC+EY
Sbjct  109  IVWNVAFVAVAVAVLVLSRDELPNMPLRVWVVGYALQCLIHMACVCVEY  157



>ref|XP_008383660.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=381

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  95   TTPLLG----DQIFGSRRFMRRPPS--LrgaarflrrassrrmmrepsmrvrESAAEQIE  256
            ++PLLG    D I  SRR +RRPP      A    R +S R M+REPS+RVRE+AAEQ+E
Sbjct  15   SSPLLGHSLADNIVRSRRLIRRPPHPLRGAARFLRRASSRRMMLREPSVRVREAAAEQVE  74

Query  257  ERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVC  436
            +RQSDWAYS+PI++LDL WN   + +++ VL +S  E P +PLR WI GY FQC++H+VC
Sbjct  75   DRQSDWAYSRPIIVLDLLWNAGLLGIAVGVLSLSWKEEPSVPLRTWIGGYAFQCLVHMVC  134

Query  437  VCLEYR  454
            V +E +
Sbjct  135  VVVECK  140



>gb|KHG00424.1| E3 ubiquitin ligase RIE1 -like protein [Gossypium arboreum]
Length=298

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 66/93 (71%), Gaps = 10/93 (11%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA ++EER++DW YSKP+V LD+ WN AFV+VS+ +L+ + +E P  P+R+WI GY  
Sbjct  56   ETAARELEERRADWGYSKPVVALDILWNTAFVVVSVVMLICTVNEKPNTPVRVWICGYAL  115

Query  413  QCVLHIVCVCLEYRRRNQLPSSPENLNSRRSSG  511
            QC +H+V V LEY+RR          N+RR+SG
Sbjct  116  QCSVHVVLVWLEYKRR----------NARRASG  138



>ref|XP_008358659.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Malus 
domestica]
Length=381

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +2

Query  95   TTPLLG----DQIFGSRRFMRRPPS--LrgaarflrrassrrmmrepsmrvrESAAEQIE  256
            ++PLLG    D I  SRR +RRPP      A    R +S R M+REPS+RVRE+AAEQ+E
Sbjct  15   SSPLLGHSLADNIVRSRRLIRRPPHPLRGAARFLRRASSRRMMLREPSVRVREAAAEQVE  74

Query  257  ERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDFQCVLHIVC  436
            +RQSDWAYS+PI++LDL WN   + +++ VL +S  E P +PLR WI GY FQC++H+VC
Sbjct  75   DRQSDWAYSRPIIVLDLLWNAGLLGIAVGVLSLSWKEEPSVPLRTWIGGYAFQCLVHMVC  134

Query  437  VCLEYR  454
            V +E +
Sbjct  135  VVVECK  140



>ref|XP_010661149.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Vitis vinifera]
Length=384

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ +VLV+SR ESP MPLR WIVGY  
Sbjct  68   ETAAEQLEERQSDWAYSKPVVVLDMIWNFAFVVVAAAVLVLSRRESPSMPLRFWIVGYAL  127

Query  413  QCVLHIVCVCLEY  451
            QC+LHIVCV +EY
Sbjct  128  QCILHIVCVSVEY  140



>ref|XP_008389170.1| PREDICTED: E3 ubiquitin protein ligase RIE1 [Malus domestica]
Length=372

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AA +++ER++DW YSKP+V LD+ WN AFV+VS+ +L+ + DE P  P+RLWI GY  
Sbjct  64   ETAARELDERRADWGYSKPVVALDMMWNTAFVVVSVVMLIWTEDERPNTPIRLWIYGYAL  123

Query  413  QCVLHIVCVCLEYRRRNQL  469
            QC  H+V V +EYRRRN +
Sbjct  124  QCFAHVVLVWVEYRRRNNI  142



>ref|XP_003631422.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Vitis vinifera]
Length=383

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  233  ESAAEQIEERQSDWAYSKPIVLLDLFWNLAFVLVSISVLVMSRDESPMMPLRLWIVGYDF  412
            E+AAEQ+EERQSDWAYSKP+V+LD+ WN AFV+V+ +VLV+SR ESP MPLR WIVGY  
Sbjct  68   ETAAEQLEERQSDWAYSKPVVVLDMIWNFAFVVVAAAVLVLSRRESPSMPLRFWIVGYAL  127

Query  413  QCVLHIVCVCLEY  451
            QC+LHIVCV +EY
Sbjct  128  QCILHIVCVSVEY  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600