BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003K13

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46296.1|  cytochrome P450                                        243   8e-74   Ipomoea nil [qian niu]
emb|CDP22261.1|  unnamed protein product                                200   7e-61   Coffea canephora [robusta coffee]
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg                209   7e-61   Erythranthe guttata [common monkey flower]
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like               207   2e-60   
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like               207   2e-60   Solanum lycopersicum
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like               207   2e-60   Nicotiana tomentosiformis
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like               207   3e-60   Nicotiana sylvestris
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like               206   9e-60   Sesamum indicum [beniseed]
ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like               206   1e-59   Nicotiana tomentosiformis
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like               205   2e-59   Solanum tuberosum [potatoes]
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like               204   3e-59   Nicotiana tomentosiformis
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like               204   4e-59   Solanum lycopersicum
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like               204   5e-59   
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like               203   1e-58   Solanum tuberosum [potatoes]
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like               201   4e-58   Nicotiana sylvestris
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like               198   4e-57   Nicotiana sylvestris
gb|EYU32453.1|  hypothetical protein MIMGU_mgv1a005630mg                197   1e-56   Erythranthe guttata [common monkey flower]
gb|EYU27551.1|  hypothetical protein MIMGU_mgv1a027070mg                197   2e-56   Erythranthe guttata [common monkey flower]
gb|EPS60789.1|  hypothetical protein M569_14012                         196   2e-56   Genlisea aurea
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like               195   9e-56   Nicotiana tomentosiformis
ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like               195   1e-55   Nicotiana tomentosiformis
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like               192   6e-55   
gb|EPS65366.1|  hypothetical protein M569_09411                         187   6e-53   Genlisea aurea
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like               186   2e-52   Nicotiana tomentosiformis
ref|XP_006340071.1|  PREDICTED: cytochrome P450 86B1-like               185   3e-52   
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like               184   2e-51   Solanum lycopersicum
ref|XP_006351417.1|  PREDICTED: cytochrome P450 86B1-like               182   5e-51   Solanum tuberosum [potatoes]
ref|XP_006339338.1|  PREDICTED: cytochrome P450 86B1-like               181   7e-51   Solanum tuberosum [potatoes]
gb|AJD25225.1|  cytochrome P450 CYP96A85                                182   9e-51   Salvia miltiorrhiza [Chinese salvia]
gb|AEI59774.1|  cytochrome P450                                         176   1e-48   Helianthus annuus
gb|EYU41723.1|  hypothetical protein MIMGU_mgv1a021724mg                175   4e-48   Erythranthe guttata [common monkey flower]
gb|EYU33777.1|  hypothetical protein MIMGU_mgv1a004858mg                174   8e-48   Erythranthe guttata [common monkey flower]
ref|XP_010683407.1|  PREDICTED: cytochrome P450 86B1-like               164   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010680694.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    155   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like               159   4e-42   Nicotiana tomentosiformis
gb|EPS60696.1|  hypothetical protein M569_14105                         157   5e-42   Genlisea aurea
ref|XP_009759082.1|  PREDICTED: cytochrome P450 86B1-like               158   7e-42   Nicotiana sylvestris
ref|XP_002279531.1|  PREDICTED: cytochrome P450 86B1                    158   7e-42   Vitis vinifera
gb|KFK32767.1|  hypothetical protein AALP_AA6G286100                    157   1e-41   Arabis alpina [alpine rockcress]
ref|XP_010027332.1|  PREDICTED: cytochrome P450 86B1-like               152   2e-41   Eucalyptus grandis [rose gum]
ref|XP_006427987.1|  hypothetical protein CICLE_v10025412mg             157   2e-41   
ref|XP_010531420.1|  PREDICTED: cytochrome P450 86B1-like               157   2e-41   Tarenaya hassleriana [spider flower]
ref|NP_179899.1|  cytochrome P450, family 96, subfamily A, polype...    156   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009601590.1|  PREDICTED: cytochrome P450 86B1-like               156   3e-41   Nicotiana tomentosiformis
ref|XP_010680693.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    156   3e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002878665.1|  CYP96A1                                            155   4e-41   
ref|XP_009117295.1|  PREDICTED: cytochrome P450 86B1                    155   4e-41   Brassica rapa
gb|EYU27556.1|  hypothetical protein MIMGU_mgv1a021423mg                155   5e-41   Erythranthe guttata [common monkey flower]
emb|CDY46088.1|  BnaA09g42120D                                          155   7e-41   Brassica napus [oilseed rape]
ref|XP_006374652.1|  cytochrome P450 family protein                     154   9e-41   
ref|XP_010419318.1|  PREDICTED: cytochrome P450 86B1-like               152   1e-40   
ref|XP_010681071.1|  PREDICTED: cytochrome P450 86B1-like               154   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011095705.1|  PREDICTED: cytochrome P450 86B1-like               154   2e-40   Sesamum indicum [beniseed]
emb|CDX76867.1|  BnaC08g34530D                                          153   4e-40   
gb|EYU27553.1|  hypothetical protein MIMGU_mgv1a006542mg                152   6e-40   Erythranthe guttata [common monkey flower]
ref|XP_009389287.1|  PREDICTED: cytochrome P450 86B1-like               152   7e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010416946.1|  PREDICTED: cytochrome P450 86B1-like               152   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010025513.1|  PREDICTED: cytochrome P450 86B1-like               152   7e-40   Eucalyptus grandis [rose gum]
ref|XP_010417073.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    152   8e-40   
ref|XP_010681072.1|  PREDICTED: cytochrome P450 86B1-like               151   2e-39   
ref|XP_010429263.1|  PREDICTED: cytochrome P450 86B1-like               151   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010473744.1|  PREDICTED: cytochrome P450 86B1-like               151   2e-39   Camelina sativa [gold-of-pleasure]
ref|NP_179782.1|  cytochrome P450, family 96, subfamily A, polype...    151   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33664.1|  hypothetical protein AALP_AA5G043500                    151   2e-39   Arabis alpina [alpine rockcress]
gb|EYU33778.1|  hypothetical protein MIMGU_mgv1a020242mg                150   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg             150   2e-39   Eutrema salsugineum [saltwater cress]
ref|XP_010261086.1|  PREDICTED: cytochrome P450 86B1-like               150   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like               150   3e-39   Nicotiana sylvestris
ref|XP_010437068.1|  PREDICTED: cytochrome P450 86B1                    150   3e-39   
ref|XP_006446602.1|  hypothetical protein CICLE_v10014930mg             150   3e-39   Citrus clementina [clementine]
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like               150   3e-39   Nicotiana tomentosiformis
ref|XP_008801256.1|  PREDICTED: cytochrome P450 86B1-like               150   4e-39   Phoenix dactylifera
emb|CDY53179.1|  BnaA06g40580D                                          150   6e-39   Brassica napus [oilseed rape]
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...    150   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1         150   6e-39   
ref|XP_002866853.1|  CYP96A10                                           149   7e-39   Arabidopsis lyrata subsp. lyrata
emb|CDP04331.1|  unnamed protein product                                149   9e-39   Coffea canephora [robusta coffee]
ref|XP_010436205.1|  PREDICTED: cytochrome P450 86B1-like               148   1e-38   Camelina sativa [gold-of-pleasure]
gb|EYU41727.1|  hypothetical protein MIMGU_mgv1a023193mg                147   1e-38   Erythranthe guttata [common monkey flower]
ref|XP_010555338.1|  PREDICTED: cytochrome P450 86B1-like               149   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_006470474.1|  PREDICTED: cytochrome P450 86B1-like               149   1e-38   
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                    149   1e-38   Brassica rapa
ref|XP_006285710.1|  hypothetical protein CARUB_v10007181mg             149   1e-38   Capsella rubella
gb|KDO55118.1|  hypothetical protein CISIN_1g036278mg                   145   2e-38   Citrus sinensis [apfelsine]
gb|KDO37689.1|  hypothetical protein CISIN_1g047842mg                   148   2e-38   Citrus sinensis [apfelsine]
gb|KDO37445.1|  hypothetical protein CISIN_1g036716mg                   142   2e-38   Citrus sinensis [apfelsine]
ref|XP_006294050.1|  hypothetical protein CARUB_v10023041mg             148   2e-38   Capsella rubella
ref|XP_002878579.1|  CYP96A5                                            148   2e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_010446494.1|  PREDICTED: cytochrome P450 86B1-like               148   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010027341.1|  PREDICTED: cytochrome P450 86B1-like               148   3e-38   Eucalyptus grandis [rose gum]
emb|CDY53181.1|  BnaA06g40600D                                          147   4e-38   Brassica napus [oilseed rape]
ref|XP_009101871.1|  PREDICTED: cytochrome P450 86B1                    147   4e-38   Brassica rapa
emb|CDX72698.1|  BnaC07g47200D                                          147   4e-38   
ref|XP_009759095.1|  PREDICTED: cytochrome P450 86B1-like               147   5e-38   Nicotiana sylvestris
ref|XP_006283543.1|  hypothetical protein CARUB_v10004594mg             147   5e-38   Capsella rubella
gb|EYU24048.1|  hypothetical protein MIMGU_mgv1a026886mg                146   8e-38   Erythranthe guttata [common monkey flower]
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like               146   9e-38   Camelina sativa [gold-of-pleasure]
emb|CDX72695.1|  BnaC07g47170D                                          146   1e-37   
ref|XP_010027235.1|  PREDICTED: cytochrome P450 86B1-like               141   1e-37   Eucalyptus grandis [rose gum]
ref|XP_010472325.1|  PREDICTED: cytochrome P450 86B1-like               142   1e-37   
ref|XP_011100902.1|  PREDICTED: cytochrome P450 86B1-like               146   1e-37   Sesamum indicum [beniseed]
ref|XP_006405740.1|  hypothetical protein EUTSA_v10027725mg             146   1e-37   Eutrema salsugineum [saltwater cress]
ref|XP_011041669.1|  PREDICTED: cytochrome P450 86B1-like               146   1e-37   Populus euphratica
ref|XP_006405739.1|  hypothetical protein EUTSA_v10028064mg             146   1e-37   Eutrema salsugineum [saltwater cress]
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg                145   2e-37   Erythranthe guttata [common monkey flower]
gb|KCW62188.1|  hypothetical protein EUGRSUZ_H04845                     144   2e-37   Eucalyptus grandis [rose gum]
ref|XP_010027339.1|  PREDICTED: cytochrome P450 86B1-like               145   3e-37   Eucalyptus grandis [rose gum]
ref|XP_010027331.1|  PREDICTED: cytochrome P450 86B1-like               145   3e-37   Eucalyptus grandis [rose gum]
gb|KFK30509.1|  hypothetical protein AALP_AA7G271200                    144   3e-37   Arabis alpina [alpine rockcress]
ref|XP_010652863.1|  PREDICTED: cytochrome P450 86B1                    144   4e-37   Vitis vinifera
ref|XP_006405689.1|  hypothetical protein EUTSA_v10028261mg             145   4e-37   
ref|XP_010027344.1|  PREDICTED: cytochrome P450 86B1-like               144   4e-37   Eucalyptus grandis [rose gum]
gb|KCW62190.1|  hypothetical protein EUGRSUZ_H04847                     144   5e-37   Eucalyptus grandis [rose gum]
gb|KJB71270.1|  hypothetical protein B456_011G113900                    144   6e-37   Gossypium raimondii
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g             144   7e-37   Populus trichocarpa [western balsam poplar]
ref|XP_007048137.1|  Cytochrome P450                                    144   7e-37   
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg                143   7e-37   Erythranthe guttata [common monkey flower]
ref|XP_009101866.1|  PREDICTED: cytochrome P450 86B1                    144   7e-37   Brassica rapa
ref|XP_006404644.1|  hypothetical protein EUTSA_v10000679mg             144   8e-37   Eutrema salsugineum [saltwater cress]
ref|XP_006404787.1|  hypothetical protein EUTSA_v10000131mg             144   8e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010681074.1|  PREDICTED: cytochrome P450 86B1-like               144   9e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002521474.1|  cytochrome P450, putative                          143   1e-36   Ricinus communis
emb|CAB44684.1|  cytochrome P450-like protein                           142   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027335.1|  PREDICTED: cytochrome P450 86B1-like               142   3e-36   
ref|XP_009107985.1|  PREDICTED: cytochrome P450 86B1-like               142   3e-36   Brassica rapa
emb|CDY53177.1|  BnaA06g40560D                                          142   3e-36   Brassica napus [oilseed rape]
ref|XP_006470473.1|  PREDICTED: cytochrome P450 86B1-like               142   3e-36   
emb|CDY44658.1|  BnaA08g06820D                                          142   3e-36   Brassica napus [oilseed rape]
ref|XP_009101865.1|  PREDICTED: cytochrome P450 86B1-like               142   4e-36   Brassica rapa
gb|KDP35260.1|  hypothetical protein JCGZ_09419                         142   4e-36   Jatropha curcas
gb|EYU27555.1|  hypothetical protein MIMGU_mgv1a020397mg                142   4e-36   Erythranthe guttata [common monkey flower]
emb|CDX76962.1|  BnaC08g35480D                                          142   4e-36   
ref|XP_009108130.1|  PREDICTED: cytochrome P450 86B1-like               142   5e-36   Brassica rapa
emb|CDY27160.1|  BnaA08g07980D                                          142   5e-36   Brassica napus [oilseed rape]
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                    141   5e-36   Solanum lycopersicum
ref|XP_010025512.1|  PREDICTED: cytochrome P450 86B1-like               141   5e-36   Eucalyptus grandis [rose gum]
emb|CDY53182.1|  BnaA06g40610D                                          141   5e-36   Brassica napus [oilseed rape]
ref|XP_011043827.1|  PREDICTED: cytochrome P450 86B1-like               141   6e-36   Populus euphratica
ref|XP_010526618.1|  PREDICTED: cytochrome P450 86B1-like               141   6e-36   Tarenaya hassleriana [spider flower]
gb|KFK32856.1|  hypothetical protein AALP_AA6G295800                    141   6e-36   Arabis alpina [alpine rockcress]
ref|XP_006446605.1|  hypothetical protein CICLE_v10017795mg             141   7e-36   
ref|XP_009795090.1|  PREDICTED: cytochrome P450 86B1-like               141   7e-36   Nicotiana sylvestris
ref|XP_010027329.1|  PREDICTED: cytochrome P450 86B1-like               141   8e-36   Eucalyptus grandis [rose gum]
ref|XP_004160509.1|  PREDICTED: cytochrome P450 86B1-like               141   8e-36   
gb|KFK31020.1|  hypothetical protein AALP_AA6G057700                    141   8e-36   Arabis alpina [alpine rockcress]
emb|CDY32582.1|  BnaC03g15500D                                          140   9e-36   Brassica napus [oilseed rape]
gb|EAY88475.1|  hypothetical protein OsI_09946                          140   1e-35   Oryza sativa Indica Group [Indian rice]
gb|KFK30510.1|  hypothetical protein AALP_AA7G271300                    140   1e-35   Arabis alpina [alpine rockcress]
gb|ABF93892.1|  Cytochrome P450 family protein                          140   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g             140   1e-35   Phaseolus vulgaris [French bean]
ref|XP_009117361.1|  PREDICTED: cytochrome P450 86B1                    140   1e-35   
gb|KFK22570.1|  hypothetical protein AALP_AAs72953U000100               140   1e-35   Arabis alpina [alpine rockcress]
ref|XP_002529227.1|  cytochrome P450, putative                          140   1e-35   Ricinus communis
emb|CAN80536.1|  hypothetical protein VITISV_035975                     140   2e-35   Vitis vinifera
emb|CDX72691.1|  BnaC07g47130D                                          135   2e-35   
emb|CDX83711.1|  BnaC07g24510D                                          135   2e-35   
ref|XP_003525678.1|  PREDICTED: cytochrome P450 86B1-like               140   2e-35   Glycine max [soybeans]
ref|XP_004151191.1|  PREDICTED: cytochrome P450 86B1-like               139   2e-35   
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g             140   2e-35   Phaseolus vulgaris [French bean]
gb|KCW62191.1|  hypothetical protein EUGRSUZ_H04849                     139   2e-35   Eucalyptus grandis [rose gum]
emb|CDY38915.1|  BnaA03g12640D                                          135   2e-35   Brassica napus [oilseed rape]
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590          139   2e-35   
gb|KGN48430.1|  hypothetical protein Csa_6G487020                       139   3e-35   Cucumis sativus [cucumbers]
gb|KGN48432.1|  hypothetical protein Csa_6G487530                       139   3e-35   Cucumis sativus [cucumbers]
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like               139   3e-35   Solanum tuberosum [potatoes]
ref|XP_011031168.1|  PREDICTED: cytochrome P450 86B1-like               139   3e-35   Populus euphratica
ref|XP_004160508.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    139   3e-35   
emb|CDP12888.1|  unnamed protein product                                139   3e-35   Coffea canephora [robusta coffee]
emb|CDY70656.1|  BnaAnng34510D                                          136   4e-35   Brassica napus [oilseed rape]
ref|XP_004237624.1|  PREDICTED: cytochrome P450 86B1-like               139   4e-35   Solanum lycopersicum
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like               139   4e-35   Glycine max [soybeans]
ref|XP_004142037.1|  PREDICTED: cytochrome P450 86B1-like               139   5e-35   
gb|KGN48434.1|  hypothetical protein Csa_6G487550                       139   5e-35   Cucumis sativus [cucumbers]
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like               139   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004173396.1|  PREDICTED: cytochrome P450 86B1-like               139   6e-35   
ref|XP_010554002.1|  PREDICTED: cytochrome P450 86B1-like               138   7e-35   Tarenaya hassleriana [spider flower]
ref|XP_010444891.1|  PREDICTED: cytochrome P450 86B1-like               133   8e-35   
emb|CDY12435.1|  BnaC08g09240D                                          138   8e-35   Brassica napus [oilseed rape]
gb|EPS73452.1|  hypothetical protein M569_01304                         130   8e-35   Genlisea aurea
ref|XP_008440138.1|  PREDICTED: cytochrome P450 86B1-like               138   8e-35   Cucumis melo [Oriental melon]
gb|KDP35253.1|  hypothetical protein JCGZ_09412                         138   8e-35   Jatropha curcas
ref|XP_006306153.1|  hypothetical protein CARUB_v10011665mg             138   9e-35   Capsella rubella
emb|CDY13727.1|  BnaA06g31960D                                          137   9e-35   Brassica napus [oilseed rape]
emb|CDY29171.1|  BnaC09g15680D                                          137   1e-34   Brassica napus [oilseed rape]
gb|ACR38435.1|  unknown                                                 137   1e-34   Zea mays [maize]
emb|CDX72690.1|  BnaC07g47120D                                          137   1e-34   
ref|XP_009151941.1|  PREDICTED: cytochrome P450 86A7-like               137   1e-34   Brassica rapa
ref|XP_009113344.1|  PREDICTED: cytochrome P450 86B1-like               137   1e-34   Brassica rapa
emb|CDY39927.1|  BnaA09g15090D                                          137   1e-34   Brassica napus [oilseed rape]
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like               137   1e-34   Glycine max [soybeans]
ref|XP_006405349.1|  hypothetical protein EUTSA_v10028238mg             137   2e-34   
ref|XP_002310605.1|  hypothetical protein POPTR_0007s06670g             137   2e-34   
ref|XP_007150920.1|  hypothetical protein PHAVU_004G005700g             136   2e-34   Phaseolus vulgaris [French bean]
ref|XP_002275905.2|  PREDICTED: cytochrome P450 86B1                    137   2e-34   
ref|XP_002868908.1|  hypothetical protein ARALYDRAFT_352944             139   3e-34   
dbj|BAD94304.1|  cytochrome p450 - like protein                         137   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KJB44293.1|  hypothetical protein B456_007G244800                    136   3e-34   Gossypium raimondii
ref|XP_010432764.1|  PREDICTED: cytochrome P450 86B1-like               136   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like               136   3e-34   Sesamum indicum [beniseed]
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g             136   3e-34   
ref|XP_008440139.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    136   3e-34   
ref|XP_010437945.1|  PREDICTED: cytochrome P450 86B1-like               136   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006301857.1|  hypothetical protein CARUB_v10022327mg             136   4e-34   Capsella rubella
emb|CDY39926.1|  BnaA09g15080D                                          136   4e-34   Brassica napus [oilseed rape]
ref|XP_009113345.1|  PREDICTED: cytochrome P450 86B1-like               136   5e-34   Brassica rapa
gb|KDP35257.1|  hypothetical protein JCGZ_09416                         136   5e-34   Jatropha curcas
ref|XP_010429268.1|  PREDICTED: cytochrome P450 86B1-like               135   5e-34   
ref|XP_010414809.1|  PREDICTED: cytochrome P450 86B1-like               135   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006283561.1|  hypothetical protein CARUB_v10004619mg             135   6e-34   
ref|NP_194944.1|  cytochrome P450, family 96, subfamily A, polype...    135   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101867.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    135   7e-34   Brassica rapa
ref|NP_176713.1|  cytochrome P450, family 96, subfamily A, polype...    135   7e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43173.1|  hypothetical protein AALP_AA1G089200                    137   8e-34   Arabis alpina [alpine rockcress]
ref|XP_011025593.1|  PREDICTED: cytochrome P450 86B1-like               135   8e-34   Populus euphratica
ref|XP_006651021.1|  PREDICTED: cytochrome P450 86B1-like               135   8e-34   Oryza brachyantha
gb|KFK40984.1|  hypothetical protein AALP_AA2G070000                    135   8e-34   Arabis alpina [alpine rockcress]
ref|XP_006283573.1|  hypothetical protein CARUB_v10004625mg             135   9e-34   Capsella rubella
ref|NP_001117509.1|  alkane hydroxylase CYP96A15                        134   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like               135   1e-33   Glycine max [soybeans]
gb|KDP35254.1|  hypothetical protein JCGZ_09413                         135   1e-33   Jatropha curcas
gb|KHN27469.1|  Cytochrome P450 86B1                                    134   1e-33   Glycine soja [wild soybean]
ref|XP_002869292.1|  CYP96A2                                            135   1e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_006392374.1|  hypothetical protein EUTSA_v10023421mg             134   1e-33   Eutrema salsugineum [saltwater cress]
ref|XP_009132532.1|  PREDICTED: cytochrome P450 86B1                    134   1e-33   Brassica rapa
ref|NP_176086.1|  alkane hydroxylase CYP96A15                           134   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322211.1|  hypothetical protein POPTR_0015s09840g             134   2e-33   Populus trichocarpa [western balsam poplar]
emb|CDP18605.1|  unnamed protein product                                134   2e-33   Coffea canephora [robusta coffee]
gb|EEC74485.1|  hypothetical protein OsI_09945                          134   3e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like               134   3e-33   Setaria italica
ref|XP_010911437.1|  PREDICTED: cytochrome P450 86B1-like               134   3e-33   Elaeis guineensis
ref|XP_006405350.1|  hypothetical protein EUTSA_v10027722mg             134   3e-33   Eutrema salsugineum [saltwater cress]
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like               133   4e-33   Glycine max [soybeans]
emb|CDY58383.1|  BnaC09g51620D                                          133   4e-33   Brassica napus [oilseed rape]
ref|XP_006294031.1|  hypothetical protein CARUB_v10023023mg             133   4e-33   Capsella rubella
gb|KFK30522.1|  hypothetical protein AALP_AA7G273500                    133   4e-33   Arabis alpina [alpine rockcress]
gb|KHN27468.1|  Cytochrome P450 86B1                                    133   5e-33   Glycine soja [wild soybean]
ref|NP_175193.1|  cytochrome P450, family 96, subfamily A, polype...    133   5e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KHN19680.1|  Cytochrome P450 86B1                                    133   6e-33   Glycine soja [wild soybean]
ref|XP_009783405.1|  PREDICTED: cytochrome P450 86B1-like               133   6e-33   Nicotiana sylvestris
emb|CDY42628.1|  BnaC01g00400D                                          133   6e-33   Brassica napus [oilseed rape]
ref|XP_009123569.1|  PREDICTED: cytochrome P450 86B1-like               132   7e-33   Brassica rapa
ref|XP_003555023.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    132   8e-33   Glycine max [soybeans]
ref|XP_006604019.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    132   8e-33   
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg                132   9e-33   Erythranthe guttata [common monkey flower]
ref|XP_009773631.1|  PREDICTED: cytochrome P450 86B1-like               132   9e-33   Nicotiana sylvestris
emb|CDX84084.1|  BnaC08g07610D                                          130   1e-32   
ref|XP_002894690.1|  hypothetical protein ARALYDRAFT_474859             132   1e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_010447431.1|  PREDICTED: cytochrome P450 86B1                    132   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002894062.1|  CYP96A8                                            132   1e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_010554710.1|  PREDICTED: cytochrome P450 86B1-like               132   1e-32   
ref|XP_007150923.1|  hypothetical protein PHAVU_004G006000g             132   1e-32   Phaseolus vulgaris [French bean]
ref|XP_010274128.1|  PREDICTED: cytochrome P450 86B1-like               132   1e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006392376.1|  hypothetical protein EUTSA_v10023422mg             132   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_006643842.1|  PREDICTED: cytochrome P450 86B1-like               131   2e-32   Oryza brachyantha
dbj|BAA99522.1|  putative cytochrome P450                               131   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006282055.1|  hypothetical protein CARUB_v10028299mg             131   2e-32   Capsella rubella
gb|KEH22137.1|  cytochrome P450 family protein                          131   2e-32   Medicago truncatula
ref|XP_009400927.1|  PREDICTED: cytochrome P450 86B1-like               132   2e-32   
ref|XP_004968445.1|  PREDICTED: cytochrome P450 86B1-like               131   2e-32   Setaria italica
ref|XP_010681237.1|  PREDICTED: cytochrome P450 86B1-like               127   2e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB44331.1|  hypothetical protein B456_007G246400                    131   2e-32   Gossypium raimondii
emb|CDY39035.1|  BnaA02g17240D                                          131   2e-32   Brassica napus [oilseed rape]
ref|XP_009128105.1|  PREDICTED: cytochrome P450 86B1-like               131   2e-32   Brassica rapa
ref|XP_007150926.1|  hypothetical protein PHAVU_004G006300g             131   2e-32   Phaseolus vulgaris [French bean]
ref|XP_010680859.1|  PREDICTED: cytochrome P450 86B1-like               131   2e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH22136.1|  cytochrome P450 family protein                          131   3e-32   Medicago truncatula
gb|EMT14219.1|  Cytochrome P450 86A2                                    131   3e-32   
ref|XP_011005604.1|  PREDICTED: cytochrome P450 86B1-like               130   3e-32   Populus euphratica
ref|XP_003564427.1|  PREDICTED: cytochrome P450 86B1-like               130   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_010555325.1|  PREDICTED: cytochrome P450 86B1-like               130   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_006411750.1|  hypothetical protein EUTSA_v10024958mg             130   4e-32   Eutrema salsugineum [saltwater cress]
ref|XP_011100086.1|  PREDICTED: cytochrome P450 86B1-like               130   4e-32   Sesamum indicum [beniseed]
ref|XP_002457225.1|  hypothetical protein SORBIDRAFT_03g003600          130   4e-32   Sorghum bicolor [broomcorn]
gb|EEE54005.1|  hypothetical protein OsJ_00650                          130   4e-32   Oryza sativa Japonica Group [Japonica rice]
gb|ABF93891.1|  Cytochrome P450 family protein                          130   4e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002866852.1|  CYP96A9                                            130   4e-32   Arabidopsis lyrata subsp. lyrata
gb|EAZ25521.1|  hypothetical protein OsJ_09345                          130   4e-32   Oryza sativa Japonica Group [Japonica rice]
gb|KFK22353.1|  hypothetical protein AALP_AAs42226U000100               130   5e-32   Arabis alpina [alpine rockcress]
ref|XP_006285226.1|  hypothetical protein CARUB_v10006585mg             130   5e-32   Capsella rubella
emb|CDP12889.1|  unnamed protein product                                130   5e-32   
ref|XP_004151610.1|  PREDICTED: cytochrome P450 86B1-like               130   5e-32   
ref|NP_001042228.1|  Os01g0183600                                       130   7e-32   
ref|XP_003558845.1|  PREDICTED: cytochrome P450 86B1-like               130   7e-32   
ref|NP_200045.1|  cytochrome P450, family 96, subfamily A, polype...    129   7e-32   
dbj|BAC42841.1|  putative cytochrome P450                               129   8e-32   
gb|EAY72807.1|  hypothetical protein OsI_00673                          129   8e-32   
ref|XP_010446498.1|  PREDICTED: cytochrome P450 86B1-like               129   8e-32   
ref|XP_010479164.1|  PREDICTED: cytochrome P450 86B1                    129   8e-32   
gb|EMS62655.1|  Cytochrome P450 86B1                                    130   9e-32   
ref|XP_010431923.1|  PREDICTED: cytochrome P450 86B1-like               129   9e-32   
emb|CDY39931.1|  BnaA09g15130D                                          129   9e-32   
ref|XP_004142038.1|  PREDICTED: cytochrome P450 86B1-like               129   1e-31   
ref|XP_004157875.1|  PREDICTED: cytochrome P450 86B1-like               129   1e-31   
emb|CDY39928.1|  BnaA09g15100D                                          129   1e-31   
ref|XP_009400643.1|  PREDICTED: cytochrome P450 86B1-like               129   1e-31   
ref|XP_004160507.1|  PREDICTED: cytochrome P450 86B1-like               129   1e-31   
ref|NP_195661.1|  cytochrome P450, family 96, subfamily A, polype...    129   1e-31   
ref|XP_010474420.1|  PREDICTED: cytochrome P450 86A4-like               127   2e-31   
ref|XP_010511350.1|  PREDICTED: cytochrome P450 86B1-like               129   2e-31   
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like               129   2e-31   
gb|AIE57505.1|  MAH1                                                    129   2e-31   
ref|NP_195658.3|  cytochrome P450, family 96, subfamily A, polype...    129   2e-31   
ref|XP_010520636.1|  PREDICTED: cytochrome P450 86B1-like               129   2e-31   
ref|XP_009381852.1|  PREDICTED: cytochrome P450 86B1-like               129   2e-31   
ref|XP_010653011.1|  PREDICTED: cytochrome P450 86B1-like               128   2e-31   
ref|XP_010470317.1|  PREDICTED: cytochrome P450 86B1-like               128   2e-31   
gb|AGV40485.1|  hypothetical protein                                    129   3e-31   
ref|XP_010511352.1|  PREDICTED: cytochrome P450 86B1-like               128   3e-31   
ref|XP_007134108.1|  hypothetical protein PHAVU_010G019500g             128   3e-31   
ref|XP_010446497.1|  PREDICTED: cytochrome P450 86B1-like               128   3e-31   
pir||C96517  hypothetical protein F16N3.7 [imported] - Arabidopsi...    128   4e-31
gb|KEH41380.1|  cytochrome P450 family protein                          127   4e-31   
ref|XP_002894061.1|  CYP96A8                                            127   4e-31   
emb|CDY53178.1|  BnaA06g40570D                                          127   4e-31   
ref|XP_008650864.1|  PREDICTED: cytochrome P450 86B1-like               127   5e-31   
gb|KDP46408.1|  hypothetical protein JCGZ_10248                         127   5e-31   
gb|KDP35251.1|  hypothetical protein JCGZ_09410                         127   5e-31   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like               127   6e-31   
emb|CBI33551.3|  unnamed protein product                                127   6e-31   
gb|KJB33823.1|  hypothetical protein B456_006G032600                    127   7e-31   
dbj|BAK07250.1|  predicted protein                                      127   7e-31   
ref|NP_001048908.1|  Os03g0138200                                       127   8e-31   
gb|EAZ25511.1|  hypothetical protein OsJ_09335                          127   8e-31   
emb|CDX72693.1|  BnaC07g47150D                                          126   8e-31   
ref|XP_010660343.1|  PREDICTED: cytochrome P450 86B1                    126   9e-31   
ref|XP_002526301.1|  heme binding protein, putative                     126   1e-30   
gb|EAY88464.1|  hypothetical protein OsI_09931                          126   1e-30   
ref|XP_009605621.1|  PREDICTED: cytochrome P450 86B1                    120   1e-30   
ref|XP_004985762.1|  PREDICTED: cytochrome P450 86B1-like               126   2e-30   
ref|XP_006279822.1|  hypothetical protein CARUB_v10028124mg             126   2e-30   
gb|EMS66236.1|  Cytochrome P450 86B1                                    125   2e-30   
ref|XP_002521476.1|  cytochrome P450, putative                          125   2e-30   
ref|XP_010437072.1|  PREDICTED: cytochrome P450 86B1-like               125   2e-30   
ref|XP_010436206.1|  PREDICTED: cytochrome P450 86B1-like               124   2e-30   
dbj|BAJ86572.1|  predicted protein                                      125   2e-30   
ref|XP_009113349.1|  PREDICTED: cytochrome P450 86B1-like               125   2e-30   
gb|KDP35256.1|  hypothetical protein JCGZ_09415                         121   2e-30   
emb|CDY68678.1|  BnaCnng60030D                                          125   2e-30   
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g             125   2e-30   
ref|XP_006301804.1|  hypothetical protein CARUB_v10022270mg             125   2e-30   
ref|XP_011025646.1|  PREDICTED: cytochrome P450 86B1-like               125   2e-30   
ref|NP_195660.1|  cytochrome P450, family 96, subfamily A, polype...    125   3e-30   
ref|NP_195910.1|  cytochrome P450, family 96, subfamily A, polype...    125   3e-30   
ref|XP_010246220.1|  PREDICTED: cytochrome P450 86B1-like               125   4e-30   
ref|XP_007134109.1|  hypothetical protein PHAVU_010G019600g             125   4e-30   
gb|KJB33822.1|  hypothetical protein B456_006G032500                    124   4e-30   
ref|XP_006287519.1|  hypothetical protein CARUB_v10000726mg             125   4e-30   
emb|CBH32607.1|  cytochrome P450, putative, expressed                   124   5e-30   
gb|KDP35252.1|  hypothetical protein JCGZ_09411                         124   6e-30   
ref|XP_006649370.1|  PREDICTED: cytochrome P450 86B1-like               124   6e-30   
gb|EAY88476.1|  hypothetical protein OsI_09947                          124   6e-30   
gb|KEH40839.1|  cytochrome P450 family protein                          124   7e-30   
ref|NP_001048917.1|  Os03g0140100                                       124   8e-30   
gb|KHN45347.1|  Cytochrome P450 86B1                                    123   1e-29   
ref|XP_009790818.1|  PREDICTED: cytochrome P450 86B1-like               124   1e-29   
ref|XP_002865907.1|  CYP96A4                                            124   1e-29   
gb|EPS57870.1|  hypothetical protein M569_16947                         124   1e-29   
gb|KFK38027.1|  hypothetical protein AALP_AA3G060700                    123   1e-29   
gb|EPS72790.1|  hypothetical protein M569_01963                         123   1e-29   
ref|XP_006392373.1|  hypothetical protein EUTSA_v10023421mg             123   1e-29   
gb|EPS67771.1|  hypothetical protein M569_06997                         123   2e-29   
ref|XP_002868909.1|  CYP96A12                                           123   2e-29   
gb|KEH40821.1|  cytochrome P450 family protein                          123   2e-29   
ref|XP_009134418.1|  PREDICTED: cytochrome P450 86B1-like               123   2e-29   
ref|XP_002870817.1|  hypothetical protein ARALYDRAFT_916433             123   2e-29   
ref|XP_006301880.1|  hypothetical protein CARUB_v10022359mg             122   2e-29   
ref|XP_009113346.1|  PREDICTED: cytochrome P450 86B1-like               122   2e-29   
dbj|BAK03685.1|  predicted protein                                      122   3e-29   
ref|XP_002465888.1|  hypothetical protein SORBIDRAFT_01g047630          122   3e-29   
ref|XP_010242506.1|  PREDICTED: cytochrome P450 86B1-like               122   3e-29   
ref|XP_007134103.1|  hypothetical protein PHAVU_010G019100g             122   3e-29   
ref|XP_010109842.1|  Cytochrome P450                                    117   3e-29   
ref|XP_004515481.1|  PREDICTED: cytochrome P450 86B1-like               122   4e-29   
ref|XP_007019556.1|  Cytochrome P450                                    122   4e-29   
ref|XP_004237152.1|  PREDICTED: cytochrome P450 86B1-like               122   4e-29   
ref|XP_004142036.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    122   4e-29   
ref|XP_010482588.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    122   4e-29   
ref|XP_010482590.1|  PREDICTED: cytochrome P450 86B1-like isoform X3    122   4e-29   
ref|XP_010442757.1|  PREDICTED: cytochrome P450 86B1-like               122   5e-29   
gb|KGN48435.1|  hypothetical protein Csa_6G487560                       122   5e-29   
ref|XP_004166589.1|  PREDICTED: cytochrome P450 86B1-like               122   5e-29   
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g             121   6e-29   
ref|XP_004515489.1|  PREDICTED: cytochrome P450 86B1-like               122   6e-29   
ref|XP_007042364.1|  Cytochrome P450-like protein                       121   8e-29   
gb|KFK33109.1|  hypothetical protein AALP_AA6G332200                    120   9e-29   
ref|XP_010501864.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    115   1e-28   
gb|EMT29524.1|  Cytochrome P450 86A2                                    120   1e-28   
ref|XP_009101869.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    120   2e-28   
ref|XP_006300436.1|  hypothetical protein CARUB_v10020100mg             120   2e-28   
ref|XP_009109464.1|  PREDICTED: cytochrome P450 86B1-like               120   2e-28   
ref|XP_006397210.1|  hypothetical protein EUTSA_v10029295mg             119   3e-28   
ref|XP_008440140.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    119   3e-28   
gb|EMT13313.1|  Cytochrome P450 86A1                                    120   3e-28   
ref|XP_004489211.1|  PREDICTED: cytochrome P450 86B1-like               119   3e-28   
ref|NP_176558.1|  cytochrome P450, family 86, subfamily A, polype...    119   4e-28   
gb|KDP46409.1|  hypothetical protein JCGZ_10249                         119   4e-28   
gb|AAM65207.1|  putative cytochrome P450                                119   4e-28   
ref|XP_010444711.1|  PREDICTED: cytochrome P450 86B1-like               119   5e-28   
gb|EAY77762.1|  hypothetical protein OsI_32799                          120   5e-28   
gb|EEE68351.1|  hypothetical protein OsJ_26654                          119   5e-28   
gb|EMT07503.1|  Cytochrome P450 86A2                                    119   5e-28   
ref|XP_002862576.1|  hypothetical protein ARALYDRAFT_920522             119   6e-28   
ref|XP_009113348.1|  PREDICTED: cytochrome P450 86B1-like               119   6e-28   
ref|XP_002886391.1|  predicted protein                                  119   6e-28   
emb|CDM81753.1|  unnamed protein product                                119   6e-28   
ref|NP_001061394.1|  Os08g0262500                                       119   6e-28   
ref|XP_004142039.1|  PREDICTED: cytochrome P450 86B1-like               118   6e-28   
gb|KEH24777.1|  cytochrome P450 family protein                          119   6e-28   
emb|CDY29175.1|  BnaC09g15720D                                          118   7e-28   
ref|XP_010274134.1|  PREDICTED: cytochrome P450 86B1-like               119   8e-28   
emb|CDX90336.1|  BnaA08g16480D                                          118   8e-28   
ref|XP_003629932.1|  Cytochrome P450                                    118   8e-28   
emb|CDM81752.1|  unnamed protein product                                118   9e-28   
ref|XP_010473620.1|  PREDICTED: cytochrome P450 86A7-like               118   1e-27   
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...    118   1e-27   
ref|XP_006391721.1|  hypothetical protein EUTSA_v10023410mg             118   1e-27   
emb|CDY66735.1|  BnaC03g60620D                                          118   1e-27   
ref|XP_009109465.1|  PREDICTED: cytochrome P450 86B1-like               118   1e-27   
emb|CAN68037.1|  hypothetical protein VITISV_011827                     119   1e-27   
gb|KFK22185.1|  hypothetical protein AALP_AAs38949U000100               120   1e-27   
gb|KEH40842.1|  cytochrome P450 family protein                          118   1e-27   
ref|XP_004515488.1|  PREDICTED: cytochrome P450 86B1-like               117   1e-27   
ref|NP_001061395.1|  Os08g0263000                                       117   1e-27   
ref|XP_010430476.1|  PREDICTED: cytochrome P450 86A7                    118   2e-27   
ref|XP_002322212.1|  hypothetical protein POPTR_0015s09850g             117   2e-27   
gb|EAZ42091.1|  hypothetical protein OsJ_26652                          117   2e-27   
ref|XP_010418406.1|  PREDICTED: cytochrome P450 86A7-like               117   2e-27   
ref|XP_002312417.2|  cytochrome P450 family protein                     117   3e-27   
gb|KEH40818.1|  cytochrome P450 family protein                          117   3e-27   
ref|XP_006280314.1|  hypothetical protein CARUB_v10026237mg             117   3e-27   
ref|XP_010527154.1|  PREDICTED: cytochrome P450 86B1-like               116   4e-27   
ref|XP_004985761.1|  PREDICTED: cytochrome P450 86B1-like               116   4e-27   
ref|XP_004489209.1|  PREDICTED: cytochrome P450 86B1-like               116   4e-27   
ref|XP_010418988.1|  PREDICTED: cytochrome P450 86B1-like               116   5e-27   
emb|CDY39934.1|  BnaA09g15160D                                          115   5e-27   
gb|AAS58486.1|  phytochrome P450-like protein                           116   6e-27   
gb|AFW89633.1|  putative cytochrome P450 superfamily protein            116   7e-27   
ref|XP_010510801.1|  PREDICTED: cytochrome P450 86B1-like               115   8e-27   
ref|XP_006412935.1|  hypothetical protein EUTSA_v10027133mg             115   1e-26   
gb|AJD25224.1|  cytochrome P450 CYP96A84                                115   1e-26   
ref|XP_003568803.1|  PREDICTED: cytochrome P450 86B1-like               115   1e-26   
ref|XP_008441106.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    115   1e-26   
gb|KDP46411.1|  hypothetical protein JCGZ_10251                         114   2e-26   
ref|XP_010452806.1|  PREDICTED: cytochrome P450 86B1 isoform X2         114   2e-26   
ref|XP_010263872.1|  PREDICTED: cytochrome P450 86A7                    110   2e-26   
ref|XP_010491450.1|  PREDICTED: cytochrome P450 86B1-like               115   2e-26   
emb|CDX90337.1|  BnaA08g16470D                                          114   2e-26   
ref|XP_004960856.1|  PREDICTED: cytochrome P450 86B1-like               114   2e-26   
gb|KEH40835.1|  cytochrome P450 family protein                          114   2e-26   
ref|XP_011022663.1|  PREDICTED: cytochrome P450 86B1-like               114   3e-26   
ref|XP_010513571.1|  PREDICTED: cytochrome P450 86B1-like               114   3e-26   
ref|XP_004489210.1|  PREDICTED: cytochrome P450 86B1-like               114   3e-26   
gb|KEH40805.1|  cytochrome P450 family protein                          114   3e-26   
gb|EMS35652.1|  Cytochrome P450 86B1                                    114   3e-26   
ref|XP_010452805.1|  PREDICTED: cytochrome P450 86B1 isoform X1         114   4e-26   
ref|XP_010676593.1|  PREDICTED: cytochrome P450 86B1-like               114   4e-26   
ref|XP_010270986.1|  PREDICTED: cytochrome P450 86B1-like               114   4e-26   
gb|KJB75060.1|  hypothetical protein B456_012G021500                    113   5e-26   
ref|XP_006290052.1|  hypothetical protein CARUB_v10003687mg             114   5e-26   
ref|XP_009139809.1|  PREDICTED: cytochrome P450 86B1-like               113   6e-26   
ref|XP_003556827.2|  PREDICTED: cytochrome P450 86B1-like               113   6e-26   
ref|XP_002523775.1|  cytochrome P450, putative                          114   6e-26   
ref|XP_010270999.1|  PREDICTED: cytochrome P450 86B1-like               113   7e-26   
emb|CAB41474.1|  cytochrome P450                                        113   7e-26   
emb|CDY20374.1|  BnaC02g24420D                                          111   7e-26   
dbj|BAJ87689.1|  predicted protein                                      113   7e-26   
ref|XP_010533650.1|  PREDICTED: cytochrome P450 86A7                    113   8e-26   
gb|KGN58549.1|  hypothetical protein Csa_3G681140                       112   9e-26   
dbj|BAK06179.1|  predicted protein                                      113   9e-26   
ref|XP_002465889.1|  hypothetical protein SORBIDRAFT_01g047640          113   1e-25   
gb|KEH40811.1|  cytochrome P450 family protein                          112   1e-25   
gb|KFK25188.1|  hypothetical protein AALP_AA8G078400                    113   1e-25   
ref|XP_010522165.1|  PREDICTED: cytochrome P450 86B1-like               113   1e-25   
emb|CDY40805.1|  BnaC02g41740D                                          112   1e-25   
ref|XP_010444065.1|  PREDICTED: cytochrome P450 86B1-like               112   1e-25   
ref|XP_006476545.1|  PREDICTED: cytochrome P450 86A8-like               112   1e-25   
gb|EMT27434.1|  Cytochrome P450 86A2                                    112   1e-25   
ref|XP_006659953.1|  PREDICTED: cytochrome P450 86B1-like               112   1e-25   
gb|AIU99467.1|  P450                                                    112   2e-25   
ref|XP_009109462.1|  PREDICTED: cytochrome P450 86B1-like               112   2e-25   
emb|CDX79038.1|  BnaA01g11050D                                          111   2e-25   
ref|XP_009400252.1|  PREDICTED: cytochrome P450 86A2-like               112   2e-25   
ref|XP_010423121.1|  PREDICTED: cytochrome P450 86B1-like               112   2e-25   
ref|XP_010482535.1|  PREDICTED: cytochrome P450 86B1-like               112   2e-25   
gb|KJB47429.1|  hypothetical protein B456_008G026100                    112   2e-25   
ref|XP_006643843.1|  PREDICTED: cytochrome P450 86B1-like               112   2e-25   
ref|XP_009130123.1|  PREDICTED: cytochrome P450 86B1-like               112   2e-25   
gb|KJB75063.1|  hypothetical protein B456_012G021700                    111   2e-25   
gb|KDO76250.1|  hypothetical protein CISIN_1g037522mg                   112   2e-25   
ref|XP_006439526.1|  hypothetical protein CICLE_v10019616mg             112   2e-25   
ref|XP_010242505.1|  PREDICTED: cytochrome P450 86B1-like               112   2e-25   
ref|XP_006399311.1|  hypothetical protein EUTSA_v10013132mg             112   3e-25   
gb|AFW68533.1|  putative cytochrome P450 superfamily protein            112   3e-25   
ref|XP_010933285.1|  PREDICTED: cytochrome P450 86B1-like               112   3e-25   
emb|CDY46948.1|  BnaA02g32980D                                          112   3e-25   
gb|AJD25208.1|  cytochrome P450 CYP86A92                                111   3e-25   
gb|KJB47427.1|  hypothetical protein B456_008G025900                    111   3e-25   
ref|XP_009109987.1|  PREDICTED: cytochrome P450 86B1-like               109   3e-25   
ref|NP_196442.2|  cytochrome P450 superfamily protein                   111   4e-25   
ref|XP_008461842.1|  PREDICTED: cytochrome P450 86B1-like               111   4e-25   



>dbj|BAF46296.1| cytochrome P450 [Ipomoea nil]
Length=525

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F+I   LGC+  +K++  SS    +PR W +VGM+P LL NAHR+H+F TD+LK SGGTF
Sbjct  14   FIIVLSLGCYMILKLRCRSSDDKVVPRNWPLVGMMPALLKNAHRVHEFATDVLKHSGGTF  73

Query  280  EFKGPV-LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  456
            EFKGP    NL ML T DPANIHH+LS+NFSNYPKGP+FR+IFD+LGDGIFNVDSQLWE 
Sbjct  74   EFKGPAAFANLSMLATSDPANIHHVLSKNFSNYPKGPEFRKIFDILGDGIFNVDSQLWEL  133

Query  457  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            HRKTTLSF NHA F+TLL+TNVWHKV+ GLLP+LD FAE
Sbjct  134  HRKTTLSFLNHAQFYTLLQTNVWHKVEKGLLPVLDWFAE  172



>emb|CDP22261.1| unnamed protein product, partial [Coffea canephora]
Length=217

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            +F F+  FCY          S++P  W V+GM+PGL+ N+HRL ++ T+ILKESGGTFE 
Sbjct  15   LFCFIFLFCYYYSFSRRWRNSSLPTNWPVIGMMPGLVRNSHRLQEYGTEILKESGGTFEA  74

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
             GP   N+ M++TCDPANIH+ILS+NFSNYPKGP+FR+IFD+LGDGIFN DSQLWE HR+
Sbjct  75   NGPWFANMHMVLTCDPANIHYILSKNFSNYPKGPEFRKIFDILGDGIFNADSQLWETHRR  134

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             TLS  +H  F  LLE  VW KV+ GLLP+L + A+
Sbjct  135  VTLSLMHHPSFLKLLEVTVWDKVEKGLLPVLQNCAK  170



>gb|EYU27552.1| hypothetical protein MIMGU_mgv1a004751mg [Erythranthe guttata]
Length=511

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 122/156 (78%), Gaps = 2/156 (1%)
 Frame = +1

Query  106  IFSFL--GCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            IF FL      ++  + ++  ++++P  W +VGMLPG+L N+HR+H + TDIL ESGGTF
Sbjct  9    IFLFLLPAMILFLVWRTKTQKKTSLPTNWPLVGMLPGILQNSHRIHDYATDILSESGGTF  68

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
            +FK P + N+DML+TCDPANIHHI SRNFSNYPKGP+FR+IF++LGDGIFN D +LWE H
Sbjct  69   QFKFPGVFNMDMLVTCDPANIHHIFSRNFSNYPKGPEFRKIFEILGDGIFNADFELWELH  128

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSF  567
            R+TTL+F NH  F++LLE++VW KV  GLLP+LD  
Sbjct  129  RRTTLAFLNHTKFYSLLESSVWGKVGTGLLPVLDDL  164



>ref|XP_006351379.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=501

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = +1

Query  124  CFCYMKMKMESS---SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            CF Y      S+     S++P  W +VGMLPGL+ NAHR+H+FVTD L E+ GTFEF GP
Sbjct  2    CFTYSTWWYLSNRWWKSSSVPTNWPLVGMLPGLIRNAHRVHEFVTDALIETKGTFEFHGP  61

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
            VL NL+ML+T DPANIHHILS+NFSNYPKG +FR+IFD+LG+G+FNVD +LWE HRKTT+
Sbjct  62   VLANLNMLLTSDPANIHHILSKNFSNYPKGVEFRKIFDMLGNGMFNVDYELWEMHRKTTM  121

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            S  NHA F TLLE N+W  ++NGL P+LD FAE
Sbjct  122  SLMNHAKFQTLLERNMWSIIENGLQPVLDGFAE  154



>ref|XP_004249316.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=513

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 119/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            ++I   + CF Y  +K    ++S+ P  W + GMLPGL++NAHR+H F TDIL E+   F
Sbjct  10   YVIPLIILCFTYWNLK-NKWAKSSKPTNWPIFGMLPGLVHNAHRIHSFFTDILLETTSNF  68

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
            EF+GP+  N+DML T DPANIHHILSRNFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE H
Sbjct  69   EFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSELWEIH  128

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RKTT+S  NH+ F TLL+ NVW  +  G++P LD  A+
Sbjct  129  RKTTMSLMNHSKFQTLLQRNVWDTIDKGIVPTLDILAK  166



>ref|XP_009623637.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=511

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            +   LG   +    +   S+S+ P  W + GMLPGL+ NAHR+H+F TDIL E+G  FEF
Sbjct  9    VLIILGFTYFTWFLINRRSKSSAPTDWPLAGMLPGLIQNAHRIHEFFTDILLETGNNFEF  68

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            +GPV+ N++ML T DPANIHHILSRNFSNYPKGP+FR+IF++LG+GIFNVDS+LWE HRK
Sbjct  69   RGPVISNMNMLFTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRK  128

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             T+S  +HA F  LL+ NVW  V+ GL+P+LD+FAE
Sbjct  129  ITMSLMSHAKFQILLKKNVWDTVEKGLVPVLDAFAE  164



>ref|XP_009759324.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=509

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            +   LG   +  + +   S+++ P  W +VGMLPGL+ NAHR+H F TDIL E+G  FEF
Sbjct  9    VLIILGFTYFTWLFINRRSKTSEPTNWPLVGMLPGLIQNAHRIHDFFTDILLETGNNFEF  68

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
             GP LGN++ML T DPANIHHILSRNFSNYPKGP+FR+IF++LG+GIFNVDS+LWE HRK
Sbjct  69   YGPALGNMNMLFTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRK  128

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             T+S  +HA F  LL+ NVW+ V+ GL+P+LD+FAE
Sbjct  129  ITMSLMSHAKFQILLKKNVWNTVEKGLVPVLDAFAE  164



>ref|XP_011095704.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=503

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +1

Query  109  FSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFK  288
            F+F+       ++  S  +S+ P  W ++GMLP LL  + R+H   T ++ ESGGTFEFK
Sbjct  12   FTFIVILLPAVLRSRSWRKSSGPTNWPLLGMLPWLLRISRRIHSSATQLMNESGGTFEFK  71

Query  289  GPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKT  468
            GP   N+DMLITCDPANIHHI SRNFSNYPKGP+FR+IFDVLGDGIFN D +LWE HR+T
Sbjct  72   GPWFCNMDMLITCDPANIHHIFSRNFSNYPKGPEFRKIFDVLGDGIFNADFELWELHRRT  131

Query  469  TLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            TLSFF+HA FHTLL   VW KV+  LLP+LDSF E
Sbjct  132  TLSFFSHARFHTLLGRAVWGKVETALLPVLDSFLE  166



>ref|XP_009603547.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=512

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  342
            +S+ P  W + GMLPGL+ NAHR+H F T IL E+GGTFEF GPVL NL+ML+T DPANI
Sbjct  31   KSSTPTNWPLFGMLPGLIRNAHRIHDFATSILMETGGTFEFYGPVLTNLNMLVTSDPANI  90

Query  343  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNV  522
            HHILS+NFSNYPKG +F++IFD+LG+GIFNVDS+LWE HRKTT+S  +HA F TLLE N+
Sbjct  91   HHILSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRKTTMSLMSHAKFQTLLERNM  150

Query  523  WHKVQNGLLPLLDSFAE  573
            W  ++ GL P+LD+FAE
Sbjct  151  WDTIEKGLRPILDTFAE  167



>ref|XP_006351377.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=524

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = +1

Query  124  CFCYMKMKMESS---SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            CF Y      S+     S++P  W +VGMLPGL+ NAHR+H+F TDIL E+ GTF+F GP
Sbjct  16   CFTYSTWWYLSNRWWKSSSVPTNWPLVGMLPGLIQNAHRVHEFATDILVETKGTFKFHGP  75

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
            VL NL+MLIT DPANIH+ILS+NFSNYPKG +FR+IFD+LG+G+FNVD +LWE HRKTT+
Sbjct  76   VLANLNMLITSDPANIHYILSKNFSNYPKGVEFRKIFDILGNGMFNVDYELWEMHRKTTM  135

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            S  NHA F TLLE N+W+ ++N L P+LD+FAE
Sbjct  136  SLMNHAKFQTLLERNMWNIIENRLRPILDAFAE  168



>ref|XP_009589080.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = +1

Query  130  CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNL  309
            CY++ +    ++++ P  W  VGMLP ++ N HR+H ++T +L E+GGTFEFKGP+   +
Sbjct  22   CYLRNRW---TKTSAPTYWPFVGMLPAIILNFHRIHDYITKVLIETGGTFEFKGPIFAYM  78

Query  310  DMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNH  489
            DMLITCDPANIHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE HRKTT+S  +H
Sbjct  79   DMLITCDPANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDSELWELHRKTTMSIMSH  138

Query  490  AHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            A F TLLE N+W+ ++    P+LD+FAE
Sbjct  139  AKFQTLLERNMWNIIEKRFRPILDAFAE  166



>ref|XP_004249313.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=515

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = +1

Query  124  CFCYMKMKMESS---SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            CF Y      S+     S+ P  W +VGMLPGL+ N HR+H+FVTD L ES GTFEF GP
Sbjct  16   CFTYSTRWYLSNIWWKSSSAPTNWPLVGMLPGLIQNTHRVHEFVTDALVESKGTFEFHGP  75

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
            VL NL+ML+T DPANIHHILS+NFSNYPKG +FR+IFD++G+GIFNVD +LWE HRKTT+
Sbjct  76   VLANLNMLLTSDPANIHHILSKNFSNYPKGVEFRKIFDMIGNGIFNVDYELWEMHRKTTM  135

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            S  NH  F T+LE N+W  ++NGL P+LD FAE
Sbjct  136  SLMNHPKFQTMLERNMWSIIENGLWPILDGFAE  168



>ref|XP_006339337.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=510

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            ++I   + C  Y  +K    ++++ P  W ++GMLPG ++NAHR+H F TD+L E+   F
Sbjct  7    YVIPLIILCLTYWYLK-NKWTKTSKPIDWPIIGMLPGFVHNAHRIHSFFTDLLLETSSNF  65

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
            EF+GP+  N+DML T DPANIHHILSRNFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE H
Sbjct  66   EFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSELWEIH  125

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RKTT+   NHA F TLL+ NVW  +  G++P LD FA+
Sbjct  126  RKTTMYLMNHAKFQTLLQRNVWDTIDKGIVPTLDIFAK  163



>ref|XP_006351378.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=517

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = +1

Query  124  CFCYMKMKMESS---SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            CF Y      S+     S++P  W +VGMLPGL+ N HR+H+F TD+L E+ GTFEF GP
Sbjct  16   CFTYSTWWYLSNRWWKSSSVPTNWPLVGMLPGLIRNVHRVHEFATDVLVETKGTFEFHGP  75

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
            VL NL+ML T DPANIHHILS+NFSNYPKG +FR+ FD+LG+GIFNVD +LWE HRKTT+
Sbjct  76   VLANLNMLATSDPANIHHILSKNFSNYPKGVEFRKFFDILGNGIFNVDYELWEIHRKTTM  135

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            S  +HA F T LE N+W  ++NGL P+LD+FAE
Sbjct  136  SLMSHAKFQTFLERNLWDIIENGLRPILDTFAE  168



>ref|XP_009802093.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=519

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  342
            +S++P  W +VGMLPGL+ NAHR+H F T IL E+GGTFEF GPVL N +ML T DPANI
Sbjct  31   KSSVPTNWPLVGMLPGLIRNAHRVHDFATSILVETGGTFEFYGPVLTNSNMLATSDPANI  90

Query  343  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNV  522
            HH+LS+NFSNYPKG +F++IFD+LG+GIFNVDS+LWE HRKTT+S  +HA F TLLE N+
Sbjct  91   HHVLSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRKTTMSLMSHAKFQTLLERNM  150

Query  523  WHKVQNGLLPLLDSFAE  573
            W   + GL P+LD+FAE
Sbjct  151  WDTFEKGLQPILDTFAE  167



>ref|XP_009782181.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
            ++++ P  W  VGMLP ++ N H +H ++T +L E+GGTFEFKGP+  N+DMLITCDPAN
Sbjct  29   TKTSAPIYWPFVGMLPAIILNFHHIHDYITKVLTETGGTFEFKGPIFANMDMLITCDPAN  88

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            IHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE HRK T+S  +HA F TLLE N
Sbjct  89   IHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDSELWELHRKITMSIMSHAKFQTLLENN  148

Query  520  VWHKVQNGLLPLLDSFAE  573
            +W  +   L P+LD FAE
Sbjct  149  MWGIMDKRLRPILDVFAE  166



>gb|EYU32453.1| hypothetical protein MIMGU_mgv1a005630mg [Erythranthe guttata]
Length=476

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  345
            S+ P  W +VGMLP ++ N HR+H + T +L E GGTFEFKGP   ++DM++T DPANIH
Sbjct  35   SSKPTNWPLVGMLPAVVQNLHRIHDYATTVLTECGGTFEFKGPWFCHVDMVVTSDPANIH  94

Query  346  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  525
            HI SRNFSNYPKGP+FR++F++LGDGIFN D +LWE HR+TTLS   H  F   LE NVW
Sbjct  95   HIFSRNFSNYPKGPEFRKMFEILGDGIFNADFELWELHRRTTLSMLTHPEFPDFLEVNVW  154

Query  526  HKVQNGLLPLLDSFAE  573
            HKVQ GLLP+LD FAE
Sbjct  155  HKVQTGLLPVLDYFAE  170



>gb|EYU27551.1| hypothetical protein MIMGU_mgv1a027070mg [Erythranthe guttata]
Length=508

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +1

Query  145  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  324
            + ++ +++++P  W +VGMLP +L N HR+  + T+IL ESGGTF+ K P + N+DML+T
Sbjct  26   RTKTPAKTSLPTNWPLVGMLPAILQNCHRIQPYFTEILTESGGTFQLKFPRVFNMDMLLT  85

Query  325  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  504
              PANIHHI SRNFSNYPKGP+FR++F++LGDGIFN D +LWE HR+TTLSF NH+ F+ 
Sbjct  86   SHPANIHHIFSRNFSNYPKGPEFRKVFEILGDGIFNADFELWELHRRTTLSFLNHSEFYG  145

Query  505  LLETNVWHKVQNGLLPLLDSFAE  573
            LLE++VW KV+ GLLP+LD F+E
Sbjct  146  LLESSVWEKVETGLLPVLDDFSE  168



>gb|EPS60789.1| hypothetical protein M569_14012, partial [Genlisea aurea]
Length=489

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 108/153 (71%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            F+      K K      +A+P  W VVGM P  L N HR+H F+T++L E GGTFEFKGP
Sbjct  2    FIAFVILRKWKSSGKFATAVPTNWPVVGMWPAALRNCHRVHDFITEVLSECGGTFEFKGP  61

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
             L N+DML TCDPANIHH+ SRNF+NYPKGP+F +IFDVLG+GIFN D +LW+FHRKTT+
Sbjct  62   WLCNMDMLFTCDPANIHHVFSRNFANYPKGPEFMKIFDVLGNGIFNADFELWKFHRKTTM  121

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F     F  L+E  VW KV+ GL P+LD FAE
Sbjct  122  GFMGSLEFSGLIEGIVWRKVEKGLFPVLDLFAE  154



>ref|XP_009622763.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   195 bits (495),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
             +IF F   F    ++   +  S+ P  W  + MLP ++ N HR+H+++T++L + GGT+
Sbjct  11   LIIFGF-TYFIVWYLRHRWTKTSSEPTNWPFIRMLPAVIMNLHRIHEYMTEVLIDVGGTY  69

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
            EF+GP+  NLDM +TCD ANIHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE H
Sbjct  70   EFEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIH  129

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RKTTLS  +HA F TLLE N+W  V+ GL P+LD+F E
Sbjct  130  RKTTLSIMSHAKFQTLLERNLWDTVEKGLRPILDAFTE  167



>ref|XP_009631751.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
             +IF F   F    ++   +  S+ P  W  + MLP ++ N HR+H+++T++L + GGT+
Sbjct  11   LIIFGF-TYFIVWYLRHRWTKTSSEPTNWPFIRMLPAVIMNLHRIHKYMTEVLIDVGGTY  69

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
            EF+GP+  NLDM +TCD ANIHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE H
Sbjct  70   EFEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIH  129

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RKTTLS  +HA F TLLE N+W  V+ GL P+LD+F E
Sbjct  130  RKTTLSIMSHAKFQTLLERNLWDTVEKGLRPILDAFTE  167



>ref|XP_011095825.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=492

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +1

Query  157  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  336
              +S++P  W ++ M+P LL N  RLHQF T++L++SGGT+ FKGP   N DML TCDPA
Sbjct  17   KEKSSLPTNWPILDMIPALLKNIDRLHQFKTELLEQSGGTYMFKGPWFSNTDMLFTCDPA  76

Query  337  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  516
            NIHH+ S+NFSNYPKGP+FR+IF++LGDGIFN D +LWE HR+TT+S   H+ FH+ LE+
Sbjct  77   NIHHVFSKNFSNYPKGPEFRKIFEILGDGIFNADFELWEIHRRTTISLLTHSKFHSSLES  136

Query  517  NVWHKVQNGLLPLLDSFAE  573
             VW KV+ GLLP+L SF +
Sbjct  137  TVWGKVETGLLPVLASFCK  155



>gb|EPS65366.1| hypothetical protein M569_09411 [Genlisea aurea]
Length=503

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F++ S +    ++ ++      +AIP  + +VGMLP LL N+HR+H F+TDIL E GGTF
Sbjct  6    FLLLSSIAAALFLLLRRNLKKPTAIPTNFPIVGMLPALLLNSHRVHDFITDILSEVGGTF  65

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
            EFKGP   NLDM++T DP+N+HH+ SR+F  YPKGP FR++F VLGDGIFN D  +WE H
Sbjct  66   EFKGPTFSNLDMVLTSDPSNVHHVFSRSFLKYPKGPDFRKMFGVLGDGIFNTDFAVWEVH  125

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RK TL F     F+ L+E  VW KV+ G+ P+LDSF E
Sbjct  126  RKATLGFVGDREFNGLVEGVVWGKVEKGVFPVLDSFVE  163



>ref|XP_009626183.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=534

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = +1

Query  157  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  336
            S +   P  W ++GMLPGLL N HRLH+FVT+IL E+ G FEFKGPV  NL+ML + DPA
Sbjct  36   SKKPVTPTNWPLIGMLPGLLRNTHRLHEFVTEILIENEGIFEFKGPVFSNLNMLFSSDPA  95

Query  337  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  516
            N+HH+LS+NF+NYPKG +++++FD++GDGIFNVD++LWE  RK T+S  +H  F + LE 
Sbjct  96   NLHHMLSKNFNNYPKGSEYKKMFDIMGDGIFNVDNELWEVQRKITISIMSHPKFLSCLER  155

Query  517  NVWHKVQNGLLPLLDSFAE  573
            NVW KV  GL P+LD+FA+
Sbjct  156  NVWDKVVKGLQPVLDNFAK  174



>ref|XP_006340071.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=499

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  345
            S++P  W +VGMLP L+ N HR+H+  T++L ES GTFEF GPV  N +ML T DP NIH
Sbjct  19   SSLPTNWPIVGMLPELIRNLHRVHEKTTEVLIESNGTFEFHGPVFANFNMLGTSDPENIH  78

Query  346  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  525
            +ILS+NFSNYPKG +FR+ FD+ G+GIF+VD +LWE HRKTT+    HA FHTLLE N+W
Sbjct  79   YILSKNFSNYPKGVEFRKYFDIFGNGIFSVDYELWEIHRKTTMYLMGHAKFHTLLERNIW  138

Query  526  HKVQNGLLPLLDSFAE  573
              ++NGL P+LD FAE
Sbjct  139  EIIENGLRPILDDFAE  154



>ref|XP_004249314.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=509

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
            ++++ P  W ++  LPG++ N HR H ++T++L E GGT++FKGP+  N+DM  TCDPAN
Sbjct  28   TKTSAPTNWPILRELPGVIGNLHRGHAYMTEVLIEYGGTYDFKGPIFTNVDMFFTCDPAN  87

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            IH+I S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE HR+TT+S  +HA F  LLE  
Sbjct  88   IHYIFSKNFSNYPKGPEFRKIFDMLGNGIFNVDHELWELHRRTTMSIMSHAKFQMLLEKT  147

Query  520  VWHKVQNGLLPLLDSFAE  573
            +W  ++ GL P+LD+FA+
Sbjct  148  MWDIIEKGLKPILDAFAK  165



>ref|XP_006351417.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=508

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = +1

Query  103  MIFSFLGCFCY-MKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            ++F  + CF Y +   +   ++++ P  W ++  LP ++ N HR H ++T++L E G T+
Sbjct  8    ILFLLIFCFTYSIWFIIYRRTKTSAPTNWPILRELPAVIGNIHRGHAYMTEVLIEYGSTY  67

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
            +FKGP+  N+DML TCDP +IH+I S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE H
Sbjct  68   KFKGPIFTNMDMLFTCDPGDIHYIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWELH  127

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RKTT+S  +HA F  LLE  +W  ++ GL P+LD+FA+
Sbjct  128  RKTTMSIMSHAKFQILLEKTLWDIIEKGLRPILDAFAK  165



>ref|XP_006339338.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=465

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLPG ++N HR+H F TDIL E+   FEF+GP+  N+DML   DPANIHHILSRNFSNYP
Sbjct  1    MLPGFVHNMHRVHSFFTDILLETNSNFEFRGPIFANMDMLFPSDPANIHHILSRNFSNYP  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KGP+F +IFD+LG+ IFNVDS+LWE HRKTT+S  NHA F TLL+ NVW  +  G++P L
Sbjct  61   KGPEFHEIFDILGNEIFNVDSELWEIHRKTTMSLMNHAKFQTLLQRNVWDTIDKGIVPTL  120

Query  559  DSFAE  573
            D FA+
Sbjct  121  DIFAK  125



>gb|AJD25225.1| cytochrome P450 CYP96A85 [Salvia miltiorrhiza]
Length=502

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            P  W ++GMLP ++ N HR+H ++T +L   GGT+ F+GP   N+DML T DPANIHH+ 
Sbjct  32   PTDWPLIGMLPRVILNFHRVHDYITSVLTVCGGTYMFRGPCFFNIDMLFTSDPANIHHVF  91

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            SRNFSNYPKGP+FR+IFD+LGDGIF  D +LWE HRKTTL+   HA F+  LE  VWHKV
Sbjct  92   SRNFSNYPKGPEFRKIFDILGDGIFGADFELWEIHRKTTLAQLTHADFNAQLERAVWHKV  151

Query  535  QNGLLPLLDSFA  570
            + GLLP+LD F 
Sbjct  152  ETGLLPVLDHFC  163



>gb|AEI59774.1| cytochrome P450 [Helianthus annuus]
Length=505

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +1

Query  163  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  342
            R  IP  W ++GM+PG+L NAH+LH + T++L +S GTF  KGP L N+DML+T DP +I
Sbjct  30   RHVIPSNWPILGMIPGVLVNAHQLHDYTTELLIQSRGTFMLKGPWLANMDMLLTTDPLDI  89

Query  343  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNV  522
            HHILS+NFSNYPKG +F++IFD+LGDGI N D ++WE   K   S  NH  F + +ET +
Sbjct  90   HHILSKNFSNYPKGDKFQKIFDILGDGILNADGKIWEISHKVIFSVLNHVGFQSKMETII  149

Query  523  WHKVQNGLLPLLDSFAE  573
            W KV+NGLLP+L+S  E
Sbjct  150  WDKVENGLLPILESICE  166



>gb|EYU41723.1| hypothetical protein MIMGU_mgv1a021724mg [Erythranthe guttata]
Length=518

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
             ++++P  W +VGMLP +  N HR+  ++T+IL ESGGTF+FK P   N+D LIT +P N
Sbjct  34   KKTSLPTNWPLVGMLPAIQRNRHRMQDYITEILIESGGTFQFKFPHFLNMDTLITSNPDN  93

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            I+HI ++NFSNYPKGP+F++IF+ LGD IF+VD++LWEF R+TT SF  H  F++LLE  
Sbjct  94   INHIFTKNFSNYPKGPEFKKIFEELGDSIFSVDNELWEFQRRTTHSFMTHPEFNSLLEGV  153

Query  520  VWHKVQNGLLPLLDSFAE  573
            VW KV+NGLLP+LD F +
Sbjct  154  VWQKVENGLLPVLDHFLQ  171



>gb|EYU33777.1| hypothetical protein MIMGU_mgv1a004858mg [Erythranthe guttata]
Length=507

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +1

Query  145  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  324
            K E+  + + P  W VVGMLPGL+ NAHR+H ++T+IL+E+G TF FKGP+  N+DM+ T
Sbjct  23   KFENRRKGSTPTNWPVVGMLPGLVGNAHRIHDYITEILRENGATFVFKGPLFTNMDMVFT  82

Query  325  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  504
            CDP NI+HI ++ FSNYPKGP+F++IF+++GDGIF  D ++WE  R+ TLS  N   F+T
Sbjct  83   CDPININHIFNKRFSNYPKGPEFQKIFEIMGDGIFRSDFEMWELQRRLTLSIVNQVGFYT  142

Query  505  LLETNVWHKVQNGLLPLLDSFAE  573
             +E   W  V+  L+P+LD F +
Sbjct  143  SVEKTTWGTVRTELVPVLDHFLQ  165



>ref|XP_010683407.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 102/149 (68%), Gaps = 5/149 (3%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  306
            FCY        +++ +P  W +VGML  LL N  R+H ++T++L++S   F FKGP   N
Sbjct  17   FCY-----SFRNKNGVPTNWPIVGMLLPLLANVPRIHDWITEVLEKSQLNFLFKGPWFAN  71

Query  307  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  486
            ++M +T DPAN+H+I+S+NF NYPKG +F ++FDV GDGIFNVDS+LWE+HRK   +F  
Sbjct  72   MEMFVTLDPANVHYIMSKNFKNYPKGSKFNEMFDVFGDGIFNVDSKLWEYHRKMAHTFIG  131

Query  487  HAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            H  FH  L   VW KV+ GL+P+LD  ++
Sbjct  132  HPKFHQFLHEKVWEKVEKGLIPVLDDASK  160



>ref|XP_010680694.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            +  F   FCY+       +++ IP  W ++GMLP LL NA+R+H+F+ ++++ S  TF F
Sbjct  6    VLIFFVLFCYL-----FRNKNGIPTNWPLLGMLPALLKNAYRIHEFLIELMERSNLTFHF  60

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP   N+++L+T DP NIHH+LS+ F NY KGP+  +I + LGDGI   DS LW +HR 
Sbjct  61   KGPWFSNMNLLLTIDPTNIHHVLSKRFENYVKGPKLYEILEPLGDGILTTDSTLWLYHRN  120

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               SFFNH  FH  L    W KV+NGL+P+L+  ++
Sbjct  121  VAHSFFNHPKFHQSLVDVTWKKVKNGLIPVLEHVSK  156



>ref|XP_009615501.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=507

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 94/149 (63%), Gaps = 1/149 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+        ++   PR W + GMLPG LY    +H+ VT  ++ SGGTF FKGP
Sbjct  12   FLAILCFFLFHGLKDTK-GYPRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGTFLFKGP  70

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
            +   +DML T DPAN+H+I+S NF N+PKGP+FR+IFDVLGDGIFN D  LW+  RKT  
Sbjct  71   LFAKMDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDGIFNADMDLWKIQRKTAR  130

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
            +   H  F+  L      KV+ GL+P+LD
Sbjct  131  ALITHQQFYKFLVKTSREKVEKGLIPVLD  159



>gb|EPS60696.1| hypothetical protein M569_14105, partial [Genlisea aurea]
Length=468

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
            SR++    W +V MLPGL  N HR+H F+ ++L ESGGTF F+GPV GN DML+T DPAN
Sbjct  2    SRNSKIADWPIVAMLPGLARNVHRVHDFIAEVLAESGGTFVFRGPVFGNTDMLVTSDPAN  61

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            +H+ILS+NF N+ KGP F++IFD+LGDGIF  + + WE  R+   +   +  FH  +   
Sbjct  62   VHYILSKNFHNFGKGPDFKKIFDILGDGIFAAEFESWEKQRRAAKAAVGNLAFHQFVART  121

Query  520  VWHKVQNGLLPLLDSFAE  573
            VW KV   L+P+L S +E
Sbjct  122  VWGKVSETLVPMLRSASE  139



>ref|XP_009759082.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=507

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 94/149 (63%), Gaps = 1/149 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+        ++   PR W + GMLPG LY    +H+ VT  ++ SGGTF FKGP
Sbjct  12   FLAILCFFLFHGLKDTK-GYPRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGTFLFKGP  70

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
            +   LDML T DPAN+H+I+S NF N+PKGP+FR+IFDVLGDGIFN D  LW+  RKT  
Sbjct  71   IFAKLDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDGIFNADLDLWKIQRKTAR  130

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
            +   H  F+  L      KV+ GL+P+L+
Sbjct  131  ALITHQQFYKFLVKTSREKVEKGLIPVLN  159



>ref|XP_002279531.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=507

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 108/170 (64%), Gaps = 9/170 (5%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            MA  +   +L+  + F F+G FC         S+  +P  W +VGM  GLL++ HR+H  
Sbjct  1    MALVSYPEILVAVIFFLFIGGFC---------SKKGVPWNWPIVGMFAGLLFHVHRIHDE  51

Query  244  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  423
              +IL+++G TF FKGP   N+DML T DPAN+H+I+S NFSN+PKG +FR++F+VLGDG
Sbjct  52   AAEILEKTGCTFLFKGPWFCNMDMLGTTDPANVHYIMSSNFSNFPKGTEFRKMFEVLGDG  111

Query  424  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            IFN D + W   RK   S  N+  FH  L    ++KV+ GL+PLLD  +E
Sbjct  112  IFNADGESWRNQRKLGQSMINNPRFHRFLAKVTYNKVEKGLVPLLDHLSE  161



>gb|KFK32767.1| hypothetical protein AALP_AA6G286100 [Arabis alpina]
Length=515

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 108/170 (64%), Gaps = 4/170 (2%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            MA   LL + + F+ FS L  +  +  K   S     P  W  +GMLPGLL   HR++ +
Sbjct  1    MALIGLLEVSVSFLCFSVLFAYFLISKKPHPS----FPTNWPFLGMLPGLLVEIHRVYDY  56

Query  244  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  423
            +T++L+ S  T+ F+GP  G LDMLIT DPANIHHI+S NF+NYPKG +F++IFDVLGDG
Sbjct  57   MTEVLEASNLTYPFRGPCFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116

Query  424  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            IFN DS+LW+  RK+  S  +H  F          K++ GL+PLL+  AE
Sbjct  117  IFNADSELWKDLRKSAQSMMSHPEFQRFTLRTSISKLEKGLIPLLNLVAE  166



>ref|XP_010027332.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62196.1| hypothetical protein EUGRSUZ_H04854 [Eucalyptus grandis]
Length=272

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 93/153 (61%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+  +++ S S    PR W +VGMLP LL N    H + T +++ S G F  + P
Sbjct  10   FLAGICFAVLRLLSKSNDGFPRNWPLVGMLPALLLNPSHFHDWATGVVERSHGNFFVRFP  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSMQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F     FH  L +    K +NGLL +LD  ++
Sbjct  130  VFMKDQRFHRFLSSTTRDKAENGLLRVLDELSQ  162



>ref|XP_006427987.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
 ref|XP_006464489.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 ref|XP_006495173.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|ESR41227.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
Length=508

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 105/153 (69%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C++ ++   S+ + IP+ + VVG LP LL N HR+H + T++L+++  TF FKGP
Sbjct  10   FLAIICFLILRYCFSNNNGIPKNFPVVGTLPHLLLNVHRIHDYSTEVLEKTQCTFLFKGP  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
               N+D+L T DPAN+HHI+S NFSN+PKGP+F++IFD+LGDGIFN DS LW+  R+   
Sbjct  70   WFANMDILATVDPANVHHIMSSNFSNFPKGPEFKRIFDILGDGIFNSDSDLWKNQRRFAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +  N   F+  L  +   K++ GL+P+LD  ++
Sbjct  130  ALMNRHSFYKFLVKSNQAKLEKGLIPILDHMSK  162



>ref|XP_010531420.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=514

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = +1

Query  124  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  303
            CF    + +     +  PR W  +GMLPG+L   HR++ +  D+L+ S  TF FKGP   
Sbjct  17   CFLVFHILLNKKPHACFPRNWPFLGMLPGVLVVFHRVYDWAADVLEISDLTFTFKGPWFA  76

Query  304  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  483
             +DML+T DP+NIHHI+S +FSNYPKGP+F+++FDVLGDGI NVDS LWE  RK+T S F
Sbjct  77   GIDMLVTVDPSNIHHIMSSHFSNYPKGPEFKEVFDVLGDGILNVDSDLWENLRKSTQSIF  136

Query  484  NHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            NH  F          K++ GLLP LD  A+
Sbjct  137  NHEGFKKFSFLANVKKLKTGLLPFLDQAAK  166



>ref|NP_179899.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAK43908.1|AF370589_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAB87111.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAC42368.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07426.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W  +GMLPGLL    R++ FVT++L+ S  T+ FKGP  G LDMLIT DPANIHHI+S N
Sbjct  37   WPFLGMLPGLLVEIPRVYDFVTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMSSN  96

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F+NYPKG +F++IFDVLGDGIFN DS+LW+  RK+  S   H  F       +  K++ G
Sbjct  97   FANYPKGTEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQRFTLRTIMSKLEKG  156

Query  544  LLPLLDSFAE  573
            L+PLLD  AE
Sbjct  157  LVPLLDYVAE  166



>ref|XP_009601590.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            F+  FC+         RS +P  W  +GM PGLL++ +R+H+   ++   +GGTF  KGP
Sbjct  16   FVAIFCFFVF-CALGDRSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSTTGGTFLLKGP  74

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
               N+D+L T DPAN+H+I+S NF N+PKG +F++IFDVLGDGIFN D  LW+  RK T 
Sbjct  75   WFANIDILGTVDPANVHYIMSANFENFPKGEEFKKIFDVLGDGIFNSDLDLWKSQRKITR  134

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
            +   H  FH  LE   W K++NGL+P+L+  A
Sbjct  135  TLITHQRFHNCLEKTSWDKIENGLIPVLEFVA  166



>ref|XP_010680693.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            +  F   FCY+       +++ IP  W ++GMLP LL NA+R+H+F+ ++++ S  TF F
Sbjct  6    VLIFFVLFCYL-----FRNKNGIPTNWPLLGMLPALLKNAYRIHEFLIELMERSNLTFHF  60

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP   N+++L+T DP NIHH+LS+ F NY KGP+  +I + LGDGI   DS LW +HR 
Sbjct  61   KGPWFSNMNLLLTIDPTNIHHVLSKRFENYVKGPKLYEILEPLGDGILTTDSTLWLYHRN  120

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               SFFNH  FH  L    W KV+NGL+P+L+  ++
Sbjct  121  VAHSFFNHPKFHQSLVDVTWKKVKNGLIPVLEHVSK  156



>ref|XP_002878665.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54924.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 106/170 (62%), Gaps = 4/170 (2%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            MA   LL + +  +  SFL  +C +  K   S  +     W  +GMLPGLL    R++ +
Sbjct  1    MALITLLEVSISLLFISFLYGYCLISKKPHRSFLT----NWPFLGMLPGLLVEIPRVYDY  56

Query  244  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  423
            VT++L+ S  T+ FKGP  G LDMLIT DPANIHHI+S NF+NYPKG +F++IFDVLGDG
Sbjct  57   VTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116

Query  424  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            IFN DS+LW+  RK+  S   H  F          K++ GL+PLLD  AE
Sbjct  117  IFNADSELWKDLRKSAQSMMTHQDFQRFTLRTSMSKLEKGLVPLLDYVAE  166



>ref|XP_009117295.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=534

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 110/172 (64%), Gaps = 8/172 (5%)
 Frame = +1

Query  64   MASAAlllllllFMIFS-FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQ  240
            MA  +LL + + F+ FS F G F  MK    S      P  W  +GMLPGLL    R++ 
Sbjct  19   MAMISLLEISVSFLCFSYFFGYFLIMKKPHRS-----FPTNWPFLGMLPGLLVEIPRVYD  73

Query  241  FVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  420
            +VT+ L+ S  TF FKGP  G LDML T DPANIHHI+S NF+NYPKG +F+++FDVLGD
Sbjct  74   YVTEFLEASNLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVLGD  133

Query  421  GIFNVDSQLWEFHRKTTLSFFNHAHFHTL-LETNVWHKVQNGLLPLLDSFAE  573
            GIFN DS LW+  RK+  S  +   F    L TN+  K++ GL+P+LD FAE
Sbjct  134  GIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNM-SKLEKGLVPILDHFAE  184



>gb|EYU27556.1| hypothetical protein MIMGU_mgv1a021423mg [Erythranthe guttata]
Length=507

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 98/143 (69%), Gaps = 0/143 (0%)
 Frame = +1

Query  145  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  324
            K + SS +  P  W + GMLPGLL N  R+H F+T++L+ SGGTF  KG    N+ MLIT
Sbjct  27   KDKKSSPAPPPTDWPIFGMLPGLLLNCGRVHTFMTELLESSGGTFYLKGAWFANMSMLIT  86

Query  325  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  504
             DPAN+H+IL++NF N+ KGPQF+++FDVLGDGIFN +S+ WE  ++T  S  ++  F  
Sbjct  87   SDPANVHYILAKNFPNFEKGPQFKKMFDVLGDGIFNAESESWEIQKRTAKSLMHNTSFPD  146

Query  505  LLETNVWHKVQNGLLPLLDSFAE  573
             +    W KV+N L+P+L+  +E
Sbjct  147  FIARTSWSKVENALIPILELASE  169



>emb|CDY46088.1| BnaA09g42120D [Brassica napus]
Length=516

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 110/172 (64%), Gaps = 8/172 (5%)
 Frame = +1

Query  64   MASAAlllllllFMIFS-FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQ  240
            MA  +LL + + F+ FS F G F  MK    S      P  W  +GMLPGLL    R++ 
Sbjct  1    MAMISLLEISVSFLCFSYFFGYFLIMKKPHRS-----FPTNWPFLGMLPGLLVEIPRVYD  55

Query  241  FVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  420
            +VT+ L+ S  TF FKGP  G LDML T DPANIHHI+S NF+NYPKG +F+++FDVLGD
Sbjct  56   YVTEFLEASNLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVLGD  115

Query  421  GIFNVDSQLWEFHRKTTLSFFNHAHFHTL-LETNVWHKVQNGLLPLLDSFAE  573
            GIFN DS LW+  RK+  S  +   F    L TN+  K++ GL+P+LD FAE
Sbjct  116  GIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNM-SKLEKGLVPILDHFAE  166



>ref|XP_006374652.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52449.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 97/149 (65%), Gaps = 0/149 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            F    C++ +       + +P+ W ++GMLPGLL+  HR H +VTD+L++S  TF+FKGP
Sbjct  10   FFAFICFLSLIFCLRKNNGLPKNWPLIGMLPGLLFQVHRFHDWVTDVLEQSKCTFQFKGP  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
              G++D+L+T DPANIH+I S NFSN+ KG  F + FD+LGDGI N D  LW+  RK   
Sbjct  70   WFGDMDILVTADPANIHYITSSNFSNFEKGSDFNKRFDILGDGIINADRDLWKSQRKVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
            +  NH  F+  L   +  KV+ GL+P+L+
Sbjct  130  ALVNHRLFYQRLVKTIQDKVERGLIPVLE  158



>ref|XP_010419318.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=363

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            PR W V+GMLPG+L   HR++ +V ++L+ S  TF FKGP    ++MLIT DPANI H+ 
Sbjct  32   PRNWPVLGMLPGILITLHRINDYVAEVLEVSNLTFVFKGPWFSGMNMLITADPANIQHVF  91

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F +     +  K+
Sbjct  92   SSNFSNYSKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVLLSHQGFQSFSLRTITRKI  151

Query  535  QNGLLPLLDSFAE  573
            +NG +P+LD FAE
Sbjct  152  KNGAVPVLDHFAE  164



>ref|XP_010681071.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 96/137 (70%), Gaps = 0/137 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
            ++S  P  W +VGML  LL N +R+H +V++IL+ S  +F FKGP   N++ML+T DPAN
Sbjct  22   NKSGTPTNWPLVGMLLPLLRNVNRIHDWVSEILETSQLSFLFKGPWFTNMEMLVTVDPAN  81

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            IHHI+++NFSNYPKG +F +IFDV+GDGIFNVD  LW++HR    +F  H  F   L   
Sbjct  82   IHHIMTKNFSNYPKGTKFNEIFDVMGDGIFNVDFDLWKYHRSMAHTFIAHPRFRHFLVVK  141

Query  520  VWHKVQNGLLPLLDSFA  570
            +  KV+ GL+P+LD  A
Sbjct  142  IQEKVEKGLIPVLDHAA  158



>ref|XP_011095705.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 103/156 (66%), Gaps = 1/156 (1%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            I  +L   CY +  +    +S++P  W ++GM+P LL N  RLHQ  T++L++SGGT  F
Sbjct  13   IVLYLMLLCY-RYAVGRKEKSSLPTNWPILGMIPALLKNIGRLHQVTTEVLEQSGGTIWF  71

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP   N+DM++T D AN+H+IL++NF N+ KGP+F++IFD+ GDGIF  + + WE  R+
Sbjct  72   KGPWFANMDMMVTSDRANVHYILTKNFPNFSKGPEFKKIFDIFGDGIFAAEHESWESQRR  131

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +T +      F  L+ T  W+KV+  L+P+++  +E
Sbjct  132  STKALMMQPGFQELVATTSWNKVETSLIPIMELVSE  167



>emb|CDX76867.1| BnaC08g34530D [Brassica napus]
Length=516

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 109/172 (63%), Gaps = 8/172 (5%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFL-GCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQ  240
            MA  +LL + + F+ FSF  G F  MK    S      P  W  +GMLPGLL    R++ 
Sbjct  1    MAMISLLEITVSFLCFSFFFGYFLIMKKPHRS-----FPTNWPFLGMLPGLLVEIPRVYD  55

Query  241  FVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  420
            +VT+ L+ S  TF FKGP  G LDML T DPANIHHI+S NF+NYPKG +F+++F VLGD
Sbjct  56   YVTEFLEASNLTFPFKGPCFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFSVLGD  115

Query  421  GIFNVDSQLWEFHRKTTLSFFNHAHFHTL-LETNVWHKVQNGLLPLLDSFAE  573
            GIFN DS LW+  RK+  S  +   F    L TN+  K++ GL+P+LD FAE
Sbjct  116  GIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNM-SKLEKGLVPILDHFAE  166



>gb|EYU27553.1| hypothetical protein MIMGU_mgv1a006542mg [Erythranthe guttata]
Length=440

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 95/138 (69%), Gaps = 13/138 (9%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
             ++++P  W +VGMLP +L N HR+H + T+IL ESGGTF  +G   G +          
Sbjct  29   KKTSLPTNWPLVGMLPAILLNCHRIHAYFTEILIESGGTFIPRGFQHGYVGYF-------  81

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
                  RNFSNYPKGP+F+++F++LGDGIFN D +LWE HR+TTLSF NH  F+ LLE +
Sbjct  82   ------RNFSNYPKGPEFKKMFEILGDGIFNADFELWELHRRTTLSFLNHTKFYDLLERS  135

Query  520  VWHKVQNGLLPLLDSFAE  573
            +W KV+ GLLP+LD F+E
Sbjct  136  IWEKVETGLLPVLDDFSE  153



>ref|XP_009389287.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 91/138 (66%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
            SRS IP  W VVGMLP LL N HRLH + TD+L+E+G +F F+GP    ++ L+TCDPAN
Sbjct  43   SRSRIPVNWPVVGMLPALLVNLHRLHDWGTDVLREAGCSFWFRGPWFLGMNHLLTCDPAN  102

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            +HH+   NFSNYPKG  F +IFD+LGDGIFN D Q W+  R    S  +   F T +  +
Sbjct  103  VHHVFGANFSNYPKGEAFLEIFDILGDGIFNSDEQSWKEQRTKAHSIMSGRRFRTFVADS  162

Query  520  VWHKVQNGLLPLLDSFAE  573
               KV+ GLLPL+   A+
Sbjct  163  ARSKVEKGLLPLIHHIAQ  180



>ref|XP_010416946.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            +PR W V+GMLPG+L   HR++ +V +IL+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLIMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHV  90

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
             S NF+NY KGP+F++IFD LG+GIF  DS+LWE  RK+ L   +H  F +     +  K
Sbjct  91   FSSNFTNYDKGPEFKEIFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITRK  150

Query  532  VQNGLLPLLDSFAE  573
            ++NG++P+LD FAE
Sbjct  151  IKNGVVPVLDHFAE  164



>ref|XP_010025513.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62205.1| hypothetical protein EUGRSUZ_H04866 [Eucalyptus grandis]
Length=507

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 95/153 (62%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C   +++ S S   +PRKW +VGMLP LL N    H + T +++ S G F F+ P
Sbjct  10   FLAGICLGVLRLLSKSDDGLPRKWPLVGMLPTLLLNLSHFHDWATGVVERSHGNFFFRLP  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F     FH  L +    K +NGLL +LD  ++
Sbjct  130  VFMKDQRFHRFLSSTTRDKAENGLLMVLDELSQ  162



>ref|XP_010417073.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Camelina sativa]
 ref|XP_010417074.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Camelina sativa]
Length=514

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 102/158 (65%), Gaps = 4/158 (3%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F+ FSF+  +  +  K   S  +     W +VGMLPGLL    R++ ++T++L+ S  T+
Sbjct  13   FLFFSFISGYFLISKKPHRSFMT----DWPIVGMLPGLLVEIPRIYDYLTELLEASNLTY  68

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
             FKGP  G LDML+T DPANIH+I+S NF+NYPKG +FR++FDVLGDGIFN DS+LW+  
Sbjct  69   PFKGPCSGGLDMLVTIDPANIHYIMSSNFANYPKGSEFRKLFDVLGDGIFNADSELWKDL  128

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RK+     +H  F          K++ GL+PLLD  A+
Sbjct  129  RKSAEGMMSHPDFQRFTVRTSMSKLEKGLVPLLDCVAQ  166



>ref|XP_010681072.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
             ++ +P  W ++GMLP LL N HR+H F+ +I ++S  TF F GP   N+ +L+T DPAN
Sbjct  25   DKTGLPTNWPLLGMLPALLKNIHRIHNFLIEIFEKSHLTFLFDGPWFTNMQILLTIDPAN  84

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            IHH++S+NF NYPKG +F ++FDVLGDGIFN D  +W++HRK    F  H  FH  L   
Sbjct  85   IHHVMSKNFGNYPKGTKFNEMFDVLGDGIFNADFLVWQYHRKMAQYFLGHPKFHHFLVKK  144

Query  520  VWHKVQNGLLPLLD  561
               K++NGL+P+LD
Sbjct  145  TREKLENGLIPVLD  158



>ref|XP_010429263.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W ++GMLPGLL    R++ ++T++L+ S  T+ FKGP  G LDML+T DPANIH+I+S N
Sbjct  37   WPILGMLPGLLVEIPRIYDYLTELLEASNLTYPFKGPCFGGLDMLVTVDPANIHYIMSSN  96

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F+NYPKG +FR++FDVLGDGIFN DS+LW+  RK+     +H  F          K++ G
Sbjct  97   FANYPKGSEFRKLFDVLGDGIFNADSELWKDLRKSAEGMMSHPDFQRFTVRTSMSKLEKG  156

Query  544  LLPLLDSFAE  573
            L+PLLD  AE
Sbjct  157  LVPLLDCVAE  166



>ref|XP_010473744.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            +PR W V+GMLPG+L   HR++ +V +IL+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLAMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHV  90

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
             S NF+NY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F +     +  K
Sbjct  91   FSSNFTNYDKGPEFKEMFDFLGNGIFTADSKLWENMRKSALVVLSHQGFQSFSLRTITRK  150

Query  532  VQNGLLPLLDSFAE  573
            ++NG++P+LD FAE
Sbjct  151  IENGVVPVLDHFAE  164



>ref|NP_179782.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
 gb|AAD20408.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07237.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
Length=510

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
            S    PR W V+GMLPG+L   HR++ +V +IL+ S  TF FKGP    ++MLIT DP+N
Sbjct  27   SHQITPRNWPVLGMLPGVLVMLHRINDYVAEILEVSNLTFAFKGPWFSGMNMLITADPSN  86

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            I H+ S NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F +     
Sbjct  87   IQHVFSSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRT  146

Query  520  VWHKVQNGLLPLLDSFAE  573
            +  K++NGL+P+LD FAE
Sbjct  147  ITCKIKNGLVPVLDHFAE  164



>gb|KFK33664.1| hypothetical protein AALP_AA5G043500 [Arabis alpina]
Length=511

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 96/152 (63%), Gaps = 0/152 (0%)
 Frame = +1

Query  118  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            +  FC++   +      + P  W  +GMLPGLL    R++ FVT+ L+++   F FKGP 
Sbjct  11   IAFFCFLIFLISKKRHRSFPTNWPFLGMLPGLLVEIPRVYDFVTEFLEDANLNFLFKGPF  70

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
             G LDML+T DPANIHHI+S NF+NYPKG +F+++FD+LGDGIFN DS+LW   RK+  S
Sbjct  71   WGGLDMLVTVDPANIHHIMSSNFANYPKGTEFKKLFDILGDGIFNADSELWNDLRKSAQS  130

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               +  F          K++ GLLPLLD  A+
Sbjct  131  MMMNPKFQKFSLATSLSKLEKGLLPLLDHVAK  162



>gb|EYU33778.1| hypothetical protein MIMGU_mgv1a020242mg [Erythranthe guttata]
Length=458

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLP ++ N HR H  +T++L E G TF  +GP   + D+L T DPANI HI S+ FSNYP
Sbjct  1    MLPTIVRNLHRAHDKLTEVLIECGATFLLRGPWFFDTDILFTSDPANIQHIFSKRFSNYP  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KG +FR  F++LGDG+F+ D +LWE  R+T LS  +HA FHT LE NVW K++ GL+P+L
Sbjct  61   KGSEFRNKFEILGDGVFSSDFELWELQRRTILSIISHAKFHTSLERNVWEKIETGLIPVL  120

Query  559  DSFA  570
            D F+
Sbjct  121  DYFS  124



>ref|XP_006411749.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
 gb|ESQ53202.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
Length=517

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            P  W  +GM+PGLL   HR++ FVTDIL+ +  T+   GP    LDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYPCIGPCFAGLDMLVTVDPANIHHIM  92

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NFSNYPKGP+F+++FDVLGDGIFN DS+LW+  RK+  S   +  F          K+
Sbjct  93   SSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQRFSLATSLSKL  152

Query  535  QNGLLPLLDSFA  570
            + GL+PLLD  A
Sbjct  153  EKGLVPLLDHVA  164



>ref|XP_010261086.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=513

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 106/171 (62%), Gaps = 2/171 (1%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            M S A + +    M+   L   C++ ++  S + S +P  W V+GMLP LL N H +H +
Sbjct  1    MTSMAFMGMGYFEMLLLSLAVVCFIYLRRLSRNDSPLP-DWPVLGMLPSLLRNIHHVHDW  59

Query  244  VTDILKESGG-TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  420
             T +L++S   TF F+GP L  +DM+ TCDPAN+H+I+S +FSN+PKGP+F+ IFDVLGD
Sbjct  60   TTKLLEQSRSYTFTFRGPWLAGMDMVWTCDPANVHYIMSTHFSNFPKGPEFKNIFDVLGD  119

Query  421  GIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            GIFN DS LW+  RK      +   F   LE      V+ GL+P+LD  +E
Sbjct  120  GIFNSDSDLWKTQRKVAHGLISRRRFCRFLERTSRKNVEEGLIPVLDHISE  170



>ref|XP_009795100.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=505

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  345
            S  P  W + GMLPG LY+  ++H+  T  ++ SGGTF FKGP   N+DML T DPAN+H
Sbjct  27   SKYPINWPIFGMLPGALYHIQQIHERCTMTMRASGGTFLFKGPWFANMDMLSTVDPANVH  86

Query  346  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  525
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RKTT +   H  F+  L     
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHLQFYKFLVKTSR  146

Query  526  HKVQNGLLPLLDSFAE  573
             KV+ GL+P+LD   +
Sbjct  147  EKVEKGLIPVLDYICD  162



>ref|XP_010437068.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=518

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W ++GMLPGLL    R++ F+TD+L+     F FKGP LG LDML T DPANIHHI+S N
Sbjct  36   WPILGMLPGLLPELPRVYDFITDVLEGGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSN  95

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK++ S  +H  F          K++ G
Sbjct  96   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQKFSLATSLSKLEKG  155

Query  544  LLPLLDSFAE  573
            L+PLLD  A+
Sbjct  156  LVPLLDHVAK  165



>ref|XP_006446602.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
 gb|ESR59842.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
Length=519

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGTFEFKGPVLGNLDMLITCDPA  336
            SR+++ R   V+GMLPGLL N  RLH+F+T D+LK++ GTFEF GP    +D++IT DP 
Sbjct  29   SRNSLRRNRPVLGMLPGLLGNTWRLHEFLTHDVLKKNRGTFEFTGPWFAQMDLIITSDPM  88

Query  337  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  516
            N+H+I S+NFSNYPKGP FR I + LGDG+FN D  LW+  RK   S   H  F + LE 
Sbjct  89   NVHYISSKNFSNYPKGPDFRMIMEPLGDGVFNADGDLWKIQRKIIHSVMKHNKFESALEN  148

Query  517  NVWHKVQNGLLPLLDSFAE  573
                K++ GL+P+LD  +E
Sbjct  149  VAHQKLETGLIPVLDHASE  167



>ref|XP_009614166.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=505

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  345
            S  P  W + GMLPG LY+  ++H+  T  ++ SGGTF FKGP   N+DML T DPAN+H
Sbjct  27   SKYPINWPIFGMLPGALYHIQQIHERCTMTMRASGGTFLFKGPWFANMDMLSTVDPANVH  86

Query  346  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  525
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RKTT +   H  F+  L     
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHQQFYKFLVKTSR  146

Query  526  HKVQNGLLPLLDSFAE  573
             KV+ GL+P+LD   +
Sbjct  147  DKVEKGLIPVLDYICD  162



>ref|XP_008801256.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=528

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 91/149 (61%), Gaps = 3/149 (2%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  306
            +CY K   E +    IP  W  VGMLP LL + H+LH + T ILKE+G  F F GP    
Sbjct  31   YCYRKRMNEGT---GIPVNWPFVGMLPALLVHLHQLHDWGTMILKETGCNFFFHGPWYSG  87

Query  307  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  486
            +DMLITCDPAN++H+ S NF NYPKG  F +IFDVLGDGIFN D++ W   R    S  N
Sbjct  88   MDMLITCDPANVYHVFSANFHNYPKGDDFSEIFDVLGDGIFNSDAESWRRQRMKAHSLIN  147

Query  487  HAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               F   +  +   KV+ GL+PLLD  AE
Sbjct  148  DRRFRAFVAQSSRSKVEKGLIPLLDQLAE  176



>emb|CDY53179.1| BnaA06g40580D [Brassica napus]
Length=515

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 96/154 (62%), Gaps = 0/154 (0%)
 Frame = +1

Query  109  FSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFK  288
             +FL  F +    +        P  W  +G++PGLL   HR++ F+T+IL+ +  T+  K
Sbjct  11   IAFLCFFLFRHFLINKKPHRLCPTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYFCK  70

Query  289  GPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKT  468
            GP    LDML+T DP+NIHHI+S NFSNYPKGP+F+++FDVLGDGIFN DS+LW+  RK+
Sbjct  71   GPCYAGLDMLVTVDPSNIHHIMSSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKS  130

Query  469  TLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
              S   H  F          K++ GL+PLLD  A
Sbjct  131  AQSMMMHPEFQKFSLATSMSKLEKGLVPLLDHVA  164



>ref|NP_001031814.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE87078.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=519

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 97/152 (64%), Gaps = 3/152 (2%)
 Frame = +1

Query  127  FCYMKMK---MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            FC++  +   +   +    P  W   GM+PGLL   HR++ F+T+IL+ +  T+   GP 
Sbjct  14   FCFLLFRHFLINKKTHRLCPTNWPFFGMIPGLLVEIHRVYDFITEILEVTNLTYPCTGPC  73

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
              NLDML+T DPANIHHI+S NF+NYPKGP+F+++FD+LGDGIFN DS+LW+  RK+  S
Sbjct  74   FANLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDILGDGIFNADSELWKDLRKSAQS  133

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               +  F          K++ GL+PLLD  A+
Sbjct  134  MMMNPEFQKFSLATSLKKLEKGLVPLLDHVAK  165



>ref|XP_010437069.1| PREDICTED: cytochrome P450 86B1 isoform X1 [Camelina sativa]
 ref|XP_010437071.1| PREDICTED: cytochrome P450 86B1 isoform X2 [Camelina sativa]
Length=513

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            P  W  +GM+PGLL   HR++ FVTDIL+ +  T+   GP+   LDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYPCVGPLFSGLDMLVTVDPANIHHIM  92

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NF+NYPKGP+F+++FDVLGDGIFN DS LW+  RK+  S   +  F         +K+
Sbjct  93   SSNFANYPKGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMMNPEFQKFSLATSLNKL  152

Query  535  QNGLLPLLDSFAE  573
            + GL+PLLD  A+
Sbjct  153  EKGLVPLLDHVAK  165



>ref|XP_002866853.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43112.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            P  W  +GM+PGLL   HR++ F+T+IL+ +  T+   GP   NLDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFITEILEVTNLTYPCIGPCFANLDMLVTVDPANIHHIM  92

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NF+NYPKGP+F+++FD+LGDGIFN DS+LW+  RK+  S   +  F         +K+
Sbjct  93   SSNFANYPKGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSSNKL  152

Query  535  QNGLLPLLDSFAE  573
            + GL+PLLD  A+
Sbjct  153  EKGLVPLLDHVAK  165



>emb|CDP04331.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            M+P L  N HR   ++T+IL+ESGGTFEFKGP   N+DML+T DPAN++HILS++FSN+ 
Sbjct  1    MMPDLFLNVHRAQDYITEILQESGGTFEFKGPWFANMDMLVTSDPANVNHILSKSFSNFQ  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KGP+F ++FD+LG GIFN + + WE  RKT +   NH  F   +    W+K++ GL+P+L
Sbjct  61   KGPEFEKMFDILGKGIFNAECESWESPRKTIMPLINHQGFQKFVGITSWNKLEKGLIPVL  120

Query  559  DSFAE  573
            +  A+
Sbjct  121  ELAAK  125



>ref|XP_010436205.1| PREDICTED: cytochrome P450 86B1-like, partial [Camelina sativa]
Length=450

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W ++GMLPGL+    R++ F+T++L++    F FKGP LG LDML T DPANIHHI+S N
Sbjct  36   WPILGMLPGLVPELPRVYDFLTEVLEDGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSN  95

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK++ S  +H  F          K++ G
Sbjct  96   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQRFSLATSLSKLEKG  155

Query  544  LLPLLDSFAE  573
            L+PLLD  A+
Sbjct  156  LVPLLDHVAK  165



>gb|EYU41727.1| hypothetical protein MIMGU_mgv1a023193mg, partial [Erythranthe 
guttata]
Length=401

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  253  ILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFN  432
            IL E GGTF+ + P + N+DMLIT DP NI HI S+NF+NYPKG QFR+IFD+LGD IFN
Sbjct  42   ILSECGGTFQMRFPRIFNMDMLITSDPLNIDHIFSKNFANYPKGRQFREIFDILGDSIFN  101

Query  433  VDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            VD +LWEF RKTT SF     F++LLE+ VW KV+NGLLP+LD F +
Sbjct  102  VDDELWEFQRKTTHSFMTGPEFNSLLESVVWQKVENGLLPVLDYFLQ  148



>ref|XP_010555338.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=564

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 93/146 (64%), Gaps = 0/146 (0%)
 Frame = +1

Query  124  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  303
            CF      +   S   +   W ++GMLP L+    R++ +  D+L+ S  TF FKGP L 
Sbjct  70   CFLIFGFLLFKKSNRDVLTNWPILGMLPSLVVQIPRVYDWSVDVLEASNLTFLFKGPWLA  129

Query  304  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  483
             +D+L+T DPANIHHI+S NF NYPKG +F++IFDVLGDGIFNVDS LW+  RK+  + F
Sbjct  130  GMDLLVTVDPANIHHIMSSNFKNYPKGHEFKKIFDVLGDGIFNVDSDLWKDLRKSAQTMF  189

Query  484  NHAHFHTLLETNVWHKVQNGLLPLLD  561
            NH  F T        K++ GLLPLLD
Sbjct  190  NHQDFQTFTVRTSISKLEKGLLPLLD  215



>ref|XP_006470474.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
Length=510

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 98/158 (62%), Gaps = 1/158 (1%)
 Frame = +1

Query  103  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGTF  279
            +I  FL  F  + +    S R++  R W V+GMLPGLL N    H+F+  D+LK++ GTF
Sbjct  2    IIAIFLISFLIIVLHWSWSDRNSPMRNWPVLGMLPGLLANTWHFHEFLAHDVLKKNRGTF  61

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
            EF GP    +D++IT DP N+H+I S+NFSNYPKGP FR I + LGDG+ N D  LW+  
Sbjct  62   EFTGPWFAQMDLIITSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDGVLNADGDLWKIQ  121

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RK   S   H  F + LE     K++ GL+P+LD  +E
Sbjct  122  RKIIHSVMKHNKFESALEKVAHQKMETGLIPVLDHASE  159



>ref|XP_009101870.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=515

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            P  W  +G++PGLL   HR++ F+T+IL+ +  T+  KGP    LDML+T DP+NIHHI+
Sbjct  33   PTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYFCKGPCYAGLDMLVTVDPSNIHHIM  92

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NFSNYPKGP+F+++FDVLGDGIFN DS+LW+  RK+  S   H  F          K+
Sbjct  93   SSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMHPEFQKFSLATSMSKL  152

Query  535  QNGLLPLLDSFA  570
            + GL+PLLD  A
Sbjct  153  EKGLVPLLDHAA  164



>ref|XP_006285710.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
 gb|EOA18608.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
Length=513

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            P  W  +GM+PGLL   HR++ FVT++L+ +  T+   GP    LDMLIT DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTEVLEVTNLTYPCVGPCFAGLDMLITVDPANIHHIM  92

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NF+NYPKGP+F+++FDVLGDGIFN DS+LW+  RK+  S   +  F         +K+
Sbjct  93   SSNFANYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSLNKL  152

Query  535  QNGLLPLLDSFAE  573
            + GL+PLLD  A+
Sbjct  153  EKGLVPLLDHVAK  165



>gb|KDO55118.1| hypothetical protein CISIN_1g036278mg, partial [Citrus sinensis]
Length=316

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            R   V+GMLPGLL N  RLH+F+T D+LK+  GTFEF GP    +D++IT DP N+H+I 
Sbjct  2    RNRPVLGMLPGLLGNTWRLHEFLTHDVLKKKRGTFEFTGPWFAQMDLIITSDPMNVHYIS  61

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S+NFSNYPKGP FR I + LGDG+FN D  LW+  RK   S   H  F + +E     K+
Sbjct  62   SKNFSNYPKGPDFRMIMEPLGDGVFNADGDLWKIQRKIIHSVMKHKKFESAVEKVAHQKL  121

Query  535  QNGLLPLLDSFAE  573
            + GL+P+LD  +E
Sbjct  122  ETGLIPVLDHASE  134



>gb|KDO37689.1| hypothetical protein CISIN_1g047842mg [Citrus sinensis]
Length=465

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 98/159 (62%), Gaps = 1/159 (1%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGT  276
             +I  FL  F  + +    S R++  R W V+GMLPGLL N    H+F+  D+LK++ GT
Sbjct  1    MIIAIFLISFLIIVLHWSWSDRNSPMRNWPVLGMLPGLLANTWYFHEFLAHDVLKKNRGT  60

Query  277  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  456
            FEF GP    +D++IT DP N+H+I S+NFSNYPKGP FR I + LGDG+ N D  LW+ 
Sbjct  61   FEFTGPWFAQMDLIITSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDGVLNADGDLWKI  120

Query  457  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             RK   S   H  F + LE     K++ GL+P+LD  +E
Sbjct  121  QRKIIHSVMKHNKFESALEKVAHQKMETGLIPVLDHASE  159



>gb|KDO37445.1| hypothetical protein CISIN_1g036716mg, partial [Citrus sinensis]
Length=208

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 94/156 (60%), Gaps = 13/156 (8%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            +F F+GC    K     SSR+          ML  L+ NAH+LH+F T +L++S GT EF
Sbjct  6    LFIFIGCLWSFK----RSSRTR---------MLSTLVLNAHQLHEFATRVLQKSRGTLEF  52

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP    +D +IT DP N+H+I S+NFSNYPKGP  R I +  GDG+F  D  LW+  RK
Sbjct  53   KGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRK  112

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               S   H  F + LE  ++ K++NGL+P+LD  +E
Sbjct  113  MIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASE  148



>ref|XP_006294050.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
 gb|EOA26948.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
Length=508

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            +PR W V+GMLPG+L   HR++ +V ++L+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLIMLHRINDYVAEVLEVSSLTFVFKGPWFSGMNMLITADPANIQHV  90

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
             S NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK++L   +H  F +     +  K
Sbjct  91   FSSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSSLVVLSHQGFQSFSLRTITRK  150

Query  532  VQNGLLPLLDSFAE  573
            ++ G++P+LD FAE
Sbjct  151  IKYGVVPVLDHFAE  164



>ref|XP_002878579.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54838.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            +PR W V+GMLPG+L+  H ++ +V +IL+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLFMLHMINDYVAEILEVSNLTFAFKGPWFTGMNMLITADPANIQHV  90

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
               NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F +     +  K
Sbjct  91   FCSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITRK  150

Query  532  VQNGLLPLLDSFAE  573
            ++NGL+P+LD F+E
Sbjct  151  IKNGLVPVLDHFSE  164



>ref|XP_010446494.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=519

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W ++GMLPGLL    R++ F+T++L++    F FKGP LG LDML T DPANIHHI+S N
Sbjct  36   WPILGMLPGLLPELPRVYDFITELLEDGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSN  95

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK + S  +H  F          K++ G
Sbjct  96   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKFSQSMMSHPEFQRFSLATSLSKLEKG  155

Query  544  LLPLLDSFAE  573
            L+PLLD  A+
Sbjct  156  LVPLLDHVAK  165



>ref|XP_010027341.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62208.1| hypothetical protein EUGRSUZ_H04869 [Eucalyptus grandis]
Length=505

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 95/153 (62%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C++ +++ S S   IPR W +VGMLP LL N    H + T +++ S G F F+  
Sbjct  10   FLAGICFLVLRLLSKSDDGIPRNWPLVGMLPALLLNLSHFHDWATGVVERSQGNFFFRFH  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +++L+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMEILLTADPANVHYIMSTNFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F     FH  L   +  K +NGLL +LD  ++
Sbjct  130  VFMKDQRFHQFLSLTIRDKAENGLLRVLDELSK  162



>emb|CDY53181.1| BnaA06g40600D [Brassica napus]
Length=510

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPR---KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            FC++  ++   S+   P     W  +GMLPGLL    R++ F+T++L+     + FKGP 
Sbjct  14   FCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLLLEIPRVYDFITEVLEHGNLNYLFKGPF  73

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
            LG LDML T DPANIHHI+S NFSNYPKG +F+++FDVLGDGIFNVDS+LW+  RK+  S
Sbjct  74   LGGLDMLFTVDPANIHHIMSSNFSNYPKGTEFKKLFDVLGDGIFNVDSELWKDLRKSAQS  133

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               +  F +       +K++ GL+PLLD  A+
Sbjct  134  MMMNPEFQSFSIATSLNKLEKGLVPLLDHVAK  165



>ref|XP_009101871.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=510

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPR---KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            FC++  ++   S+   P     W  +GMLPGLL    R++ F+T++L+     + FKGP 
Sbjct  14   FCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLLLEIPRVYDFITEVLEHGNLNYLFKGPF  73

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
            LG LDML T DPANIHHI+S NFSNYPKG +F+++FDVLGDGIFNVDS+LW+  RK+  S
Sbjct  74   LGGLDMLFTVDPANIHHIMSSNFSNYPKGTEFKKLFDVLGDGIFNVDSELWKDLRKSAQS  133

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               +  F +       +K++ GL+PLLD  A+
Sbjct  134  MMMNPEFQSFSIATSLNKLEKGLVPLLDHVAK  165



>emb|CDX72698.1| BnaC07g47200D [Brassica napus]
Length=449

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 103/164 (63%), Gaps = 7/164 (4%)
 Frame = +1

Query  103  MIFSFLGCF-------CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILK  261
            MI  FL  F        +  + +   +   +P  W+V+GMLPGLL   HR++ ++T++L+
Sbjct  3    MIIGFLDIFIAFIFFLVFRCLLLYKQTHKPLPTNWSVLGMLPGLLLQVHRIYDWITELLE  62

Query  262  ESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDS  441
             +G TF FKGP L   D+L+T DP NIH+ILS NF NYPKG +F++IF+V+GD IFN+DS
Sbjct  63   ATGMTFCFKGPWLSGTDILLTVDPVNIHYILSSNFVNYPKGMEFKKIFEVIGDAIFNIDS  122

Query  442  QLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             +WE  R ++ + F+   F  L  +    K+  GL+P+LD+  E
Sbjct  123  GMWEDMRNSSHAIFSRQDFQRLWVSTSVSKINQGLVPILDNAVE  166



>ref|XP_009759095.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            F+  FC+         RS +P  W  +GM PGLL++ +R+H+   ++   +GGT+  KGP
Sbjct  16   FVAIFCFFVF-CALGDRSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSRTGGTYLLKGP  74

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
               N+D+L T DPAN+H+I+S  F N+PKG +F++IFDVLGDGIFN D  LW+  RK T 
Sbjct  75   WFANMDILGTVDPANVHYIMSAKFENFPKGEEFKKIFDVLGDGIFNSDLDLWKTQRKITR  134

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
            +   H  FH  L    W K++NGL+ +L+  A
Sbjct  135  TLITHQRFHNCLVKTSWDKIENGLISVLEFVA  166



>ref|XP_006283543.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
 gb|EOA16441.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
Length=518

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W  +GMLPGLL    R++ F+T++L+++   + FKGP LG +DML T DPANIHHI+S N
Sbjct  37   WPFLGMLPGLLTQLPRVYDFLTEVLEDANLNYLFKGPFLGGIDMLFTVDPANIHHIMSSN  96

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK++ S  +H  F          K++ G
Sbjct  97   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQRFTLDTSLSKLEKG  156

Query  544  LLPLLDSFAE  573
            L+PLLD  A+
Sbjct  157  LVPLLDHVAK  166



>gb|EYU24048.1| hypothetical protein MIMGU_mgv1a026886mg [Erythranthe guttata]
Length=509

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 93/154 (60%), Gaps = 9/154 (6%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F+ F F+ CF          + + +P  W VVGMLP L  + HR+H    DILK +GGTF
Sbjct  16   FIFFLFVWCF---------RNINGLPWNWPVVGMLPSLFCHLHRVHHRCVDILKLAGGTF  66

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
              KGP   N D++IT DPANIH I+S NF+N+PKGP F++IFDVLGDGIFN DS  W   
Sbjct  67   HLKGPSFANSDIIITADPANIHFIMSSNFANFPKGPHFKEIFDVLGDGIFNADSDSWARQ  126

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
            RK   +   H  F   L      KV++ L+P+L+
Sbjct  127  RKQARALITHDSFRRFLIRTTSEKVRHSLIPVLE  160



>ref|XP_010446495.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            P  W  +GM+PG+L   HR++ FVTDIL+ +  T+   GP+   LDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGMLAEIHRVYDFVTDILEVTNLTYPCVGPLFSGLDMLVTVDPANIHHIM  92

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NF+NYPKGP+F+++FDVLGDGIFN DS LW+  RK+  +   +  F         +K+
Sbjct  93   SSNFANYPKGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQNMMMNPEFQKFSLATSLNKL  152

Query  535  QNGLLPLLDSFA  570
            + GL+PLLD  A
Sbjct  153  EKGLVPLLDHAA  164



>emb|CDX72695.1| BnaC07g47170D [Brassica napus]
Length=510

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 3/152 (2%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPR---KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            FC++  ++   S+   P     W  +GMLPGL+    R++ F+T++L+     + FKGP 
Sbjct  14   FCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLILEIPRVYDFITEVLEHGNLNYLFKGPF  73

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
            LG LDML T DPANIHHI+S NFSNYPKG +F+++FDVLGDGIFNVDS+LW+  RK+  S
Sbjct  74   LGGLDMLFTVDPANIHHIMSSNFSNYPKGAEFKKLFDVLGDGIFNVDSELWKDLRKSAQS  133

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               +  F +        K++ GL+PLLD  A+
Sbjct  134  MMMNPEFQSFSIATSLSKLEKGLVPLLDHVAK  165



>ref|XP_010027235.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
Length=237

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 91/153 (59%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+    +   S   +P+ W +VGMLP L  N  R H + T +L++S   F F+  
Sbjct  10   FLATICFAVFHLLGKSHDGLPKNWPLVGMLPALFLNLGRGHDWATGVLEQSRCNFLFRFH  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +D+L+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGI N DS +W   R+   
Sbjct  70   WFSGMDVLVTADPANVHYIMSTNFENFPKGPEFKRVFDILGDGILNSDSDMWRMQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F N   F   L T    KV+NGLL +LD  ++
Sbjct  130  VFMNDQRFCRFLATTTRDKVENGLLRVLDELSQ  162



>ref|XP_010472325.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=282

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 88/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W  +GMLPG L    R++ ++T++L+ S  T+ FKGP  GNLDML T DPANIHHI+S N
Sbjct  70   WLFLGMLPGFLMEIPRVYDYMTELLEASNLTYLFKGPCFGNLDMLFTVDPANIHHIMSSN  129

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK+  S   +  +          K++ G
Sbjct  130  FANYPKGSEFKKLFDVLGDGIFNADSELWKDLRKSAQSIMRNPEYQRFTLRTSMSKLEKG  189

Query  544  LLPLLDSFAE  573
            L+P L+  AE
Sbjct  190  LVPFLNHVAE  199



>ref|XP_011100902.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 100/160 (63%), Gaps = 10/160 (6%)
 Frame = +1

Query  103  MIFSFLGCF---CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGG  273
            ++F+ L CF   C+       S+ + +P  W +VGMLP + ++ +++H    +I ++ GG
Sbjct  11   ILFALLCCFLVWCF-------SNINGMPWNWPLVGMLPSVFWHVNQIHDRCVNIFEQVGG  63

Query  274  TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWE  453
            TF  KGP   N+D++ T DPAN+H I+S NF+N+PKG +F++IFDVLGDGIFN D+ LW 
Sbjct  64   TFLLKGPWFANMDIIATADPANVHFIMSANFANFPKGAEFKKIFDVLGDGIFNSDADLWR  123

Query  454  FHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
              RK   +   H  F   L    W KV+ GL+P+L+  +E
Sbjct  124  SQRKQARALITHERFRKFLIKTSWEKVEKGLIPVLEHVSE  163



>ref|XP_006405740.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
 gb|ESQ47193.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
Length=516

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            + R W V+GMLP LL   HR++ F+ +IL+ S  TF+FKG     +DMLIT DPANIH+I
Sbjct  31   LARNWPVLGMLPDLLMALHRVYDFLAEILEMSNLTFQFKGLWFAGMDMLITVDPANIHYI  90

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            LS NFSNY KGP+F+++FDV  D IFN DS+LW+  RK   S  NH  F     T    K
Sbjct  91   LSSNFSNYTKGPEFKEVFDVFKDVIFNTDSELWKNLRKAAQSRLNHQGFQRFSVTATRSK  150

Query  532  VQNGLLPLLDSFAE  573
            ++NGL+PL D FA+
Sbjct  151  LKNGLVPLFDHFAK  164



>ref|XP_011041669.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=507

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 98/153 (64%), Gaps = 2/153 (1%)
 Frame = +1

Query  103  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  282
            + F+F+   C +   +  ++   +P  W +VGMLP LL + HR H  VTD+L++S  TF+
Sbjct  9    IFFAFICVLCSLIFCLRKNN--VLPMNWPLVGMLPSLLVHVHRFHDHVTDVLEQSKCTFQ  66

Query  283  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  462
            FKGP  G++D+L+T DPANIH+I+S NFSN+ KG  F + FD+LG GI N D  LW+  R
Sbjct  67   FKGPWFGDMDILVTADPANIHYIMSSNFSNFEKGSDFNKRFDILGHGILNADRDLWKNQR  126

Query  463  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
            K   +  NH  F+  L   +  KV+ GL+P+L+
Sbjct  127  KVAQALVNHRLFYQRLVKTIQDKVERGLIPVLE  159



>ref|XP_006405739.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
 gb|ESQ47192.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
Length=516

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            + R W V+GMLP LL   HR++ F+ +IL+ S  TF+FKG     +DMLIT DPANIH+I
Sbjct  31   LARNWPVLGMLPDLLMALHRVYDFLAEILEMSNLTFQFKGLWFAGMDMLITVDPANIHYI  90

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            LS NFSNY KGP+F+++FDV  D IFN DS+LW+  RK   S  NH  F     T    K
Sbjct  91   LSSNFSNYTKGPEFKEVFDVFKDVIFNTDSELWKNLRKAAQSRLNHQGFQRFSVTATRSK  150

Query  532  VQNGLLPLLDSFAE  573
            ++NGL+PL D FA+
Sbjct  151  LKNGLVPLFDHFAK  164



>gb|EYU24049.1| hypothetical protein MIMGU_mgv1a004847mg [Erythranthe guttata]
Length=507

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESG-GTFEFKGPVLGNLDMLITCDPANIHHILSR  360
            W ++GMLPGLL N  R+H+  T++L++S  GTF F+GP   N+DML T DP NIH+I++ 
Sbjct  34   WPLIGMLPGLLLNVGRIHEICTEVLRKSRRGTFHFQGPCFANMDMLWTVDPENIHYIMTS  93

Query  361  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQN  540
            NF N+PKGP+FR+IFDVLGDGIFN D   W+  R  + +   H  FH  L      KV+ 
Sbjct  94   NFRNFPKGPEFREIFDVLGDGIFNSDDDSWKDQRNVSRALITHRSFHRFLAVISREKVEK  153

Query  541  GLLPLLDSFA  570
            GL+P+L+  A
Sbjct  154  GLIPVLEKAA  163



>gb|KCW62188.1| hypothetical protein EUGRSUZ_H04845 [Eucalyptus grandis]
Length=415

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 91/153 (59%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C++ + +   S   +P  W +VGMLP L  N   +H + T IL+ S   F F+  
Sbjct  10   FLAVICFVVLCLLGKSDDGLPNNWPLVGMLPALCLNLSHVHDWATGILERSRCNFLFRFH  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +DML+T DPAN+H+I+S NF N+P GP+F+++FDVLGDGIFN DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPNGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F N   FH  L      KV+NGLL +LD  ++
Sbjct  130  VFMNDQRFHRFLAKTTRDKVENGLLRVLDELSQ  162



>ref|XP_010027339.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62202.1| hypothetical protein EUGRSUZ_H04860 [Eucalyptus grandis]
Length=507

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 91/153 (59%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+  + +   S   +P  W +VGMLP L  N   +H + T IL+ S   F F+  
Sbjct  10   FLAVICFAVLCLLGKSDDGLPNNWPLVGMLPALWLNLSHVHDWATGILERSCCNFLFRFH  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FDVLGDGIFN DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F N   FH  L      KV+NGLL +LD  ++
Sbjct  130  VFMNDQRFHRFLAKTTRDKVENGLLRVLDELSQ  162



>ref|XP_010027331.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62195.1| hypothetical protein EUGRSUZ_H04853 [Eucalyptus grandis]
Length=507

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 91/153 (59%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+  + +   S   +P  W +VGMLP L  N   +H + T IL+ S   F F+  
Sbjct  10   FLAVICFAVLCLLGKSDDGLPNNWPLVGMLPALWLNLSHVHDWATGILERSCCNFLFRFH  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FDVLGDGIFN DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F N   FH  L      KV+NGLL +LD  ++
Sbjct  130  VFMNDQRFHRFLAKTTRDKVENGLLRVLDELSQ  162



>gb|KFK30509.1| hypothetical protein AALP_AA7G271200 [Arabis alpina]
Length=447

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLPGLL    R++ F T+IL+++   F FKGP LG LDMLIT DPANIHHI+S NF+NYP
Sbjct  1    MLPGLLVEIPRVYDFATEILEDANLNFPFKGPFLGGLDMLITVDPANIHHIMSSNFANYP  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KG +F+++FDVLGDGIFN DS+LW+  RK+  S   +  F          K++ GLLPLL
Sbjct  61   KGTEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQNFSLATSLSKLEKGLLPLL  120

Query  559  DSFAE  573
            D  A+
Sbjct  121  DHVAK  125



>ref|XP_010652863.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=502

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 94/149 (63%), Gaps = 1/149 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
             L   C++ +   S+S + +P  W +VGMLP +  N  ++    T++L++S GTF  KGP
Sbjct  10   LLAVICFLLLHRLSNS-NMLPWNWPLVGMLPWIFRNIQQIQDRCTEVLEQSSGTFLLKGP  68

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
               N+DMLIT DPAN+H+I+S NFSN+PKGP+F +IFDVLG+GIFN DS LW   RK   
Sbjct  69   WFANMDMLITSDPANVHYIMSTNFSNFPKGPEFLKIFDVLGEGIFNSDSDLWRKQRKLAQ  128

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
               N   F   L     +KV  GL+P+L+
Sbjct  129  VLINDRQFQQFLVKTTENKVDEGLIPVLE  157



>ref|XP_006405689.1| hypothetical protein EUTSA_v10028261mg, partial [Eutrema salsugineum]
 gb|ESQ47142.1| hypothetical protein EUTSA_v10028261mg, partial [Eutrema salsugineum]
Length=538

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R W V+GMLPGLL   H++++F   IL++S  TF FKGP    +DML T D ANIHHI+S
Sbjct  46   RNWPVLGMLPGLLVEFHQIYEFTVRILRKSNLTFTFKGPWCSGMDMLFTVDQANIHHIMS  105

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KGP F+++FDVLGDGI   DS+LW+  RK +   F+H  +     +    K+ 
Sbjct  106  SNFSNYTKGPDFKEVFDVLGDGILTADSELWKNLRKASKVMFSHQGYQRFSMSTTRRKIN  165

Query  538  NGLLPLLDSFAE  573
            +GL+PL D FA+
Sbjct  166  DGLVPLFDHFAK  177



>ref|XP_010027344.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62209.1| hypothetical protein EUGRSUZ_H04870 [Eucalyptus grandis]
Length=507

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 92/153 (60%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+  + + S S    PR W +VGMLP L  N  R+H + T +++ S G F F+  
Sbjct  10   FLAGICFAVLCLLSKSDDGFPRNWPLVGMLPALFLNLSRVHDWATGLVERSHGNFFFRSL  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
               ++DML+T DPAN H+I+S NF N+PKGP+F+++FD+LGDGI N DS LW   R+   
Sbjct  70   WFSSMDMLVTADPANFHYIMSANFGNFPKGPEFKRVFDILGDGIINSDSNLWSTQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F     FH  L +    K +NGLL +LD  ++
Sbjct  130  VFMKDQRFHRFLLSTTRDKAENGLLRVLDELSQ  162



>gb|KCW62190.1| hypothetical protein EUGRSUZ_H04847 [Eucalyptus grandis]
Length=502

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 92/153 (60%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+  +++   S   +P+ W +VGMLP L  N  R+H +VT  L+ S G F F+  
Sbjct  10   FLAAICFAFLRLLGKSHDGLPKNWPLVGMLPALFLNLGRVHDWVTGFLERSHGNFLFRFH  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +DML+T DPAN+H+I+S NF N+PKG +F+++FDVLGDGI N DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDGILNSDSDMWRMQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F N   F   L      KV+NGLL +LD  ++
Sbjct  130  VFMNDRRFCRFLAKTTRDKVENGLLRVLDELSQ  162



>gb|KJB71270.1| hypothetical protein B456_011G113900 [Gossypium raimondii]
Length=506

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 97/158 (61%), Gaps = 8/158 (5%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F+ F FLGC          +S+   P  + +VGM+P LL N HR+H + T+IL+    T 
Sbjct  13   FICFLFLGCL--------KNSKDGQPINFPLVGMMPQLLLNVHRIHDWCTEILQMCHCTS  64

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
             F GP    ++ L+TCDPAN+H+++  NF N+PKG  F +IF++LGDGIFN D  LW++ 
Sbjct  65   LFMGPWFTQMNFLLTCDPANVHYVMISNFHNFPKGSDFMEIFEILGDGIFNADMDLWKYQ  124

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RK    F  H  FH LL T    KV+NGL+P+L+  A+
Sbjct  125  RKVAQEFVRHQLFHRLLSTASRAKVENGLIPVLEHVAK  162



>ref|XP_006370230.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
 gb|ERP66799.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
Length=519

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 93/152 (61%), Gaps = 0/152 (0%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            +   L CF  ++   +     A  R W +VGMLP LL N+  ++++ T  L+ +GGT +F
Sbjct  9    VVGVLVCFLLLRCWDQIRKLDADKRNWPIVGMLPRLLINSSNVYEYTTRTLRNNGGTSKF  68

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP   N+D +IT DP N+HHILS NF+NYPKGP +++IF+ LGDGI N DS+ W   RK
Sbjct  69   KGPWFANMDFVITSDPKNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRK  128

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
                F  +  +  L+E  +  K+  GL P+LD
Sbjct  129  MIQLFMKNNKYKELVEKTILQKLVQGLFPILD  160



>ref|XP_007048137.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92294.1| Cytochrome P450 [Theobroma cacao]
Length=509

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 98/154 (64%), Gaps = 1/154 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKE-SGGTFEFKG  291
             L   C++ +    ++    P+ + +VGM+PGLL N HR+H + T+IL+     T+ F+G
Sbjct  10   LLAIICFLFLFCLRNNVHGTPKNFPLVGMMPGLLLNTHRIHDWCTEILERCQCSTYLFQG  69

Query  292  PVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTT  471
            P    ++ML+TCDPANIH+I+S NF N+PKG +F++IFD+LGDGIFN D  LW+  RK  
Sbjct  70   PWFAKMNMLVTCDPANIHYIMSSNFCNFPKGSEFKEIFDILGDGIFNADMDLWKKQRKAA  129

Query  472  LSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
              F  H  F+  L      KV+ GL+P+L+  A+
Sbjct  130  QGFMRHQLFYLFLLRTSRAKVEKGLIPVLEHVAK  163



>gb|EYU33779.1| hypothetical protein MIMGU_mgv1a018283mg [Erythranthe guttata]
Length=454

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +1

Query  226  HRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIF  405
            HR H+ +T +L E GGT+  +GP    +++L T DPANI HI S+ FSNYPKG +FR  F
Sbjct  2    HRAHEKITQVLNERGGTYLLRGPWFFRIEILFTSDPANIQHIFSKRFSNYPKGTEFRNKF  61

Query  406  DVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
            ++LGDGIF+ D ++WE  R+T LS  +HA FHT LE NVW K++ GL+P+LD F+
Sbjct  62   EILGDGIFSSDFEMWELQRRTILSLISHAKFHTSLERNVWEKIETGLIPVLDYFS  116



>ref|XP_009101866.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=505

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 94/150 (63%), Gaps = 0/150 (0%)
 Frame = +1

Query  124  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  303
            CF  +   +        PR W V+GMLPGLL + HRL+ +  +IL+ S  TF  KGP   
Sbjct  15   CFLILFYLLFKKPHDRFPRNWPVLGMLPGLLVSLHRLYDYSVEILEISDLTFLLKGPRFF  74

Query  304  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  483
             +DML+T DPANIHHI+S NFSNY KGP+F  +FDV GDGI   DS+LW   R++  +  
Sbjct  75   GMDMLVTVDPANIHHIMSSNFSNYIKGPEFHDVFDVFGDGILTADSELWRNLRRSYQAMV  134

Query  484  NHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +H  F     + +  K+++GL+PLL+ FAE
Sbjct  135  HHQGFQKFSVSTMTSKLKDGLVPLLNHFAE  164



>ref|XP_006404644.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
 gb|ESQ46097.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
Length=513

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            +PR W ++GMLPG++   HR++ ++ +IL+ S  TF FKGP    ++MLIT DPAN+ H+
Sbjct  31   LPRNWPLLGMLPGVVVMLHRINGYLAEILEVSNLTFVFKGPWFSGMNMLITADPANVQHV  90

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
             S NFSNY KG +F+++FD LG+GIF  DS+LWE  R+++L   +H  F +     +  K
Sbjct  91   FSSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSLVMLSHQGFQSFSLKTIASK  150

Query  532  VQNGLLPLLDSFAE  573
            ++NGL P+LD FAE
Sbjct  151  IKNGLAPVLDHFAE  164



>ref|XP_006404787.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
 gb|ESQ46240.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
Length=515

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 110/170 (65%), Gaps = 4/170 (2%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            MA  +LL + + F+ FSFL  +  +  K   S     P KW ++GMLPGLL    R++ +
Sbjct  1    MALLSLLEVSVSFLCFSFLFGYFLISKKPHRS----FPTKWPLLGMLPGLLVEIPRVYDY  56

Query  244  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  423
            +T++L+ S  TF FKGP  G LDMLIT DPANIHHI+S NF+NYPKG +F++IFDVLGDG
Sbjct  57   ITEVLEASNLTFPFKGPSFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116

Query  424  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            IFN DS LW+  RK+  S  +H  F          K++ GL+PLLD  AE
Sbjct  117  IFNADSDLWKDLRKSAQSMMSHQEFQRFTLRTSMSKLEKGLVPLLDHVAE  166



>ref|XP_010681074.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 96/155 (62%), Gaps = 10/155 (6%)
 Frame = +1

Query  106  IFSFLGCF---CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGT  276
            IF  + CF   CY+       +R  IP  W  +GMLP +L + HR H    DIL+ +  +
Sbjct  10   IFLAVVCFFLICYL-------TRHGIPWNWPFLGMLPSILIHLHRTHHRCVDILQGNNCS  62

Query  277  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  456
            F FKGP   N+D L+T DPANI HI+S NF+NYPKG +F +IFD+LG+GIFN D +LW+ 
Sbjct  63   FLFKGPWFANMDFLMTVDPANIQHIMSSNFTNYPKGEEFLKIFDILGNGIFNSDGELWKL  122

Query  457  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
             RK T +  NH  F   L    ++KVQ GL+P+L 
Sbjct  123  QRKITRALINHRSFIRFLVKITYNKVQKGLVPILQ  157



>ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40964.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 89/139 (64%), Gaps = 1/139 (1%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNA-HRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  336
            SR  +   W VVGM+PGLL+     +H F T +L+ SGGT  F+GP    ++ L+T DP 
Sbjct  23   SRGLVVTNWPVVGMIPGLLFRPISSVHDFATYVLQRSGGTLLFQGPWFSGMNFLMTSDPM  82

Query  337  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  516
            N+ +I+S+NF+NYPKGP FRQIF+VLGDGIFNVDS  W   R+   S      FH  +E 
Sbjct  83   NVQYIVSKNFANYPKGPDFRQIFEVLGDGIFNVDSDSWRIQRRIMHSLLKSKRFHLAVER  142

Query  517  NVWHKVQNGLLPLLDSFAE  573
             V HK+  GL  +LD+ +E
Sbjct  143  TVEHKILKGLFVVLDNVSE  161



>emb|CAB44684.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80612.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=479

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            M+PGLL   HR++ F+T+IL+ +  T+   GP   NLDML+T DPANIHHI+S NF+NYP
Sbjct  1    MIPGLLVEIHRVYDFITEILEVTNLTYPCTGPCFANLDMLVTVDPANIHHIMSSNFANYP  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KGP+F+++FD+LGDGIFN DS+LW+  RK+  S   +  F          K++ GL+PLL
Sbjct  61   KGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSLKKLEKGLVPLL  120

Query  559  DSFAE  573
            D  A+
Sbjct  121  DHVAK  125



>ref|XP_010027335.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62199.1| hypothetical protein EUGRSUZ_H04857 [Eucalyptus grandis]
Length=507

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 91/153 (59%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+  +++ S     +P+ W +VGMLP LL N    H++ T  L+ S G F  +  
Sbjct  10   FLAGICFAVLRLLSKRDDGLPKNWPLVGMLPALLLNLSHFHEWATGFLERSRGNFFLRFH  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +DML T DPAN+H+ILS NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMDMLFTADPANVHYILSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F     FH  L      K++NGLL +LD  ++
Sbjct  130  VFMKDLRFHRFLLMTTRDKLENGLLRVLDELSQ  162



>ref|XP_009107985.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=502

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            +P  W V+GMLPGLL + +R++  +T++L+ S  TF FKGP L   D+LIT DPANI +I
Sbjct  33   LPTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYI  92

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            LS NF NYPKG +F+QIF+VLGD IFNVDS+LWE  R ++ + F+H  F          K
Sbjct  93   LSSNFDNYPKGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQRFWVNTSVSK  152

Query  532  VQNGLLPLLDSFAE  573
            +  GL+P+L++  E
Sbjct  153  LNQGLVPILENAVE  166



>emb|CDY53177.1| BnaA06g40560D [Brassica napus]
Length=518

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R   V+ MLPGLL   HR+H F   IL+ SG TF FKGP    +DML+T DP NIHHI+S
Sbjct  50   RNLPVLRMLPGLLMTLHRIHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMS  109

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KGP  ++IFDV GDGIF  DS++W+  RK+  S  +H  F     + +  K++
Sbjct  110  SNFSNYIKGPGLQEIFDVFGDGIFTTDSEMWKNLRKSIQSMLHHQEFQRFSMSTMTSKLK  169

Query  538  NGLLPLLDSFAE  573
            +GL+PLL+ FAE
Sbjct  170  SGLVPLLNHFAE  181



>ref|XP_006470473.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|KDO37420.1| hypothetical protein CISIN_1g043945mg [Citrus sinensis]
Length=518

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 95/157 (61%), Gaps = 15/157 (10%)
 Frame = +1

Query  106  IFSFLGC-FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  282
            +F  +GC +C+ +     SSR+          ML  L+ N H+LH+F T +LK+S GT E
Sbjct  15   LFILIGCLWCFKR-----SSRTR---------MLSTLVLNTHQLHEFATRVLKKSRGTLE  60

Query  283  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  462
            FKGP    +D +IT DP N+H+I S+NFSNYPKGP  R I +  GDG+F  D  LW+  R
Sbjct  61   FKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQR  120

Query  463  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            K   S   H  F + LE  ++ K++NGL+P+LD  +E
Sbjct  121  KMIHSVMKHKKFESALEKTIYQKLENGLIPVLDHASE  157



>emb|CDY44658.1| BnaA08g06820D [Brassica napus]
Length=502

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            +P  W V+GMLPGLL + +R++  +T++L+ S  TF FKGP L   D+LIT DPANI +I
Sbjct  33   LPTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYI  92

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            LS NF NYPKG +F+QIF+VLGD IFNVDS+LWE  R ++ + F+H  F          K
Sbjct  93   LSSNFDNYPKGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQRFWVNTSVSK  152

Query  532  VQNGLLPLLDSFAE  573
            +  GL+P+L++  E
Sbjct  153  LNQGLVPILENAVE  166



>ref|XP_009101865.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=518

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R   V+ MLPGLL   HR+H F   IL+ SG TF FKGP    +DML+T DP NIHHI+S
Sbjct  50   RNLPVLRMLPGLLMTLHRIHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMS  109

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KGP  ++IFDV GDGIF  DS++W+  RK+  S  +H  F     + +  K++
Sbjct  110  SNFSNYIKGPGLQEIFDVFGDGIFTTDSEMWKNLRKSIQSMLHHQEFQRFSMSTMTSKLK  169

Query  538  NGLLPLLDSFAE  573
            +GL+PLL+ FAE
Sbjct  170  SGLVPLLNHFAE  181



>gb|KDP35260.1| hypothetical protein JCGZ_09419 [Jatropha curcas]
Length=506

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 89/138 (64%), Gaps = 0/138 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
            +++  P  W V GMLP  LY+ HR+HQ  T++L+ +G T  +KGP   N+ +L T DP N
Sbjct  24   NKNGQPINWPVFGMLPDTLYHLHRIHQRTTEVLERAGSTLYYKGPWFSNVKILATVDPTN  83

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            IH+I+S NFSN+PKGP+F +IFD+LGDGIFN DS  W+  RK   +  N   FH  L   
Sbjct  84   IHYIMSSNFSNFPKGPEFSKIFDILGDGIFNSDSNSWKNQRKLAHTLINRGCFHKFLINT  143

Query  520  VWHKVQNGLLPLLDSFAE  573
                V+ GLLP+L+  ++
Sbjct  144  CQDMVEKGLLPVLEHVSD  161



>gb|EYU27555.1| hypothetical protein MIMGU_mgv1a020397mg [Erythranthe guttata]
Length=503

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  306
             CY K+   +      P  W V+GMLPG L N  R H+++T++L+++GGTF  KGP   N
Sbjct  10   LCYGKI-FHARKEKRTPTNWPVLGMLPGALANIGRPHEYITEVLQQNGGTFYHKGPWFTN  68

Query  307  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  486
            L+++ TCDP N+H+I ++NFSN+ KGP+F+++FD++G+GI   +S+ WE  R++  S  N
Sbjct  69   LNIMFTCDPVNVHYIQAKNFSNFQKGPEFKKMFDIMGEGILTAESESWENQRRSAKSLIN  128

Query  487  HAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +  F   + T   +K++  L+P+L+  +E
Sbjct  129  NTSFLEFVATTTSNKMETALIPILEVASE  157



>emb|CDX76962.1| BnaC08g35480D [Brassica napus]
Length=510

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            PR W ++GMLPG+L   H+++ ++ ++L+ S  TF FKGP    ++MLIT DPAN+ H+ 
Sbjct  32   PRNWPILGMLPGVLVMLHKINGYLVEVLEVSNLTFVFKGPWFSGMNMLITADPANVQHVF  91

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NFSNY KG +F+++FD LG+GIF  DS+LWE  R++++   +H  F +     +  K+
Sbjct  92   SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSMVMLSHQGFQSFSLKTIASKI  151

Query  535  QNGLLPLLDSFAE  573
            +NGL+P+LD FA+
Sbjct  152  KNGLVPVLDHFAK  164



>ref|XP_009108130.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=513

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 91/136 (67%), Gaps = 2/136 (1%)
 Frame = +1

Query  169  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  348
            + P  W  +GMLPGLL    R++ ++T+ L+ S  TF FKGP    ++ML T DPANIHH
Sbjct  32   SFPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVDPANIHH  91

Query  349  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTL-LETNVW  525
            I+S NF+NYPKG +F++IFDVLGDGIFN D  LW   RK+  S  +   F    L TN+ 
Sbjct  92   IMSSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRFTLRTNM-  150

Query  526  HKVQNGLLPLLDSFAE  573
             K++ GL+P+LD FAE
Sbjct  151  RKLEKGLVPILDHFAE  166



>emb|CDY27160.1| BnaA08g07980D [Brassica napus]
Length=513

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 91/136 (67%), Gaps = 2/136 (1%)
 Frame = +1

Query  169  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  348
            + P  W  +GMLPGLL    R++ ++T+ L+ S  TF FKGP    ++ML T DPANIHH
Sbjct  32   SFPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVDPANIHH  91

Query  349  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTL-LETNVW  525
            I+S NF+NYPKG +F++IFDVLGDGIFN D  LW   RK+  S  +   F    L TN+ 
Sbjct  92   IMSSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRFTLRTNM-  150

Query  526  HKVQNGLLPLLDSFAE  573
             K++ GL+P+LD FAE
Sbjct  151  RKLEKGLVPILDHFAE  166



>ref|XP_004237151.1| PREDICTED: cytochrome P450 86B1 [Solanum lycopersicum]
Length=506

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = +1

Query  166  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  345
            S  P  + + GMLPGLLYN  ++H+  T  +K SGGTF FKG    N+D L T DPAN+H
Sbjct  27   SNYPINFPIFGMLPGLLYNIQQIHERCTMSMKASGGTFLFKGLWFANMDTLTTVDPANVH  86

Query  346  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  525
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RK T S   H  F+  L     
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRSLITHHEFYKFLVKTSC  146

Query  526  HKVQNGLLPLLD  561
             KV+ GL+P++D
Sbjct  147  DKVEKGLIPVID  158



>ref|XP_010025512.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62204.1| hypothetical protein EUGRSUZ_H04862 [Eucalyptus grandis]
Length=507

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+  +++   S   +P+ W +VGMLP L  N   +H +VT  L+ S G F F+  
Sbjct  10   FLATICFAFLRLLGKSHDGLPQNWPLVGMLPALFLNLGSVHDWVTSFLERSRGNFLFRFH  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +DML+T DPAN+H+I+S NF N+PKG +F+++FDVLGDGI N DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDGILNSDSDVWRMQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F N   F   L      KV+NGLL +LD  ++
Sbjct  130  VFMNDQRFCQFLAKTTRDKVENGLLRVLDELSQ  162



>emb|CDY53182.1| BnaA06g40610D [Brassica napus]
Length=465

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 101/164 (62%), Gaps = 7/164 (4%)
 Frame = +1

Query  103  MIFSFLGCF-------CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILK  261
            MI  FL  F        +  + +   +   +P  W V+GMLPGLL   HR++ ++T++L+
Sbjct  3    MIIGFLDIFIAFIFFLVFRCLLLYKQTHKPLPTNWPVLGMLPGLLLQVHRIYDWITELLE  62

Query  262  ESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDS  441
             +G TF FKGP L   D+L+T DP NIH+ILS NF NYPKG +F++IF+V+GD IFN+DS
Sbjct  63   ATGMTFCFKGPWLSGTDILLTVDPVNIHYILSSNFVNYPKGMEFKKIFEVIGDAIFNIDS  122

Query  442  QLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             +WE  R ++ + F+   F  L  +    K+  GL+ +LD+  E
Sbjct  123  GMWEDMRNSSHAIFSRQDFQRLWVSTSVSKINQGLVHILDNAVE  166



>ref|XP_011043827.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=520

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 92/152 (61%), Gaps = 0/152 (0%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            +   L CF  ++   +     A    W VVGMLP LL N+  ++++ T  L+ +GGT +F
Sbjct  9    VVGVLVCFLLLRCWDQIRKLDADKANWPVVGMLPRLLINSSNVYEYTTQALRNNGGTSKF  68

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP   N+D +IT DP N+HHILS NF+NYPKGP +++IF+ LGDGI N DS+ W   RK
Sbjct  69   KGPWFANMDFVITSDPRNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRK  128

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
                F  +  +  L+E  +  K+  GL P+LD
Sbjct  129  MIQLFMKNNKYKGLVEKTILQKLVQGLFPILD  160



>ref|XP_010526618.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=513

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 86/133 (65%), Gaps = 0/133 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            PR    +GMLPGLL    R +    D+L++S  TF FKGP    +D+L T DPANIHH++
Sbjct  32   PRNLPFLGMLPGLLVAFDRFYDLAVDVLEKSNMTFPFKGPWFMGMDVLATVDPANIHHVM  91

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NF NYPKG  F++IFDV+GDGI NVD +LWE  RK+TL+ F+H  F          KV
Sbjct  92   SSNFGNYPKGDDFKEIFDVIGDGIINVDGELWENLRKSTLAIFSHEGFKRFSIIANVKKV  151

Query  535  QNGLLPLLDSFAE  573
            + GL+P LD  A+
Sbjct  152  KKGLIPFLDHVAK  164



>gb|KFK32856.1| hypothetical protein AALP_AA6G295800 [Arabis alpina]
Length=509

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            +PR W ++GMLPG+L   HR++ +V + L+ S  TF FKGP    ++ML+T DPANI H+
Sbjct  31   LPRNWPILGMLPGVLVVFHRINDYVAEALEVSNMTFAFKGPWFSGMNMLVTADPANIQHV  90

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
             S NFS+Y KG +F++IFD LG+GIF  DS+LWE  RK+ L   +H  F +        K
Sbjct  91   FSSNFSSYDKGSEFKEIFDFLGEGIFTADSKLWEELRKSALVMLSHQGFQSFSFRTFTSK  150

Query  532  VQNGLLPLLDSFAE  573
            ++N L+P+LD FAE
Sbjct  151  IKNRLIPVLDHFAE  164



>ref|XP_006446605.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
 gb|ESR59845.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
Length=509

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 93/156 (60%), Gaps = 13/156 (8%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            +F  +GC    K     SSR+          ML  L+ NAH+LH+F T +L++S GT EF
Sbjct  6    LFILIGCLWSFK----RSSRTR---------MLSTLVLNAHQLHEFATRVLQKSRGTLEF  52

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP    +D +IT DP N+H+I S+NFSNYPKGP  R I +  GDG+F  D  LW+  RK
Sbjct  53   KGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRK  112

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               S   H  F + LE  ++ K++NGL+P+LD  +E
Sbjct  113  MIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASE  148



>ref|XP_009795090.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=513

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 98/153 (64%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            F+  F ++      ++++ +PR +  +GM P LL N HR+H+ +T++L ++GGTF  KGP
Sbjct  16   FIAIFFFLVFWAIGNTKNDLPRNYPFLGMFPTLLLNIHRIHEKITEVLSKTGGTFLLKGP  75

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
               N+DML T DP N+H+I+S N SN+PKGP+F++IFD  GDGIFN D  LW+   K   
Sbjct  76   WFTNMDMLGTVDPVNVHYIMSTNSSNFPKGPEFKKIFDAFGDGIFNSDFDLWKKQSKYAK  135

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
                +  +H  L   +  KV++GL+P+LD  A+
Sbjct  136  ELVINQKYHKCLIKTINDKVKDGLIPILDFMAK  168



>ref|XP_010027329.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62193.1| hypothetical protein EUGRSUZ_H04851 [Eucalyptus grandis]
Length=507

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 91/153 (59%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C+  +++ S S   +P+ W +VGMLP LL N    H++ T  L+ S G F  +  
Sbjct  10   FLAGICFAVLRLLSKSDDGLPKNWPLVGMLPALLLNLSHFHEWATGFLERSHGNFFLRFH  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +D+L T DP N+H+ILS NF N+PKGP+F+++FDVLGDGIFN DS LW   R+   
Sbjct  70   WFSGMDILFTADPVNVHYILSANFGNFPKGPEFKRVFDVLGDGIFNSDSNLWSTQRRVAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F     FH  L      K++NGLL +LD  ++
Sbjct  130  VFMKDLRFHRFLLMTTRDKLENGLLRVLDELSQ  162



>ref|XP_004160509.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48433.1| hypothetical protein Csa_6G487540 [Cucumis sativus]
Length=511

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 87/135 (64%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  348
            A+P  W +VGM P ++ + HR H  +T++++E G TF FKG     +D L+T DP+NIHH
Sbjct  34   AVPWNWPIVGMTPSVVTHIHRSHDRITEVIQEVGSTFFFKGVWFSGMDFLLTADPSNIHH  93

Query  349  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWH  528
            ILS NF  YPKGP F+ IF+VLGDGIFN DS  W+  RKT  S  +   F   LE    +
Sbjct  94   ILSANFERYPKGPDFKYIFEVLGDGIFNSDSYAWKDQRKTARSLVHDEKFLQFLEKITLN  153

Query  529  KVQNGLLPLLDSFAE  573
            KV+ G++P+LD   E
Sbjct  154  KVKTGIVPVLDGVCE  168



>gb|KFK31020.1| hypothetical protein AALP_AA6G057700 [Arabis alpina]
Length=508

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            RKW V+GMLP LL   HR++++  +I++ S  TF+FKGP    +DML T DPANIHHI+S
Sbjct  33   RKWPVLGMLPSLLMVLHRMYEYGIEIMEFSDLTFQFKGPWFVGMDMLFTVDPANIHHIMS  92

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NF NY KGP F+ +FDV GDGI   DS+LW+  RK+  +  +H  F     + +  K++
Sbjct  93   SNFPNYIKGPDFQDVFDVFGDGIITTDSELWKDLRKSYQAMVHHQGFQRFSMSTMTSKLK  152

Query  538  NGLLPLLDSFAE  573
            +GL+PLLD FAE
Sbjct  153  DGLVPLLDHFAE  164



>emb|CDY32582.1| BnaC03g15500D [Brassica napus]
Length=435

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 103/159 (65%), Gaps = 7/159 (4%)
 Frame = +1

Query  100  FMIFSFLGC-FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGT  276
            F+ F  L C F +M+      +++  P  W V+GMLPGLL   HR+H ++T +L+ +  T
Sbjct  14   FIFFLVLYCLFLHMR------TQTPFPTNWPVLGMLPGLLLQIHRIHDWLTQVLEAANMT  67

Query  277  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  456
            F  KGP     D+L+T DP N+H+ILS +F NYPKG +F++IF+ LGDGIFNVDS LWE 
Sbjct  68   FRLKGPWGSGTDILVTVDPVNVHYILSSHFVNYPKGEEFQKIFEFLGDGIFNVDSGLWEE  127

Query  457  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             R ++ + F+H  F +   +    K++ GL+P+L++ +E
Sbjct  128  MRNSSHAIFSHQDFRSFSVSTSVSKLRQGLVPILENASE  166



>gb|EAY88475.1| hypothetical protein OsI_09946 [Oryza sativa Indica Group]
Length=507

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 97/169 (57%), Gaps = 4/169 (2%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            MA A++L L L F+ FS    F Y  +K +  + +AIP  W ++GMLP LL N HR+H +
Sbjct  1    MAFASILQLALCFLCFSI---FSYNHIKSKRKN-TAIPVCWPLIGMLPDLLANRHRIHDW  56

Query  244  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  423
            +T +L  S   F F GP   N+ + ITCDPAN+ H+ + NFSNYPKGP F +IFD+ GDG
Sbjct  57   ITSLLTASQLNFRFTGPPSSNMRLFITCDPANVRHVFTSNFSNYPKGPDFTEIFDIFGDG  116

Query  424  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
            IFNVD   W   R           F   +      KV+  LLPLL  FA
Sbjct  117  IFNVDGDSWRRQRAKAQLLTCRPRFRAFVSRCSRAKVEKALLPLLAHFA  165



>gb|KFK30510.1| hypothetical protein AALP_AA7G271300 [Arabis alpina]
Length=501

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 100/157 (64%), Gaps = 0/157 (0%)
 Frame = +1

Query  103  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  282
            ++ +FL    +        +R  +   W V+GMLPGLL N  R++  +T++L+ +G T+ 
Sbjct  8    ILIAFLFFLVFQGFLHHKKTRRHLATNWPVLGMLPGLLVNLPRIYDCITEVLEAAGMTYH  67

Query  283  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  462
            FKGP L   D+L+T DPANI ++LS NF NY KG +F++IF+ LGDGIFNVDS+LWE  R
Sbjct  68   FKGPWLSRTDILLTADPANIQYVLSSNFVNYHKGLEFQEIFEFLGDGIFNVDSELWEDMR  127

Query  463  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             ++ + F+H  F     +    K++ GL+P+L+S  E
Sbjct  128  NSSHAMFSHQEFQKFSVSTTLSKLKQGLVPILESAVE  164



>gb|ABF93892.1| Cytochrome P450 family protein [Oryza sativa Japonica Group]
 gb|EAZ25522.1| hypothetical protein OsJ_09346 [Oryza sativa Japonica Group]
Length=507

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 97/169 (57%), Gaps = 4/169 (2%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            MA A++L L L F+ FS    F Y  +K +  + +AIP  W ++GMLP LL N HR+H +
Sbjct  1    MAFASILQLALCFLCFSI---FSYNHIKSKRKN-TAIPVCWPLIGMLPDLLANRHRIHDW  56

Query  244  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  423
            +T +L  S   F F GP   N+ + ITCDPAN+ H+ + NFSNYPKGP F +IFD+ GDG
Sbjct  57   ITSLLTASQLNFRFTGPPSSNMRLFITCDPANVRHVFTSNFSNYPKGPDFTEIFDIFGDG  116

Query  424  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
            IFNVD   W   R           F   +      KV+  LLPLL  FA
Sbjct  117  IFNVDGDSWRRQRAKAQLLTCRPRFRAFVSRCSRAKVEKALLPLLAHFA  165



>ref|XP_007150921.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
 gb|ESW22915.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
Length=508

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 90/146 (62%), Gaps = 1/146 (1%)
 Frame = +1

Query  127  FCYMKM-KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  303
            FC M      +  R  I   + ++GMLP LL+N  R H F T++LK+ GGT EF GP   
Sbjct  16   FCIMYFFHRRACCRYPILTDYPILGMLPQLLFNLSRCHDFFTEVLKQKGGTGEFTGPWFT  75

Query  304  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  483
            N++ L+T DP N+HHI+S++F NY KGP FR IF+  G+GIF  DS+ W+++R    S F
Sbjct  76   NMNYLVTSDPLNVHHIMSKSFHNYVKGPVFRDIFEAFGEGIFTADSETWKYNRDLFHSLF  135

Query  484  NHAHFHTLLETNVWHKVQNGLLPLLD  561
                F   LE  +  KVQN LLP+LD
Sbjct  136  KQKSFEMFLEKTIHKKVQNSLLPVLD  161



>ref|XP_009117361.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
 emb|CDY63371.1| BnaA09g55910D [Brassica napus]
Length=510

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            PR W V+GMLPG+L   H+++ ++ ++L+ S  TF FKGP    ++MLIT DP N+ H+ 
Sbjct  32   PRNWPVLGMLPGVLVMLHKINGYLVEVLEVSNLTFVFKGPWFSGMNMLITADPENVQHVF  91

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NFSNY KG +F+++FD LG+GIF  DS+LWE  R++++   +H  F +     +  K+
Sbjct  92   SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSMVMLSHQGFQSFSLKTIASKI  151

Query  535  QNGLLPLLDSFAE  573
            +NGL+P+LD FA+
Sbjct  152  KNGLVPVLDHFAK  164



>gb|KFK22570.1| hypothetical protein AALP_AAs72953U000100 [Arabis alpina]
Length=500

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 96/158 (61%), Gaps = 5/158 (3%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F+ F    CF   K      ++   P  W V+GMLP LL+   R++  +T++L+ +  TF
Sbjct  14   FIFFLVFQCFLLHK-----KTQRPFPTNWPVLGMLPALLHQVPRIYDCITEVLEAADMTF  68

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
             FKGP L   D+LIT DPANIH+ILS NF NYPKG +FR IF  LGD IFNVD +LWE  
Sbjct  69   HFKGPWLSRTDILITVDPANIHYILSSNFVNYPKGMEFRNIFKELGDSIFNVDWELWEDL  128

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            R +  + F+H  F  +  +    K++ GL+P+L++  E
Sbjct  129  RNSAHAIFSHQEFQKISVSTSMSKLKQGLVPILENAVE  166



>ref|XP_002529227.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33140.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  348
             +P  W VVGMLP  ++N HR+H+   ++L+++G TF + GP   N+ +L T DPANIH+
Sbjct  27   GMPINWPVVGMLPDTIFNFHRIHERFAEVLEQNGLTFLYAGPWFSNVKILGTVDPANIHY  86

Query  349  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWH  528
            ++S NF+N+PKG +F +IF++LGDGIFN DS  W+  RKT  +  NH  FH  L     +
Sbjct  87   VMSSNFANFPKGSEFSKIFNILGDGIFNSDSDSWKNQRKTAQALINHQRFHQFLVKTCRN  146

Query  529  KVQNGLLPLLDSFAE  573
             V+ GLLP+L+  A+
Sbjct  147  MVEKGLLPVLEHVAD  161



>emb|CAN80536.1| hypothetical protein VITISV_035975 [Vitis vinifera]
Length=471

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            M  GLL++ HR+H    +IL+++G TF FKGP   N+DML T DPAN+H+I+S NFSN+P
Sbjct  1    MFAGLLFHVHRIHDEAAEILEKTGCTFLFKGPWFCNMDMLGTTDPANVHYIMSSNFSNFP  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KG +FR++F+VLGDGIFN D + W   RK   S  N+  FH  L    ++KV+ GL+PLL
Sbjct  61   KGTEFRKMFEVLGDGIFNADGESWRNQRKLGQSMINNPRFHRFLAKVTYNKVEKGLVPLL  120

Query  559  DSFAE  573
            D  +E
Sbjct  121  DHLSE  125



>emb|CDX72691.1| BnaC07g47130D [Brassica napus]
Length=243

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 92/150 (61%), Gaps = 0/150 (0%)
 Frame = +1

Query  124  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  303
            CF  +   +        PR W VVGMLP LL + H+L+ +  +IL+ S  TF FKGP   
Sbjct  15   CFLILFYLLFKKPHDRFPRNWPVVGMLPRLLVSLHQLYDYGVEILEISDLTFLFKGPRFF  74

Query  304  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  483
             +DML T DPANI HI+S NFSNY KG  F+ +FDV GDGI   DS+LW+  RK+  +  
Sbjct  75   GMDMLFTVDPANILHIMSSNFSNYIKGSDFQDVFDVFGDGIITTDSELWKNLRKSYQAMV  134

Query  484  NHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +H  F     + +  K+++GL+PLL+ FAE
Sbjct  135  HHQEFQRFSMSTMISKLKDGLVPLLNHFAE  164



>emb|CDX83711.1| BnaC07g24510D [Brassica napus]
Length=222

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLPGLL   HR++ F  ++L+ S  TF+FKGP+L  +DML+T DPANIH++LS NF NY 
Sbjct  1    MLPGLLMVLHRIYDFTVELLENSNLTFQFKGPLLSGMDMLVTVDPANIHYMLSSNFLNYN  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KGP+F++IFDV  D IFNVD++LW   RK       H  F  L  +    K++NGL+P+ 
Sbjct  61   KGPEFKEIFDVFKDVIFNVDAELWYNSRKAAEGILRHQGFARLSVSATRSKLKNGLVPVF  120

Query  559  DSFAE  573
            D FA+
Sbjct  121  DHFAK  125



>ref|XP_003525678.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=500

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 85/133 (64%), Gaps = 0/133 (0%)
 Frame = +1

Query  163  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  342
            +  I  ++ ++GMLP LL+N  R H + T +L+  GGT EF GP   N+D L+TCDP N+
Sbjct  26   KHPILTEYPIIGMLPQLLFNLWRAHDYSTQVLQRHGGTGEFIGPWFTNMDYLVTCDPINV  85

Query  343  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNV  522
            HH+LS+NF NY KGP+FR IF   GDGIF  DS+ W++ R    S F    F   +   +
Sbjct  86   HHMLSKNFHNYVKGPEFRHIFQAFGDGIFAADSEAWKYSRDLFHSLFKQKSFEVFVAKTI  145

Query  523  WHKVQNGLLPLLD  561
             +KV NGLLP+LD
Sbjct  146  HNKVHNGLLPILD  158



>ref|XP_004151191.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=481

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG     +D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHI  94

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H +F   LE    +K
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNK  154

Query  532  VQNGLLPLLDSFAE  573
            V+ GL+P+LDS  E
Sbjct  155  VKTGLVPILDSVCE  168



>ref|XP_007150917.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
 gb|ESW22911.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
Length=504

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 0/127 (0%)
 Frame = +1

Query  181  KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSR  360
            ++  VGMLP +L N    H + T +LK+ GGT EF GP   N++ L+TCDP N+HH+LS+
Sbjct  34   EYPFVGMLPQVLCNLWHAHDYSTQVLKQHGGTAEFGGPWFTNMNYLVTCDPLNVHHMLSK  93

Query  361  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQN  540
            NF NY KGP+FR IF   GDGIF  D + W++ R    S F H  F  LLE  +  KVQN
Sbjct  94   NFHNYVKGPEFRDIFQAFGDGIFTADGEAWKYSRDLFHSLFKHKSFEVLLEKTIHKKVQN  153

Query  541  GLLPLLD  561
             LLP+LD
Sbjct  154  SLLPVLD  160



>gb|KCW62191.1| hypothetical protein EUGRSUZ_H04849 [Eucalyptus grandis]
Length=496

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 90/153 (59%), Gaps = 0/153 (0%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C++   +   S   +P+ W +V MLP L  N  R H + T +L++S   F F+ P
Sbjct  10   FLAAICFVVFHLLGKSHDGLPKNWPLVRMLPALFLNLGRAHDWGTSVLEQSRCNFFFRSP  69

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                +D+L+  DPAN+H+I+S NF N+PKGP+F+++FD+LGDGI N DS +W   R+   
Sbjct  70   WFSGMDVLVAADPANVHYIMSTNFENFPKGPEFKRVFDILGDGILNSDSDMWRAQRRDAQ  129

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F N   F   L      KV+NGLL +LD  ++
Sbjct  130  VFMNDQRFCRFLAKTTRDKVENGLLRVLDDLSQ  162



>emb|CDY38915.1| BnaA03g12640D [Brassica napus]
Length=232

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = +1

Query  100  FMIFSFLGC-FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGT  276
            F+ F  L C F +M+      +++     W V+GMLPGLL   HR+H ++T +L+ +  T
Sbjct  14   FIFFLVLYCLFLHMR------TQTPFLTNWPVLGMLPGLLLQIHRIHDWLTQVLEAANMT  67

Query  277  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  456
            F  KGP     D+L+T DP N+H+ILS +F NYPKG +F++IF+ LGDGIFNVDS LWE 
Sbjct  68   FRLKGPWRSGTDILVTVDPVNVHYILSSHFVNYPKGEEFQKIFEFLGDGIFNVDSGLWED  127

Query  457  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             R ++ + F++  F +   +    K++ GL+P+L++ +E
Sbjct  128  MRNSSHAIFSNKDFQSFSVSTSVSKIRQGLVPVLENASE  166



>ref|XP_002457224.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
 gb|EES02344.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
Length=511

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = +1

Query  118  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            L CF  +  +++   R  +P  W VVG+LP +  NA R+H+++T+ L+ +G ++  KGP 
Sbjct  21   LACFLLLFHRLKR--RDGLPTNWPVVGVLPAITINAGRIHEWLTEFLRAAGLSYVIKGPW  78

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
               +D+++T DPAN+ H+ + NF NYPKG +F ++FDVLGDGIFN D   W F R+   +
Sbjct  79   GSPVDVIVTADPANVAHVFTANFGNYPKGEEFAELFDVLGDGIFNADGDSWAFQRRKAHA  138

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
              + A F   +  +   K+++GL+PLLD  A
Sbjct  139  LLSDARFRAGVAASTARKLRDGLVPLLDGLA  169



>gb|KGN48430.1| hypothetical protein Csa_6G487020 [Cucumis sativus]
Length=516

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 87/135 (64%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  348
             IP  W V+GM+P +++N +R+H  +T+IL+++  TF F G    N   L+T DP+NIHH
Sbjct  32   GIPWNWPVLGMIPTVIHNIYRVHDRITEILQQTSCTFYFNGIWFTNTGFLMTVDPSNIHH  91

Query  349  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWH  528
            I+S NF NYPKGP+F+ IFDVLGDGIFN DS  W+  RK   S   H  F   +      
Sbjct  92   IMSTNFQNYPKGPEFKYIFDVLGDGIFNSDSDSWKSQRKIAQSLIVHEKFLEFMARAAKE  151

Query  529  KVQNGLLPLLDSFAE  573
            KV+ GL+P+L+ F E
Sbjct  152  KVEKGLVPILEYFCE  166



>gb|KGN48432.1| hypothetical protein Csa_6G487530 [Cucumis sativus]
Length=511

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG     +D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHI  94

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H +F   LE    +K
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNK  154

Query  532  VQNGLLPLLDSFAE  573
            V+ GL+P+LDS  E
Sbjct  155  VKTGLVPILDSVCE  168



>ref|XP_006346789.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=505

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = +1

Query  166  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  345
            S  P  + + GMLPGLLYN  ++H+  T  ++ SGGTF FKG    N+D L T DPAN+H
Sbjct  27   SNYPINFPIFGMLPGLLYNIQQIHERCTMSMRASGGTFLFKGLWFANMDTLTTVDPANVH  86

Query  346  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  525
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RK T +   H  F+  L     
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRALITHHEFYKFLVKTSR  146

Query  526  HKVQNGLLPLLD  561
             KV+ GL+P++D
Sbjct  147  DKVEKGLIPVID  158



>ref|XP_011031168.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=518

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W VVGMLPGLL+ A  +H++ T +LK+SGGTFEFKGP   N+++ +T DP N+ HI ++N
Sbjct  33   WPVVGMLPGLLFQAQNVHEYATQLLKQSGGTFEFKGPWFANMNIFLTADPLNVRHISTKN  92

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F NYPKGP++++IF+  GDG+ N D + W+  RK   S      F   LE ++  K+  G
Sbjct  93   FVNYPKGPEYKKIFEPFGDGVLNSDFESWKSFRKLIHSMIKDNKFQVFLERSLREKIVKG  152

Query  544  LLPLLD  561
            L+P+L+
Sbjct  153  LIPVLE  158



>ref|XP_004160508.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
sativus]
Length=511

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG     +D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHI  94

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H +F   LE    +K
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNK  154

Query  532  VQNGLLPLLDSFAE  573
            V+ GL+P+LDS  E
Sbjct  155  VKTGLVPILDSVCE  168



>emb|CDP12888.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLP L+  A+ LH   T++ + +GGTF FKGP   N+D L+T DPANIHHI+S NF N+P
Sbjct  1    MLPNLILYANWLHDNCTNVARLAGGTFLFKGPWFFNMDTLLTVDPANIHHIMSGNFPNFP  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KGP+F+++FDVLGDGIFN D  LW+  RKTT    NH  FH  L      KV+ GL+P+L
Sbjct  61   KGPKFKEMFDVLGDGIFNADMDLWKSQRKTTRFLINHHRFHQFLVKTSRDKVEKGLIPVL  120

Query  559  D  561
            D
Sbjct  121  D  121



>emb|CDY70656.1| BnaAnng34510D [Brassica napus]
Length=298

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 98/158 (62%), Gaps = 4/158 (3%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F+ F    CF   K     S   A+   W  +GMLPG+L+N  R+  +++++ + +  TF
Sbjct  13   FIFFLVFQCFFVCK----KSHNVALLENWPFLGMLPGILFNLPRIFDWLSEVHEANDMTF  68

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
             FKGP     DML T DP NI+H+LS NF NYPKGP+F++IF++LGDGI   D +LWE  
Sbjct  69   AFKGPWFSGTDMLFTVDPRNINHMLSSNFPNYPKGPEFKKIFEILGDGIVAADMELWEDL  128

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RK+  + F+H +F  L  ++   K++N L+PLLD  AE
Sbjct  129  RKSGHALFHHQNFLKLTVSSTTSKLKNDLVPLLDQAAE  166



>ref|XP_004237624.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=510

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            P+ W +VGMLP +L++   +H  +T I+  +GGTF  KGP+   +D+L T DP+N+H+I+
Sbjct  31   PKSWPIVGMLPSMLFHLKHIHDRLTVIMSVTGGTFVPKGPLFAEMDILATVDPSNVHYIM  90

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S+NF N+PKG +F+++FDVLGDGIFN D  LW+  RKTT S   H  F+  L      KV
Sbjct  91   SQNFMNFPKGKKFKELFDVLGDGIFNADMDLWKIQRKTTRSLVTHQQFYKFLIKTSRDKV  150

Query  535  QNGLLPLLD  561
            + GL+ +LD
Sbjct  151  EKGLVNVLD  159



>ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 91/150 (61%), Gaps = 1/150 (1%)
 Frame = +1

Query  124  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  303
            CF Y         R  +   + ++GMLP LL+N  R H + T +LK+ GGT EF GP   
Sbjct  16   CFLYF-FHRRQCCRHPLFTDFPILGMLPQLLFNLWRAHDYSTQVLKQRGGTAEFTGPWFT  74

Query  304  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  483
             ++ L+T DP N+HH++S++F NY KGP FR+IF   GDGIF  DS+ W+++R    S F
Sbjct  75   KMNCLVTGDPINVHHVMSKSFPNYVKGPVFREIFQAFGDGIFTADSEAWKYNRNLFHSLF  134

Query  484  NHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             H  F   LE  + +KVQN LLP+LD+  +
Sbjct  135  KHRSFEVFLEKTIHNKVQNTLLPMLDNLQQ  164



>ref|XP_004142037.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 0/143 (0%)
 Frame = +1

Query  145  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  324
            +  S+    +P  W ++GM+P L+ + HR+H  + ++L ES   F FKG    + D L+T
Sbjct  28   RWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFLLT  87

Query  325  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  504
             DP+N++HILS +F  YPKGP F  IFD+LGDGIFN DS +W+  RKT LS   H  FH 
Sbjct  88   ADPSNVNHILSVHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESFHK  147

Query  505  LLETNVWHKVQNGLLPLLDSFAE  573
             LE     KV+ GL+P+L S  E
Sbjct  148  FLEKITLKKVKEGLVPVLQSACE  170



>gb|KGN48434.1| hypothetical protein Csa_6G487550 [Cucumis sativus]
Length=509

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 0/143 (0%)
 Frame = +1

Query  145  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  324
            +  S+    +P  W ++GM+P L+ + HR+H  + ++L ES   F FKG    + D L+T
Sbjct  28   RWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFLLT  87

Query  325  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  504
             DP+N++HILS +F  YPKGP F  IFD+LGDGIFN DS +W+  RKT LS   H  FH 
Sbjct  88   ADPSNVNHILSVHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESFHK  147

Query  505  LLETNVWHKVQNGLLPLLDSFAE  573
             LE     KV+ GL+P+L S  E
Sbjct  148  FLEKITLKKVKEGLVPVLQSACE  170



>ref|XP_009397903.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 94/155 (61%), Gaps = 1/155 (1%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            + SF+ CF +     +   RS +P  W V GMLPGLL    R++ +   +++E G TF F
Sbjct  14   LLSFV-CFVFCYYFCQIFRRSNVPVNWPVAGMLPGLLLRCRRIYDWGACLVREVGCTFVF  72

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            +GP L  ++ ++TCDPAN+ HI S  FSNYPKG +F +IFDVLGDGIFN D +LW+  R 
Sbjct  73   RGPWLLGMNYVLTCDPANLQHIFSAGFSNYPKGEEFSEIFDVLGDGIFNSDGELWKKQRM  132

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
                  +   F + +  +   KV+ GL+PLLD  A
Sbjct  133  RAHGLISSRSFRSFVAGSSRRKVEQGLIPLLDGIA  167



>ref|XP_004173396.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 0/143 (0%)
 Frame = +1

Query  145  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  324
            +  S+    +P  W ++GM+P L+ + HR+H  + ++L ES   F FKG    + D L+T
Sbjct  28   RWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFLLT  87

Query  325  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  504
             DP+N++HILS +F  YPKGP F  IFD+LGDGIFN DS +W+  RKT LS   H  FH 
Sbjct  88   ADPSNVNHILSIHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESFHK  147

Query  505  LLETNVWHKVQNGLLPLLDSFAE  573
             LE     KV+ GL+P+L S  E
Sbjct  148  FLEKITLKKVKEGLVPVLQSACE  170



>ref|XP_010554002.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=525

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 93/158 (59%), Gaps = 1/158 (1%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F + S L   C+    +   + +  P  W  +GMLP LL   H+++ +  D+L+ S  TF
Sbjct  25   FFLISLLAI-CFFFFFINKKTHAVFPTNWPFLGMLPALLQMLHQIYDYSADLLESSNMTF  83

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
              KGP    +DMLIT DPANIHHI+S NF NY KGP+F ++F+V G+ IFN DS LW+  
Sbjct  84   LLKGPWFAGIDMLITVDPANIHHIMSSNFLNYTKGPEFNEVFEVFGEAIFNTDSDLWKDK  143

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RK+     NH  F     +   +K++ GL+PLLD  A+
Sbjct  144  RKSAQVMLNHHGFQRFTLSTTVNKIKKGLVPLLDHAAK  181



>ref|XP_010444891.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=214

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 82/132 (62%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R W V+GM+PG L   HR++ F  +I + +  TF F GP    +DML T DPANIH+ILS
Sbjct  33   RSWPVLGMIPGFLLELHRIYDFGVEIFETADLTFLFTGPWFTGMDMLFTVDPANIHYILS  92

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KG  F+++FDV G+ IF+ DS+LW+  RK      NH  F  L  +    K+ 
Sbjct  93   SNFSNYTKGADFKEVFDVFGEMIFSSDSELWKNQRKAAQYMLNHQGFQKLSMSTTRRKLY  152

Query  538  NGLLPLLDSFAE  573
            +GL+PLLD   E
Sbjct  153  DGLVPLLDQCCE  164



>emb|CDY12435.1| BnaC08g09240D [Brassica napus]
Length=513

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 90/136 (66%), Gaps = 2/136 (1%)
 Frame = +1

Query  169  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  348
            + P  W  +GMLPGLL    R++ ++T+ L+ S  TF FKGP    ++ML T DPANIHH
Sbjct  32   SFPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVDPANIHH  91

Query  349  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTL-LETNVW  525
            I+S NF+NYPKG +F++IFDVLGDGIFN D  LW   RK+     +   F    L TN+ 
Sbjct  92   IMSSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQCMMSRPEFQRFTLRTNM-  150

Query  526  HKVQNGLLPLLDSFAE  573
             K++ GL+P+LD FA+
Sbjct  151  RKLEKGLVPILDHFAK  166



>gb|EPS73452.1| hypothetical protein M569_01304 [Genlisea aurea]
Length=134

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 2/122 (2%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
             L CF +      +  ++A    W V+GMLP +L N HR+H F T+I+ +SGGTF  KGP
Sbjct  9    LLPCFAFALACYRTWRKAAA--DWPVIGMLPSVLRNLHRIHDFATEIVVDSGGTFLLKGP  66

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
             L  +DML+T DPAN+H+IL++NF N+ KG  FR+IFDV GDGIF V+S++WE  R+   
Sbjct  67   RLAEMDMLLTSDPANVHYILTKNFGNFGKGSDFREIFDVWGDGIFAVESEMWENQRRMAK  126

Query  475  SF  480
             F
Sbjct  127  LF  128



>ref|XP_008440138.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=511

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG      D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHFHRPHDRVTEVLQQTAFTFFFKGIWFSGTDFLFTVDPSNIHHI  94

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H  F   LE    +K
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKSQRKTAHHLVRHESFLQFLEKITLNK  154

Query  532  VQNGLLPLLDSFAE  573
            V+ GL+P+LDS  E
Sbjct  155  VKTGLVPVLDSVCE  168



>gb|KDP35253.1| hypothetical protein JCGZ_09412 [Jatropha curcas]
Length=498

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 91/149 (61%), Gaps = 1/149 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
             L   CY  +    S+R  +   W  +GMLP L+ +    H +   +++ SGGTF FKGP
Sbjct  10   LLAVICY-SIGFWLSNRYELLWNWPFLGMLPSLVAHVPDFHDWSKALIERSGGTFLFKGP  68

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
               N+D++ TCDPAN+ H LS NF NYPKG +F+++FDVLGDGIFN DS LW+  RK   
Sbjct  69   WFSNMDIVATCDPANVKHTLSTNFYNYPKGDEFKEMFDVLGDGIFNADSDLWKHQRKNAS  128

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
            +  NH  FH+ L    ++K+   L P+L+
Sbjct  129  ALINHDRFHSFLVKTTYNKLAKELHPVLE  157



>ref|XP_006306153.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
 gb|EOA39051.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
Length=518

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (62%), Gaps = 3/149 (2%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  306
            F Y+  K    +  + P  W V+GMLPG+L   HR++ F  ++L+ S  TF+FKGP    
Sbjct  28   FSYLLTK---KTLGSYPWNWPVLGMLPGILLRLHRIYDFSVEVLENSNLTFQFKGPWFVA  84

Query  307  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  486
            +D L T DPAN+HHI+S NFSNY KGP F +IF+  GDGI N DS+LW   R +    FN
Sbjct  85   MDALATVDPANVHHIMSSNFSNYIKGPIFHEIFEAYGDGIINSDSELWRNWRNSAQIIFN  144

Query  487  HAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            H  +     +    K+++GL+PLL+ FA+
Sbjct  145  HQRYQNFSTSTTRSKLKDGLVPLLNHFAD  173



>emb|CDY13727.1| BnaA06g31960D [Brassica napus]
Length=463

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  345
            S I   W ++GMLPGL    HR++ F  ++L+ S  TF+FKGP L  +DML T DPANIH
Sbjct  25   SFITTNWPLIGMLPGLFMVLHRVYDFTVELLESSNLTFQFKGPWLSGMDMLATVDPANIH  84

Query  346  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  525
            ++LS NF NY KGP+F++IFDV  D IFNVD++LW   RK       H  F  +  +   
Sbjct  85   YMLSSNFLNYNKGPEFKEIFDVFEDVIFNVDAELWYNSRKAAEGILRHQGFPRVSMSATR  144

Query  526  HKVQNGLLPLLDSFAE  573
             K++NGL+P+ D FA+
Sbjct  145  RKLKNGLVPVFDHFAK  160



>emb|CDY29171.1| BnaC09g15680D [Brassica napus]
Length=437

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 99/158 (63%), Gaps = 4/158 (3%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F+ F    CF   K     S   A+ + W  +GMLPG+L+N  R+  +++++ + +  TF
Sbjct  13   FIFFLVFQCFFLCK----KSHNVALLKNWPFLGMLPGILFNIPRIFDWLSEVHEANDMTF  68

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
             FKGP     DML T DP NI+H+LS NF NYPKGP+F++IFD+LGDGI   D +LWE  
Sbjct  69   AFKGPWYSGTDMLFTVDPRNINHMLSSNFPNYPKGPEFKKIFDILGDGIAAADMELWEDL  128

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            RK+  + F+H +F  L  ++   K++N L+PLLD  AE
Sbjct  129  RKSGHALFHHQNFLKLTVSSTTSKLKNDLVPLLDQAAE  166



>gb|ACR38435.1| unknown [Zea mays]
 gb|AFW80290.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=511

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = +1

Query  118  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            L CF  +  ++  + R  +P  W VVG LP +  NA R+H++VT+ L+ +G ++  KGP 
Sbjct  21   LACFLLLFRRL--NQRDGLPTNWPVVGALPAITVNAGRMHEWVTEFLRAAGLSYVMKGPW  78

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
               +D+++T DPAN+ H+ + NF NYPKG +F  +FDVLGDGIFN D + W F R+   +
Sbjct  79   GSPVDVIMTADPANVAHVFTSNFGNYPKGQEFAALFDVLGDGIFNADGESWAFQRRKAHA  138

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
              + A F   +  +   K+++ L+PLLD  A
Sbjct  139  LLSDARFRAGVAASTARKLRDALVPLLDGIA  169



>emb|CDX72690.1| BnaC07g47120D [Brassica napus]
Length=507

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 87/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R   V+ MLPGLL   HR+H F   IL+ SG TF FKGP    +DML+T DP NIHHI+S
Sbjct  50   RNLPVLRMLPGLLMTLHRVHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMS  109

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KGP  ++IFDV GDGIF  DS++W+  RK++ +  +H  F     + +  K++
Sbjct  110  SNFSNYIKGPGLQEIFDVYGDGIFTTDSEMWKNLRKSSQAMLHHQEFQRFSVSTMTSKLK  169

Query  538  NGLLPLLDSFA  570
             GL+PLL+ FA
Sbjct  170  CGLVPLLNHFA  180



>ref|XP_009151941.1| PREDICTED: cytochrome P450 86A7-like [Brassica rapa]
Length=518

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 98/160 (61%), Gaps = 3/160 (2%)
 Frame = +1

Query  103  MIFSFLGCFCYMKMK---MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGG  273
            M F  +   C++ +    ++  + S I   W ++GMLPGL    HR++ F  ++L+ S  
Sbjct  1    MAFICIPIVCFLILLHFFIKKPNMSFITTNWPLIGMLPGLFMVLHRVYDFTVELLESSNL  60

Query  274  TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWE  453
            TF+FKGP L  +DML T DPANIH++LS NF NY KGP+F++IFDV  D IFNVD++LW 
Sbjct  61   TFQFKGPWLSGMDMLATVDPANIHYMLSSNFLNYNKGPEFKEIFDVFEDVIFNVDAELWY  120

Query  454  FHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
              RK       H  F  +  +    K++NGL+P+ D FA+
Sbjct  121  NSRKAAEGILRHQGFPRVSMSATRRKLKNGLVPVFDHFAK  160



>ref|XP_009113344.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 94/140 (67%), Gaps = 0/140 (0%)
 Frame = +1

Query  151  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  330
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  331  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  510
            P NIHHILS NF NYPKGP+F++IFDVLGDGI +VD +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSVDLELWEDLRKSNHAMFHHPDFLELS  145

Query  511  ETNVWHKVQNGLLPLLDSFA  570
             ++   K++ GL+P LD+ A
Sbjct  146  VSSNTSKLKEGLVPFLDNAA  165



>emb|CDY39927.1| BnaA09g15090D [Brassica napus]
Length=496

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 94/140 (67%), Gaps = 0/140 (0%)
 Frame = +1

Query  151  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  330
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKNWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  331  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  510
            P NIHHILS NF NYPKGP+F++IFDVLGDGI +VD +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSVDLELWEDLRKSNHAMFHHPDFLELS  145

Query  511  ETNVWHKVQNGLLPLLDSFA  570
             ++   K++ GL+P LD+ A
Sbjct  146  VSSNTSKLKEGLVPFLDNAA  165



>ref|XP_003524561.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=504

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 88/148 (59%), Gaps = 1/148 (1%)
 Frame = +1

Query  118  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            L CF Y         R  +   + ++GMLP LL+N  R H F T+ILK  G T EF GP 
Sbjct  15   LFCFLYF-FHRRLCCRHPLLTDYPILGMLPQLLFNLWRAHDFFTEILKRHGPTGEFTGPW  73

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
              ++D L+TCDP N+HH+LS+NF NY KGP+FR IF   GDGIF  D + W+++R    S
Sbjct  74   FTSMDYLVTCDPINVHHMLSKNFHNYVKGPEFRHIFQAFGDGIFTADFEAWKYNRDLFHS  133

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLD  561
             F    F   L   + +KV NGLLP+LD
Sbjct  134  LFKQKSFEVFLVKTIHNKVHNGLLPILD  161



>ref|XP_006405349.1| hypothetical protein EUTSA_v10028238mg, partial [Eutrema salsugineum]
 gb|ESQ46802.1| hypothetical protein EUTSA_v10028238mg, partial [Eutrema salsugineum]
Length=544

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 93/149 (62%), Gaps = 3/149 (2%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  306
            FCY    +   +  + P  W V+GMLPG+L   HR + F  ++L+ S  TF+FKG     
Sbjct  52   FCY---SLIQKTLKSYPWNWPVLGMLPGVLVRLHRSYAFGVEVLESSNLTFQFKGLWFAG  108

Query  307  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  486
            +DML+T DPANI++IL+ NFSNY KGP+F++IF+  GDGI N DS+LW   RK   + FN
Sbjct  109  MDMLVTVDPANINYILTSNFSNYIKGPEFKEIFEAFGDGILNTDSELWRELRKVAQATFN  168

Query  487  HAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            H  +  L       K+ +GL+PL + FA+
Sbjct  169  HQAYPNLSTFTTRSKLTDGLVPLFNHFAK  197



>ref|XP_002310605.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
 gb|EEE91055.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
Length=505

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 92/139 (66%), Gaps = 0/139 (0%)
 Frame = +1

Query  157  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  336
            + +  +PR W +VGMLP  + N HR ++ + ++++ SGG+F +K     + ++L T DPA
Sbjct  24   NKKKRLPRNWPLVGMLPDSIRNLHRPYERIAEVIQLSGGSFIYKSLWFFSPNVLNTVDPA  83

Query  337  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  516
            NIH+I+S NFSN+PKG  F +IFD+LGDGIFN DS LW+  RK      NH  F   L  
Sbjct  84   NIHYIMSSNFSNFPKGSMFSRIFDILGDGIFNADSHLWKNQRKLAHVLINHQQFQRFLVK  143

Query  517  NVWHKVQNGLLPLLDSFAE  573
            + W+KV+ GL+P+L+  A+
Sbjct  144  SSWNKVEKGLIPVLEHVAK  162



>ref|XP_007150920.1| hypothetical protein PHAVU_004G005700g [Phaseolus vulgaris]
 gb|ESW22914.1| hypothetical protein PHAVU_004G005700g [Phaseolus vulgaris]
Length=457

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 0/135 (0%)
 Frame = +1

Query  157  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  336
            S R  +   + ++GMLP +L N   +H F  ++LK  GGT EF GP   NL+ L+T DP 
Sbjct  26   SCRYPLYTDYPILGMLPEVLCNLWHIHDFSAEMLKSHGGTAEFIGPWFTNLNFLVTSDPL  85

Query  337  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  516
            N+HH+LS+NF+NY KGP+FR+IF   GDGIF  D++ W+++R    S F H  F   +E 
Sbjct  86   NVHHVLSKNFNNYIKGPEFREIFQAFGDGIFTTDAEAWKYNRDLFHSLFKHRSFEVFMEK  145

Query  517  NVWHKVQNGLLPLLD  561
             +   VQN LLP+LD
Sbjct  146  TIRKTVQNSLLPILD  160



>ref|XP_002275905.2| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=522

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            +P  W ++GM P +  + HR+H  VTDIL++SG TF  KGP   N+D+L+T DPAN+H+I
Sbjct  43   LPWNWPLLGMFPSVFLHLHRIHDRVTDILEKSGCTFLVKGPWFCNMDLLVTTDPANVHYI  102

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            +S +FSN+PKG +F +IFD LGDGIFN D++ W   RK      N+   +  L     +K
Sbjct  103  MSSHFSNFPKGSEFSKIFDFLGDGIFNSDAESWRKQRKLGQLMINNVRLYRFLGKITQNK  162

Query  532  VQNGLLPLLDSFAE  573
            V+ GLLP+LD  +E
Sbjct  163  VEKGLLPILDYLSE  176



>ref|XP_002868908.1| hypothetical protein ARALYDRAFT_352944 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45167.1| hypothetical protein ARALYDRAFT_352944 [Arabidopsis lyrata subsp. 
lyrata]
Length=994

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 91/139 (65%), Gaps = 0/139 (0%)
 Frame = +1

Query  157  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  336
            ++   +PR W V+GMLP LL    R++ ++ +IL+ S  TF FKGP+   +DML+T DPA
Sbjct  511  TTHGRLPRNWPVLGMLPCLLAVLRRIYDYIVEILEISDLTFSFKGPLFAGMDMLLTVDPA  570

Query  337  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  516
            NIHHI++ NFSNY KG  F+++FDV GDGI   DS LW+  RK+  +  +H  F     +
Sbjct  571  NIHHIMNSNFSNYIKGSDFKEVFDVFGDGIITTDSDLWKNLRKSYQAMLHHQAFQKFSLS  630

Query  517  NVWHKVQNGLLPLLDSFAE  573
                K+ +GL+PLL+ FAE
Sbjct  631  TTRSKLMDGLVPLLNHFAE  649


 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R W V+GM+ G L   HR++ F  + L+ S  TF FKGP    +DML T DPANIH+ILS
Sbjct  33   RNWPVIGMI-GFLMVLHRMYNFGVEALEISHLTFPFKGPWFAGMDMLFTVDPANIHYILS  91

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KG  F+++FDV G+ IF+ DS+LW+  RK      NH  F  L  +    K+ 
Sbjct  92   SNFSNYTKGADFKEVFDVFGEMIFSSDSELWKNQRKAAQFMLNHHEFQKLSMSATRTKLY  151

Query  538  NGLLPLLDSFAE  573
            +GL+PL + + E
Sbjct  152  DGLVPLFNQYCE  163



>dbj|BAD94304.1| cytochrome p450 - like protein [Arabidopsis thaliana]
Length=506

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 91/150 (61%), Gaps = 0/150 (0%)
 Frame = +1

Query  124  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  303
            CF  +   +        PR W V+ MLP +L   HR++ +  +IL+ S  TF FKGP   
Sbjct  15   CFLILHYFLFKKPHGRYPRNWPVLRMLPAMLKALHRIYDYSVEILETSDLTFPFKGPRFT  74

Query  304  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  483
             +DML+T DPANIHHI+S NFSNY KGP+F+ +FDVLGD     DS+LW+  RK+  +  
Sbjct  75   GMDMLLTVDPANIHHIMSSNFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAML  134

Query  484  NHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +   F     + +  K++ GL+PLL+ FAE
Sbjct  135  HSQEFQRFSMSTMTSKLKYGLVPLLNHFAE  164



>gb|KJB44293.1| hypothetical protein B456_007G244800 [Gossypium raimondii]
Length=499

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 2/153 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            FL   C++ +          P+ + +VGM+P  L N  RLH + TD L+    TF FKG 
Sbjct  10   FLPLVCFLLLYCLRDKYHGPPKSFPLVGMMPQFLSNIPRLHDWFTDTLEICHCTFLFKG-  68

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
                 ++L+TCDP+NIH+I+S NF+N+PKGP F+QIFD+LGDGIFNVD  LW   R    
Sbjct  69   -FAKTNVLVTCDPSNIHYIMSSNFNNFPKGPGFKQIFDILGDGIFNVDMDLWRKQRIAAQ  127

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F  H  F+  L      KV+ GL+PLLD  A+
Sbjct  128  GFMRHQLFYRFLSRTTGAKVEEGLIPLLDHVAK  160



>ref|XP_010432764.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R W V+ MLP LL   HR++ +   IL+ S  TF FKGP    +DML+T DPANIHHI++
Sbjct  34   RNWPVLRMLPALLRALHRIYDYSVKILEISNLTFPFKGPRFAGMDMLVTVDPANIHHIMT  93

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KGP F+ +FDV GDGI   D +LW+  RK+  +  +   F     + +  K++
Sbjct  94   SNFSNYIKGPAFQDVFDVFGDGIITTDLELWKTLRKSYQAILHRQEFQRYSMSTMTRKLK  153

Query  538  NGLLPLLDSFAE  573
            +GL+PLLD FAE
Sbjct  154  DGLVPLLDHFAE  165



>ref|XP_011100903.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=515

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 96/151 (64%), Gaps = 2/151 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDIL-KESGGTFEFKG  291
            FL    +M + +  + R A+   W V+GMLP LL +  R+H   T+I+ K   GTF F+G
Sbjct  10   FLSVMWFMALWVWLNYR-ALAWNWPVIGMLPTLLLHVSRIHDNCTEIMGKSRRGTFHFRG  68

Query  292  PVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTT  471
            P L ++DM+ T DP N+H+I+S NF N+PKGP+FR+IFDVLGDGIFN DS+ W   R+  
Sbjct  69   PWLADMDMMGTADPENVHYIMSANFQNFPKGPKFREIFDVLGDGIFNADSESWRDQRRVA  128

Query  472  LSFFNHAHFHTLLETNVWHKVQNGLLPLLDS  564
             +  +H  F   L      KV+ GL+P+L++
Sbjct  129  RALISHHGFLRFLAKISREKVEKGLIPVLET  159



>ref|XP_002306257.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
 gb|EEE93253.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
Length=517

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 85/126 (67%), Gaps = 0/126 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W VVGMLPGLL+ A  +H++ T +LK+SGGTFEFKGP   N+++ +T DP N+ HI + N
Sbjct  33   WPVVGMLPGLLFKAQNIHEYATRLLKQSGGTFEFKGPWFANMNIFLTADPLNVRHISTTN  92

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F NYPKGP++++IF+  GDG+ N D + W+  RK   S      F   LE ++  K+  G
Sbjct  93   FVNYPKGPEYKKIFEPYGDGVLNSDFESWKSFRKLIHSMIKDNKFQVSLERSLREKIVEG  152

Query  544  LLPLLD  561
            L+P+L+
Sbjct  153  LIPVLE  158



>ref|XP_008440139.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Cucumis melo]
Length=510

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 87/135 (64%), Gaps = 0/135 (0%)
 Frame = +1

Query  169  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  348
            A+P  W ++GM P ++ + +R H  +T++++E+G TF FKG     +D L+T DP+NIHH
Sbjct  34   AVPWNWPIIGMTPSVVTHFYRSHDRITEVIQEAGSTFFFKGVWFSGMDFLLTVDPSNIHH  93

Query  349  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWH  528
            ILS NF  YPKGP F+ IF+VLGDGIFN DS  W+  RKT  S  +  +F   LE     
Sbjct  94   ILSANFERYPKGPDFKYIFEVLGDGIFNSDSYAWKDQRKTARSLVHDENFLQFLEKITLK  153

Query  529  KVQNGLLPLLDSFAE  573
            KV+  L+P+L S  E
Sbjct  154  KVKTALVPVLQSVCE  168



>ref|XP_010437945.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R W V+ MLP LL   HR++ +   IL+ S  TF FKGP    +DML+T DPANIHHI++
Sbjct  34   RNWPVLRMLPALLRALHRIYDYSVKILEISNLTFPFKGPRFAGMDMLVTVDPANIHHIMT  93

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KGP F+ +FDV GDGI   D +LW+  RK+  +  +   F     + +  K++
Sbjct  94   SNFSNYIKGPAFQDVFDVFGDGIITTDLELWKTLRKSYQAVLHRQEFQRFSMSTMTRKLK  153

Query  538  NGLLPLLDSFAE  573
            +GL+PLLD FAE
Sbjct  154  DGLVPLLDHFAE  165



>ref|XP_006301857.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
 gb|EOA34755.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
Length=497

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 100/159 (63%), Gaps = 3/159 (2%)
 Frame = +1

Query  103  MIFSFLGCFCYMKMKMESSSR-SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            +I +FL  F +    +   SR S + + W ++GMLPGLL    R+     ++L+ S  TF
Sbjct  10   VIIAFLSFFVFQCFFLHKKSRESPLLKNWPILGMLPGLLVRIPRIFDCTAEVLEASNLTF  69

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
              KG  L   D+L+T DP NI+HILS NF NYPKGP+FR+IFD+LGDGI   DS+LWE  
Sbjct  70   AIKGAWLSGTDLLLTADPRNINHILSSNFRNYPKGPEFRKIFDILGDGILAADSELWEDL  129

Query  460  RKTTLSFFNHAHFHTL-LETNVWHKVQNGLLPLLDSFAE  573
            RK+  + F+H     + L +NV  K++ GL+P LD+ A+
Sbjct  130  RKSGHTIFHHQDILEISLSSNV-SKLKKGLIPFLDNAAD  167



>emb|CDY39926.1| BnaA09g15080D [Brassica napus]
Length=496

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 93/140 (66%), Gaps = 0/140 (0%)
 Frame = +1

Query  151  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  330
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  331  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  510
            P NIHHILS NF NYPKGP+F++IFDVLGDGI + D +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSADLELWEDLRKSNHAIFHHPDFLKLS  145

Query  511  ETNVWHKVQNGLLPLLDSFA  570
             ++   K++ GL+P LD+ A
Sbjct  146  ASSNTLKLKEGLVPFLDNAA  165



>ref|XP_009113345.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 93/140 (66%), Gaps = 0/140 (0%)
 Frame = +1

Query  151  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  330
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  331  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  510
            P NIHHILS NF NYPKGP+F++IFDVLGDGI + D +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSADLELWEDLRKSNHAIFHHPDFLKLS  145

Query  511  ETNVWHKVQNGLLPLLDSFA  570
             ++   K++ GL+P LD+ A
Sbjct  146  ASSNTLKLKEGLVPFLDNAA  165



>gb|KDP35257.1| hypothetical protein JCGZ_09416 [Jatropha curcas]
Length=502

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
            +++ +P  W + GMLP  LY+ HRL++++T+ ++ +G TF +KGP   N+ +LIT DP N
Sbjct  24   NKNGLPINWPIFGMLPETLYHLHRLYEWLTEKIERAGLTFFYKGPWFSNVKILITVDPTN  83

Query  340  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  519
            +H+++S NFSN+PKG +F +IFD+LGDGIFN DS  W+  RK   +  N   FH  L   
Sbjct  84   VHYVMSSNFSNFPKGSEFSKIFDILGDGIFNADSHSWKTQRKLVQTLINRGCFHNFLIEA  143

Query  520  VWHKVQNGLLPLLD  561
                V+ GL+P+++
Sbjct  144  CQEMVEKGLVPVIE  157



>ref|XP_010429268.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=473

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLPG L    R++ ++T++L+ S  T+ FKGP  GNLDML T DPANIHHI+S NF+NYP
Sbjct  1    MLPGFLMEISRVYDYMTELLEASNLTYLFKGPCFGNLDMLFTVDPANIHHIMSSNFANYP  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KG +F+++FDVLGDGIFN DS+LW+  R++  S  ++  +          K++ GL+P L
Sbjct  61   KGSEFKKLFDVLGDGIFNADSKLWKDLRQSAQSIMSNPEYQRFTLRTSMSKLEKGLVPFL  120

Query  559  DSFAE  573
            +  AE
Sbjct  121  NHVAE  125



>ref|XP_010414809.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=495

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 91/141 (65%), Gaps = 0/141 (0%)
 Frame = +1

Query  151  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  330
            + S +S + + W  +GM+PGL+   HR++ ++ + L+ S     FKG      D+L+T D
Sbjct  27   KKSHKSPLFKNWPFLGMIPGLVVEIHRIYDWMVEALEASDLNLVFKGAWFTGTDLLLTAD  86

Query  331  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  510
            P NIHHILS NF NYPKGP+F++IFD+LGDGI   DS+LWE  RK+  + F+H  F  L 
Sbjct  87   PRNIHHILSSNFQNYPKGPEFKKIFDILGDGIVAADSELWEDLRKSNHTLFHHKDFLELA  146

Query  511  ETNVWHKVQNGLLPLLDSFAE  573
             ++   K++ GL+PLLD   E
Sbjct  147  VSSNISKLEKGLIPLLDRAVE  167



>ref|XP_006283561.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
 gb|EOA16459.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
Length=506

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R W V+ MLP L    HR++ +   IL+ S  TF FKGP    +DMLIT DPANIHHI++
Sbjct  33   RNWPVLRMLPALHMALHRIYDYSVKILEISNMTFPFKGPRFAGMDMLITVDPANIHHIMT  92

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KGP F+ +FDV GDGI   DS+LW+  RK+  +  +   F     + +  K++
Sbjct  93   SNFSNYIKGPAFQDVFDVFGDGIITTDSELWKNLRKSYQAMIHRQEFQRFSMSTMTRKLK  152

Query  538  NGLLPLLDSFAE  573
            +G++PLLD FAE
Sbjct  153  DGIVPLLDHFAE  164



>ref|NP_194944.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 emb|CAA16973.1| cytochrome p450 - like protein [Arabidopsis thaliana]
 emb|CAA16572.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79935.1| cytochrome p450-like protein [Arabidopsis thaliana]
 gb|AEE86013.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=506

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 90/150 (60%), Gaps = 0/150 (0%)
 Frame = +1

Query  124  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  303
            CF  +   +        PR W V+ MLP +L   HR++ +   IL+ S  TF FKGP   
Sbjct  15   CFLILHYFLFKKPHGRYPRNWPVLRMLPAMLKALHRIYDYSVKILETSDLTFPFKGPRFT  74

Query  304  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  483
             +DML+T DPANIHHI+S NFSNY KGP+F+ +FDVLGD     DS+LW+  RK+  +  
Sbjct  75   GMDMLLTVDPANIHHIMSSNFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAML  134

Query  484  NHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +   F     + +  K++ GL+PLL+ FAE
Sbjct  135  HSQEFQRFSMSTMTSKLKYGLVPLLNHFAE  164



>ref|XP_009101867.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Brassica rapa]
Length=517

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = +1

Query  175  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  354
            P  W V+GMLPG+L   HR++    ++L+ S  TF+FKGP    +D+L+T  PANIH+IL
Sbjct  41   PWNWPVLGMLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFAGMDILVTVYPANIHYIL  100

Query  355  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  534
            S NFSNY KGP+F++IF+  GDGI N D +LW   RK +   F+H  +    ++    K+
Sbjct  101  SSNFSNYIKGPEFQEIFEAFGDGIINSDLELWRNIRKASQVIFSHQKYQNFSKSTTRSKL  160

Query  535  QNGLLPLLDSFA  570
            ++GLLP+L  FA
Sbjct  161  KDGLLPILSHFA  172



>ref|NP_176713.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
 gb|AAC27155.1| Similar to cytochrome P450 gb|X90458 from A. thaliana [Arabidopsis 
thaliana]
 gb|AEE34360.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
Length=503

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W  +GMLPGLL    R++ ++T++L+ +  TF FKGP L  +D+L+T DP NIH+ILS N
Sbjct  37   WPALGMLPGLLLQVPRIYDWITEVLEATDMTFCFKGPCLSGMDILLTVDPVNIHYILSSN  96

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F+NYPKG +F++IF+V+GD IFNVDS LWE  R ++ + F++  F     +    K++ G
Sbjct  97   FANYPKGMEFKKIFEVVGDSIFNVDSGLWEDMRNSSHAIFSNQDFQMFWVSTSVRKLRQG  156

Query  544  LLPLLDSFAE  573
            L+P+L++ A+
Sbjct  157  LVPILENAAD  166



>gb|KFK43173.1| hypothetical protein AALP_AA1G089200 [Arabis alpina]
Length=732

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLPG+L   HR+H +V + L+ S  TF FKGP    ++ L+T DPANIHH  + NFS Y 
Sbjct  1    MLPGVLVMLHRIHDYVAEGLEVSDLTFAFKGPWFSGMNTLVTADPANIHHAFNTNFSIYD  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KGP+F++IFD LG+GIF  DS+LWE  R++ L FF+H  F +     +  K++NGL+P+L
Sbjct  61   KGPEFKEIFDFLGEGIFTADSKLWEELRRSALVFFSHQRFQSFSLKTIASKIKNGLVPVL  120

Query  559  DSFAE  573
            D FAE
Sbjct  121  DHFAE  125



>ref|XP_011025593.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=513

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 102/172 (59%), Gaps = 8/172 (5%)
 Frame = +1

Query  58   ITMASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLH  237
            ++MAS  LL + L  +  +   CF   K ++        P  W +VGMLP  + N HR +
Sbjct  7    LSMASLGLLEIFLAIVALAIFRCFGNKKKRL--------PTNWPLVGMLPDSIQNLHRPY  58

Query  238  QFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLG  417
            + + ++++ SGG+F +K     +  +L T DPANIH+I+S NFSN+PKG  F +IFD+LG
Sbjct  59   ERIAEVIQLSGGSFIYKSLWFLSPHVLNTVDPANIHYIMSSNFSNFPKGSMFSRIFDILG  118

Query  418  DGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            DGIFN DS LW+  RK      NH  F   L  + W KV+ GL+P+L+  A+
Sbjct  119  DGIFNADSHLWKNQRKLAHMLINHQQFQRFLVNSSWSKVEKGLIPVLEQVAK  170



>ref|XP_006651021.1| PREDICTED: cytochrome P450 86B1-like [Oryza brachyantha]
Length=506

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 92/169 (54%), Gaps = 4/169 (2%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            MA A  L L L F+ FS    F Y  M  +  SR AIP  W +VGMLP LL N HR+H +
Sbjct  1    MAFACTLHLALCFLCFSV---FYYHHMVSKRKSR-AIPLCWPLVGMLPELLANRHRIHGW  56

Query  244  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  423
            +T +L  S   F F GP   ++ + ITCDPAN+ H+ + NF NYPKGP F +IFD+ G G
Sbjct  57   ITSLLAVSKLNFRFTGPTSSSMRLFITCDPANVRHVFTSNFCNYPKGPDFAEIFDIFGGG  116

Query  424  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
            IFNVD   W   R           F   +      KV+  LLPLL  FA
Sbjct  117  IFNVDGDAWRRQRAKAQLLMCRPQFRAFVSRCSRAKVETSLLPLLAHFA  165



>gb|KFK40984.1| hypothetical protein AALP_AA2G070000 [Arabis alpina]
Length=493

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 97/155 (63%), Gaps = 5/155 (3%)
 Frame = +1

Query  100  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  279
            F+ F    CF   K      +   +   W V+GMLPGL+    R++ ++T++L+ +  TF
Sbjct  3    FVFFIVFQCFLLHK-----KTHKPLVTNWPVLGMLPGLILQVPRIYDWITEVLEATDMTF  57

Query  280  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  459
             FKGP L   D+L T DPANI +ILS NF NYPKG + ++IF+VLGD IFNVDS+LWE  
Sbjct  58   CFKGPWLSGTDILATVDPANIQYILSSNFVNYPKGIESKKIFEVLGDSIFNVDSELWEDM  117

Query  460  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDS  564
            R ++ + F+H  F  +  +    K++ GL+P+L++
Sbjct  118  RSSSHAIFSHQEFQKISVSTTISKLKQGLVPILEN  152



>ref|XP_006283573.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
 gb|EOA16471.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
Length=505

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 98/170 (58%), Gaps = 6/170 (4%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            MAS +LL   +  +   F  CF + K K E+       R W V+GM+PG L   HR++ F
Sbjct  1    MASISLLDASIAIVCLVFFQCFFFKKPKNEAF------RNWPVLGMIPGFLLVLHRIYNF  54

Query  244  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  423
              + L+ +  TF FKGP    +DML T DPANIH+ILS NFSNY KG  F+++FDV G+ 
Sbjct  55   GVETLEATDLTFFFKGPWFTGMDMLFTVDPANIHYILSSNFSNYTKGADFKEVFDVFGEM  114

Query  424  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            IF+ DS+LW+  RK      NH  F  L  +    K+ +GL+PL D   E
Sbjct  115  IFSSDSELWKNQRKAAQFMLNHQGFQKLSMSATRSKLYDGLVPLFDQCCE  164



>ref|NP_001117509.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
 gb|AEE33459.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
Length=436

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            IF  +  F Y  ++ +   +  I + W  + MLPG+L+   R++ +  ++L+ +  TF F
Sbjct  11   IFFLVCLFTYFFLQKKPQGQ-PILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYF  69

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP L   DML T DP NIHHILS NF NYPKGP+F++IFDVLG+GI  VD +LWE  RK
Sbjct  70   KGPWLSGTDMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRK  129

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +  + F++  F  L  ++   K++ GL+P LD+ A+
Sbjct  130  SNHALFHNQDFIELSVSSNKSKLKEGLVPFLDNAAQ  165



>ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 91/152 (60%), Gaps = 1/152 (1%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            I + L CF Y+      S +  + R + ++GMLP +L+N  R+H F T++LK+ GGT EF
Sbjct  10   ITASLFCFLYL-FHRRRSCKHPLMRDYPILGMLPPILFNLWRIHDFCTEVLKKQGGTGEF  68

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP    +  LITCD  N+ H+L ++F NY KGP+FR+IF+  GDG+   DS+ W++ R 
Sbjct  69   KGPWFTKMHYLITCDSLNVQHMLCKSFDNYIKGPEFREIFEPFGDGVVTADSETWKYFRT  128

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
               S      F T ++  V  KV   LLP+LD
Sbjct  129  VLHSLIKQRRFETFVDKTVQKKVHTSLLPILD  160



>gb|KDP35254.1| hypothetical protein JCGZ_09413 [Jatropha curcas]
Length=498

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 1/149 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
             L   CY  +    S+R  +   W  +GMLP L+ +    H +   +++ SGGTF FKGP
Sbjct  10   LLAVICY-SIGFWLSNRYELLWNWPFLGMLPSLVAHVPDFHDWNKALIERSGGTFLFKGP  68

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
               N+D++ TCDPAN+ H LS NF NYPKG +F+++FDVLGDGIFN DS LW+  RK   
Sbjct  69   WFSNMDIVATCDPANVKHTLSTNFYNYPKGDEFKEMFDVLGDGIFNADSDLWKHQRKNAS  128

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
            +  NH  F + L    ++K+   L P+L+
Sbjct  129  ALINHDRFRSFLVKTTYNKLAKELHPVLE  157



>gb|KHN27469.1| Cytochrome P450 86B1 [Glycine soja]
Length=463

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLP LL+N  R H + T +L+  GGT EF GP   N+D L+TCDP N+HH+LS+NF NY 
Sbjct  1    MLPQLLFNLWRAHDYSTQVLQRHGGTGEFIGPWFTNMDYLVTCDPINVHHMLSKNFHNYV  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KGP+FR IF   GDGIF  DS+ W++ R    S F    F   +   + +KV NGLLP+L
Sbjct  61   KGPEFRHIFQAFGDGIFAADSEAWKYSRDLFHSLFKQKSFEVFVAKTIHNKVHNGLLPIL  120

Query  559  D  561
            D
Sbjct  121  D  121



>ref|XP_002869292.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45551.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            R W V+ MLP LL   HR++ +   IL+ S  TF FKGP    +DMLIT DPANIHHI+S
Sbjct  33   RNWPVLRMLPALLKALHRIYDYSVKILETSDLTFPFKGPRFAGIDMLITVDPANIHHIMS  92

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             +FSNY KGP+F+ +FDVLGD     DS+LW+  RK+  +  +   F     + +  K++
Sbjct  93   SSFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAMLHTQEFQRFSMSTMTSKLK  152

Query  538  NGLLPLLDSFAE  573
            +GL+PLL+ FAE
Sbjct  153  DGLVPLLNHFAE  164



>ref|XP_006392374.1| hypothetical protein EUTSA_v10023421mg [Eutrema salsugineum]
 gb|ESQ29660.1| hypothetical protein EUTSA_v10023421mg [Eutrema salsugineum]
Length=497

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W  +GMLPG+L    R++ +  ++L+ +  TF FKGP     DML T DP NIHHIL+ N
Sbjct  37   WPFLGMLPGMLPYIPRIYDWTVEVLEATNLTFLFKGPWFSGTDMLFTADPKNIHHILNSN  96

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F NYPKGP+F++IFDVLGDGI   DS+LWE  RK+  + F+H  F  L  ++   K++ G
Sbjct  97   FGNYPKGPEFKKIFDVLGDGILTADSELWEELRKSNNTIFHHQDFMNLSVSSNTSKLKEG  156

Query  544  LLPLLDSFAE  573
            L+P LD+ A 
Sbjct  157  LVPFLDNAAR  166



>ref|XP_009132532.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=498

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W V+GMLPGLL   HR+H ++T +L+ +  TF FKGP     D+L+T DP N+H+ILS +
Sbjct  37   WPVLGMLPGLLLQIHRIHDWLTQVLEAANMTFRFKGPWRSGTDILVTVDPVNVHYILSSH  96

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F NYPKG +F++IF+ LGDGIFNVDS LWE  R ++ + F++  F +   +    K++ G
Sbjct  97   FVNYPKGEEFQKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSNKDFQSFSVSTSVSKLRQG  156

Query  544  LLPLLDSFAE  573
            L+P+L++  E
Sbjct  157  LVPVLENAYE  166



>ref|NP_176086.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
 sp|Q9FVS9.1|C96AF_ARATH RecName: Full=Alkane hydroxylase MAH1; AltName: Full=Cytochrome 
P450 96A15; AltName: Full=Protein MID-CHAIN ALKANE HYDROXYLASE 
1 [Arabidopsis thaliana]
 gb|AAG50737.1|AC079733_5 cytochrome P450, putative [Arabidopsis thaliana]
 gb|AAL31942.1|AF419610_1 At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AAM13991.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAO64745.1| At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AEE33458.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
Length=497

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 99/156 (63%), Gaps = 1/156 (1%)
 Frame = +1

Query  106  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  285
            IF  +  F Y  ++ +   +  I + W  + MLPG+L+   R++ +  ++L+ +  TF F
Sbjct  11   IFFLVCLFTYFFLQKKPQGQ-PILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYF  69

Query  286  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  465
            KGP L   DML T DP NIHHILS NF NYPKGP+F++IFDVLG+GI  VD +LWE  RK
Sbjct  70   KGPWLSGTDMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRK  129

Query  466  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +  + F++  F  L  ++   K++ GL+P LD+ A+
Sbjct  130  SNHALFHNQDFIELSVSSNKSKLKEGLVPFLDNAAQ  165



>ref|XP_002322211.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
 gb|EEF06338.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
Length=508

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 92/139 (66%), Gaps = 1/139 (1%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  339
            +RS++   W VVGMLPGL  N+ R+H+FVT +L++ GGTF FKGP  G LD L+T +PAN
Sbjct  21   NRSSVIINWPVVGMLPGLFRNSSRVHEFVTYVLRQCGGTFVFKGPWFGGLDFLVTSNPAN  80

Query  340  IHHILSRNFSNYPKGPQFRQIF-DVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  516
            +HHIL +   NY KG +F++IF +  G+GIF  D   W+  R+T  SF  ++ F    E 
Sbjct  81   VHHILRKKAFNYHKGLEFKEIFAESFGNGIFCADGDRWKTQRRTIHSFIKNSKFEEAAER  140

Query  517  NVWHKVQNGLLPLLDSFAE  573
            N+  KV +G+  +L+ F+E
Sbjct  141  NIQRKVLHGIFVILEHFSE  159



>emb|CDP18605.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  313  MLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHA  492
            M++TCDPANIH+ILS+NFSNYPKGP+FR+IFD+LGDGIFN DSQLWE HR+ TLS  +H 
Sbjct  3    MVLTCDPANIHYILSKNFSNYPKGPEFRKIFDILGDGIFNADSQLWETHRRVTLSLMHHP  62

Query  493  HFHTLLETNVWHKVQNGLLPLLDSFAE  573
             F  +LE  VW KV+ GLLP+L + A+
Sbjct  63   SFLKVLEVTVWDKVEKGLLPVLQNCAK  89



>gb|EEC74485.1| hypothetical protein OsI_09945 [Oryza sativa Indica Group]
Length=504

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 102/172 (59%), Gaps = 8/172 (5%)
 Frame = +1

Query  64   MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  243
            MA +++L L L F+ FS    F Y  +K +  +  AIP  W +VGMLP LL N H+LH +
Sbjct  1    MAFSSILQLTLCFLCFS---VFYYYHIKSKRKN-PAIPVCWPLVGMLPDLLVNRHQLHDW  56

Query  244  VTDILKESGGTFEFKGPVLG-NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIF-DVLG  417
            +T  L  S   F F GP +  N+    TCDPAN+ HI + NF+NYPKGP F +IF D LG
Sbjct  57   ITSFLTASQLNFRFIGPTMSSNMRFFFTCDPANVRHIFTSNFANYPKGPDFAEIFDDTLG  116

Query  418  DGIFNVDSQLWEFHR-KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
            DGIFNVD   W   R KT L  +NH  F + +      KV+N LLPLL  FA
Sbjct  117  DGIFNVDGDSWRRQRAKTQLLMYNH-RFQSFVSRCSSDKVENALLPLLSHFA  167



>ref|XP_004968446.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=506

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 92/151 (61%), Gaps = 2/151 (1%)
 Frame = +1

Query  118  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            L CF  +  ++  + R  +P  W V+G LP +  NA R+H++VT+ L  +G ++  +GP 
Sbjct  21   LACFLLLFHRL--NRRDGLPTNWPVIGALPAITINAGRVHEWVTEFLCAAGLSYVIEGPW  78

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
               +D+++T DPAN+ H+ + NF+NYPKG +F  +FDVLG GIFN D + W F R+   +
Sbjct  79   GSPVDVVVTADPANVAHVFTTNFANYPKGKEFTALFDVLGGGIFNADGEWWAFQRRKAHA  138

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFA  570
              + A F   +  +   K++ GL+PLLD  A
Sbjct  139  LLSDARFRAAVAASTARKLREGLVPLLDGLA  169



>ref|XP_010911437.1| PREDICTED: cytochrome P450 86B1-like [Elaeis guineensis]
Length=523

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 91/149 (61%), Gaps = 4/149 (3%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  306
            +CY K K        IP  W  VGM P LL + H LH + T +LKESG TF F+GP    
Sbjct  30   YCYQKTK----KGPGIPVNWPFVGMFPALLAHLHHLHDWGTMVLKESGCTFFFRGPWFSG  85

Query  307  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  486
            +DML TCDPAN+HH+ + NF NYPKG  F +IFD+LGDGIFN D++ W   R    S  +
Sbjct  86   MDMLFTCDPANVHHVFNANFLNYPKGDDFSEIFDILGDGIFNSDAESWRSQRMKAHSLIS  145

Query  487  HAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               F + +  +  +KV+ G++PLLD  A+
Sbjct  146  DQRFRSFVSQSSRNKVEKGVIPLLDQLAK  174



>ref|XP_006405350.1| hypothetical protein EUTSA_v10027722mg [Eutrema salsugineum]
 gb|ESQ46803.1| hypothetical protein EUTSA_v10027722mg [Eutrema salsugineum]
Length=519

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 93/149 (62%), Gaps = 3/149 (2%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  306
            FC + ++    +  + P  W V+GMLPG+L   H ++ +  ++L+ S  TF+FKGP    
Sbjct  28   FCCLLIQ---KTHKSYPWNWPVLGMLPGVLLRLHHIYDYSVEVLECSNLTFQFKGPWFAG  84

Query  307  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  486
            +D L+T D ANIH++L+ NFSNY KGP+F +IF+V GDGI N DS LW   RK + + FN
Sbjct  85   MDTLVTVDSANIHYMLTSNFSNYIKGPEFHEIFEVFGDGIVNSDSDLWRNLRKLSQATFN  144

Query  487  HAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            H  F          K+ +GL+PLL+ FAE
Sbjct  145  HQGFQNFSTFTTRSKLTDGLVPLLNHFAE  173



>ref|XP_003554826.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=501

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  103  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  282
            +I + + C  Y   +         P  + ++GMLP +L N  R H  ++D+LK+ GGT E
Sbjct  9    VIVTAVLCMLYFLHRKRCCRHPLFP-DYPIIGMLPPVLCNLWRAHDLISDVLKQHGGTGE  67

Query  283  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  462
            F GP    ++ LI+ DP N+HH++S+NF NY KGP FR IF   GDGIF  DS+ W+++R
Sbjct  68   FTGPWFTIMNCLISSDPINVHHVMSKNFHNYVKGPVFRDIFQAFGDGIFTADSEAWKYNR  127

Query  463  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
                S F +  F   LE  + +KVQN LLP+LD
Sbjct  128  DLFHSLFKNRSFEFFLEKTIQNKVQNSLLPMLD  160



>emb|CDY58383.1| BnaC09g51620D [Brassica napus]
Length=496

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = +1

Query  151  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  330
            + S    I + W V+GMLPG+L +  R+  +  ++L+ +  TF FKGP     DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFDWTFEVLEATNLTFFFKGPWFSGTDMLFTAD  85

Query  331  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  510
            P NIHHILS NF NYPKGP+F++IFDVLGDGI + D +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSADLELWEDLRKSNHAIFHHPDFLKLS  145

Query  511  ETNVWHKVQNGLLPLLDSFA  570
             ++   K++ GL+P LD+ A
Sbjct  146  ASSNTIKLKEGLVPFLDNAA  165



>ref|XP_006294031.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
 gb|EOA26929.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
Length=514

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +1

Query  229  RLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFD  408
            R++ +VT++L+ S  T+  KGP  G LDML+T DPANIH+I+S NF NYPKG +F++IFD
Sbjct  52   RVYDYVTELLEASNLTYPLKGPCFGGLDMLVTIDPANIHYIMSSNFENYPKGSEFKKIFD  111

Query  409  VLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            VLGDGIFN DS+LW+  RK+T S  +H  F          K++ GL+PLLD  AE
Sbjct  112  VLGDGIFNADSELWKDLRKSTQSMMSHHDFQRFTLRTSMSKLEKGLVPLLDYVAE  166



>gb|KFK30522.1| hypothetical protein AALP_AA7G273500 [Arabis alpina]
Length=506

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 91/150 (61%), Gaps = 0/150 (0%)
 Frame = +1

Query  124  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  303
            CF   +  +         R W V+GMLPG L   HR++ F  ++L+++  TF FKGP   
Sbjct  15   CFLIFRFLIFKKPHDRFLRNWPVLGMLPGFLMVLHRIYDFSVEVLEKTDLTFPFKGPWFT  74

Query  304  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  483
             +D+L+T DPANIH+ILS NFSNY KG  F+++F+V G+ IFN D++LW+  RK      
Sbjct  75   GMDLLVTVDPANIHYILSSNFSNYTKGADFKEVFEVFGEMIFNSDAELWKNQRKAAQFML  134

Query  484  NHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            NH  F  L  +    K+++GL+PL +  +E
Sbjct  135  NHQGFQKLSLSATRSKLKDGLVPLFNHLSE  164



>gb|KHN27468.1| Cytochrome P450 86B1 [Glycine soja]
Length=464

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLP LL+N  R H F T+ILK  G T EF GP   N+D L+TCDP N+HH+LS+NF NY 
Sbjct  1    MLPQLLFNLWRAHDFFTEILKLHGPTGEFTGPWFTNMDYLVTCDPINVHHMLSKNFHNYV  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KGP+FR IF   GDGIF  D + W+++R    S F    F   L   + +KV NGLLP+L
Sbjct  61   KGPEFRHIFQAFGDGIFTADFEAWKYNRDLFHSLFKQKSFEVFLVKTIHNKVHNGLLPIL  120

Query  559  D  561
            D
Sbjct  121  D  121



>ref|NP_175193.1| cytochrome P450, family 96, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
 gb|AAD46023.1|AC007519_8 Strong simlarity to gb|286426 F10M6.190 cytochrome p450 homolog 
from Arabidopsis thaliana BAC gb|AL021811 [Arabidopsis thaliana]
 gb|AAQ89636.1| At1g47620 [Arabidopsis thaliana]
 dbj|BAD44042.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44086.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32195.1| cytochrome P450, family 96, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
Length=520

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)
 Frame = +1

Query  127  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  306
            F Y+ +K    +  + P  W V+GMLPG+L    R++    ++L+ S  TF+FKGP    
Sbjct  28   FSYLLIK---KTLQSYPWNWPVLGMLPGVLLRLQRIYDCSVEVLENSNMTFQFKGPWFVG  84

Query  307  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  486
            +D+L T DPANIHHI+S NFSNY KGP F +IF+  GDGI N D++LW   R  +   FN
Sbjct  85   MDVLATVDPANIHHIMSSNFSNYIKGPIFHEIFEAFGDGIINTDAELWRDWRNASQLIFN  144

Query  487  HAHFHTLLETNVWHKVQNGLLPLLDSFA  570
            H  +     +    KV +GL+PL + FA
Sbjct  145  HQRYQNFSASTTKTKVNDGLVPLFNHFA  172



>gb|KHN19680.1| Cytochrome P450 86B1 [Glycine soja]
Length=572

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  103  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  282
            +I + + C  Y   +         P  + ++GMLP +L N  R H  ++D+LK+ GGT E
Sbjct  9    VIVTAVLCMLYFLHRKRCCRHPLFP-DYPIIGMLPPVLCNLWRAHDLISDVLKQHGGTGE  67

Query  283  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  462
            F GP    ++ LI+ DP N+HH++S+NF NY KGP FR IF   GDGIF  DS+ W+++R
Sbjct  68   FTGPWFTIMNCLISSDPINVHHVMSKNFHNYVKGPVFRDIFQAFGDGIFTADSEAWKYNR  127

Query  463  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLD  561
                S F +  F   LE  + +KVQN LLP+LD
Sbjct  128  DLFHSLFKNRSFEFFLEKTIQNKVQNSLLPMLD  160



>ref|XP_009783405.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=520

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = +1

Query  166  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  345
            + +PR +  +GM PGLL +  ++H+    +L  +GGTF  KG    N D L T DPAN+H
Sbjct  35   NGLPRNYPFLGMFPGLLLHIQKIHESSAKLLPRAGGTFLLKGLWFTNTDTLCTLDPANVH  94

Query  346  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  525
            +I+S NFSN+PKGP+F++IFD LGDGIFN D  LWE  RK       +  +H  L   + 
Sbjct  95   YIMSTNFSNFPKGPEFKKIFDFLGDGIFNSDFDLWENQRKYARELIINQRYHKCLVKTIE  154

Query  526  HKVQNGLLPLLDSFAE  573
            +KV++GL+P+L+  A+
Sbjct  155  NKVKDGLIPILEFMAK  170



>emb|CDY42628.1| BnaC01g00400D [Brassica napus]
Length=557

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 88/152 (58%), Gaps = 0/152 (0%)
 Frame = +1

Query  118  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  297
            L CF      +         + W V+GMLPG L   HR++ F  ++L+++  TF FKGP 
Sbjct  13   LLCFLIFHHLLSKKPHDRFLKNWPVLGMLPGFLIVLHRIYDFSVEVLEQTNLTFPFKGPW  72

Query  298  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  477
               +D+L+T DPANIH+ILS NFSNY KG  F+++FDV G+ IFN D  LW   R+    
Sbjct  73   FTGMDILVTVDPANIHYILSSNFSNYTKGANFKEVFDVFGEMIFNSDGDLWRNQRRAAQY  132

Query  478  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
              NH  F  L  +    K+ +GL+PL D F++
Sbjct  133  MLNHQGFQKLSMSATRTKLDDGLVPLFDRFSK  164



>ref|XP_009123569.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
 emb|CDY41980.1| BnaA01g05520D [Brassica napus]
Length=503

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 84/132 (64%), Gaps = 0/132 (0%)
 Frame = +1

Query  178  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  357
            + W V+GMLPG L   HR++ F  ++L+++  TF FKGP    +D+L+T DPANIH+ILS
Sbjct  33   KNWPVLGMLPGFLIVLHRIYDFSVEVLEQTNLTFPFKGPWFTGMDILVTVDPANIHYILS  92

Query  358  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  537
             NFSNY KG  F+++FDV G+ IFN D  +W   R+      NH  F  L  +    K+ 
Sbjct  93   SNFSNYTKGADFKEVFDVFGEMIFNSDGDMWRNQRRAAQYMLNHQGFQKLSMSATRAKLD  152

Query  538  NGLLPLLDSFAE  573
            +GL+PL D F++
Sbjct  153  DGLVPLFDRFSK  164



>ref|XP_003555023.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Glycine max]
Length=509

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 82/127 (65%), Gaps = 0/127 (0%)
 Frame = +1

Query  181  KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSR  360
            KW ++GMLPG+  N   +  ++T +LK  GGTF F+GP L N++++ T DP N+ HI S 
Sbjct  32   KWPILGMLPGVFLNMPTIFDYITSVLKREGGTFMFEGPCLSNMNIMFTSDPMNVQHITST  91

Query  361  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQN  540
             F NY KG  FR+IF++LGDGIF  DSQLW ++R    S F  A F   +   + +K+++
Sbjct  92   KFQNYGKGNDFREIFEILGDGIFRSDSQLWNYNRTILHSVFRKASFQLFVHQTIMNKIES  151

Query  541  GLLPLLD  561
             LLP LD
Sbjct  152  CLLPFLD  158



>ref|XP_006604019.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Glycine max]
Length=530

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 82/127 (65%), Gaps = 0/127 (0%)
 Frame = +1

Query  181  KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSR  360
            KW ++GMLPG+  N   +  ++T +LK  GGTF F+GP L N++++ T DP N+ HI S 
Sbjct  32   KWPILGMLPGVFLNMPTIFDYITSVLKREGGTFMFEGPCLSNMNIMFTSDPMNVQHITST  91

Query  361  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQN  540
             F NY KG  FR+IF++LGDGIF  DSQLW ++R    S F  A F   +   + +K+++
Sbjct  92   KFQNYGKGNDFREIFEILGDGIFRSDSQLWNYNRTILHSVFRKASFQLFVHQTIMNKIES  151

Query  541  GLLPLLD  561
             LLP LD
Sbjct  152  CLLPFLD  158



>gb|EYU31098.1| hypothetical protein MIMGU_mgv1a004607mg [Erythranthe guttata]
Length=518

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = +1

Query  160  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESG-GTFEFKGPVLGNLDMLITCDPA  336
            ++  I   W ++GMLP LL++  R+H   T+IL+ +  GTF FKGP    +++L T +PA
Sbjct  20   NKKRIAWNWPLIGMLPALLHHVGRIHDGCTEILRRTRRGTFHFKGPWFSGMEILGTVNPA  79

Query  337  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  516
            N+H+I+S NF N+PKGP+FR+IFDVLGDGIFN D+  W   R+    F +H  FH  L  
Sbjct  80   NVHYIMSANFHNFPKGPKFREIFDVLGDGIFNSDADSWRHQRRAARGFLSHRRFHRFLVK  139

Query  517  NVWHKVQNGLLPLLD  561
                KV  GL+P+L+
Sbjct  140  ISRDKVAYGLVPVLE  154



>ref|XP_009773631.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=510

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 93/153 (61%), Gaps = 2/153 (1%)
 Frame = +1

Query  115  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  294
            F+  FC+  +  +   R +    W  +GM P L+++ HR+H+   ++L  + GTF  KG 
Sbjct  16   FVAIFCFFVLAFQG--RGSFIWNWPFLGMFPSLVFHIHRIHERSVEVLSRTRGTFLLKGL  73

Query  295  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  474
               N+D+L T DPAN+ +I+S NF+N+PKG + R+IFDVLGDGIF+ D  LW+  RK   
Sbjct  74   WFTNMDILGTVDPANVQYIMSANFTNFPKGRELRKIFDVLGDGIFSSDMDLWKNQRKLAR  133

Query  475  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
            +   H  FH  L      KV+NGL+P+L+  A+
Sbjct  134  ALITHQRFHKCLTKISLDKVKNGLIPILELIAK  166



>emb|CDX84084.1| BnaC08g07610D [Brassica napus]
Length=359

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLPGLL + +R++  + ++L+ S  TF FKGP L   D+LIT DPANI +ILS NF NYP
Sbjct  1    MLPGLLVHINRIYDAIAELLEASNMTFCFKGPWLSGTDILITVDPANIRYILSSNFDNYP  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  558
            KG +F+QIF+VLGD IFNVDS+LWE  R ++ + F+H  F          K+  GL+P+L
Sbjct  61   KGTEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQRFWVNTSVSKLNQGLVPIL  120

Query  559  DSFAE  573
            ++  E
Sbjct  121  ENAVE  125



>ref|XP_002894690.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70949.1| hypothetical protein ARALYDRAFT_474859 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +1

Query  172  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  351
            I + W  +GMLPG+L    R++ +  ++L+ S  TF FKGP L   DML T DP NI+HI
Sbjct  35   ILKNWPFLGMLPGMLPQIPRIYDWTVEVLEASNLTFYFKGPWLSGTDMLFTADPKNINHI  94

Query  352  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  531
            LS NF NYPKGP+F++IFDVLG+GI  VD +LWE  RK+  + F++  F  L  ++   K
Sbjct  95   LSSNFGNYPKGPEFKKIFDVLGEGILTVDLELWEDLRKSNHAMFHNQDFLELSLSSNKSK  154

Query  532  VQNGLLPLLDSFA  570
            ++ GL+P LD+ A
Sbjct  155  LKEGLVPFLDNAA  167



>ref|XP_010447431.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=508

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  184  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  363
            W V+ MLP LL   HR++ +   IL+ S  TF F+GP    +DML+T DPANIHHI++ N
Sbjct  35   WPVLRMLPALLRALHRIYDYSVKILEISNLTFPFEGPQFAGMDMLVTVDPANIHHIMTSN  94

Query  364  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  543
            F+NY KGP F+ +FDV GDGI   D +LW+  RK+  +  +   F     + +  K+++G
Sbjct  95   FTNYIKGPAFQDVFDVFGDGIITTDLELWKTLRKSYQAILHRQEFQRFSMSTMTRKLKDG  154

Query  544  LLPLLDSFAE  573
            L+PLLD FAE
Sbjct  155  LVPLLDHFAE  164



>ref|XP_002894062.1| CYP96A8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70321.1| CYP96A8 [Arabidopsis lyrata subsp. lyrata]
Length=521

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 94/161 (58%), Gaps = 6/161 (4%)
 Frame = +1

Query  100  FMIFSFL---GCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESG  270
            F+IF +      F Y+ +K    +  + P  W V+GMLPG+L    R++    +IL+ S 
Sbjct  16   FLIFYYFLVKKPFSYLPIK---KTLESYPWNWPVLGMLPGVLLRLQRIYDCSVEILENSN  72

Query  271  GTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLW  450
             TF+FKGP    + +L T DPANIHHI+S NFSNY KGP F +IF+  GDGI N DS+LW
Sbjct  73   LTFQFKGPWFVGMGILATVDPANIHHIMSSNFSNYIKGPIFHEIFEAFGDGIINSDSELW  132

Query  451  EFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE  573
               R  +   FNH  +     +    K+++GL+PL   FA+
Sbjct  133  RDWRNASQIIFNHQRYQNFSASTTKSKLKDGLVPLFSHFAD  173



>ref|XP_010554710.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=457

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +1

Query  199  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  378
            MLPG+L   HR++ +  +IL+ S  TF FKGP LG +DMLIT DPANIHHI+S NF NYP
Sbjct  1    MLPGVLVMFHRIYDWTVEILENSDMTFPFKGPWLGGIDMLITVDPANIHHIMSSNFGNYP  60

Query  379  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHF  498
            KG +F+ +FDVLGDGI NVD +LWE  RK+T + F+H  F
Sbjct  61   KGTEFKDVFDVLGDGIINVDGELWESLRKSTRTIFSHDGF  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750