BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003K05

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771504.1|  PREDICTED: probable serine/threonine-protein...    220   3e-68   Nicotiana sylvestris
ref|XP_009771502.1|  PREDICTED: probable serine/threonine-protein...    220   3e-68   Nicotiana sylvestris
ref|XP_009618839.1|  PREDICTED: probable serine/threonine-protein...    226   8e-68   Nicotiana tomentosiformis
ref|XP_009777631.1|  PREDICTED: probable serine/threonine-protein...    225   2e-67   Nicotiana sylvestris
ref|XP_009606854.1|  PREDICTED: probable serine/threonine-protein...    223   9e-67   Nicotiana tomentosiformis
ref|XP_006342111.1|  PREDICTED: probable serine/threonine-protein...    222   2e-66   Solanum tuberosum [potatoes]
ref|XP_004238413.1|  PREDICTED: probable serine/threonine-protein...    222   3e-66   Solanum lycopersicum
emb|CAN74078.1|  hypothetical protein VITISV_000979                     219   4e-65   Vitis vinifera
ref|XP_002285926.1|  PREDICTED: probable serine/threonine-protein...    218   1e-64   Vitis vinifera
emb|CDP07307.1|  unnamed protein product                                217   3e-64   Coffea canephora [robusta coffee]
ref|XP_008236113.1|  PREDICTED: probable serine/threonine-protein...    211   4e-62   Prunus mume [ume]
ref|XP_010094592.1|  putative serine/threonine-protein kinase           211   6e-62   Morus notabilis
ref|NP_567980.1|  BR-signaling kinase 1                                 210   9e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69121.1|  BnaC01g03320D                                          210   1e-61   
gb|EYU38018.1|  hypothetical protein MIMGU_mgv1a004862mg                207   2e-61   Erythranthe guttata [common monkey flower]
emb|CAA18746.1|  putative protein                                       210   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061148.1|  PREDICTED: probable serine/threonine-protein...    209   2e-61   Eucalyptus grandis [rose gum]
ref|XP_008360691.1|  PREDICTED: probable serine/threonine-protein...    209   3e-61   
ref|XP_007199795.1|  hypothetical protein PRUPE_ppa004587mg             207   3e-61   
ref|XP_010242854.1|  PREDICTED: probable serine/threonine-protein...    208   4e-61   Nelumbo nucifera [Indian lotus]
gb|KDO85050.1|  hypothetical protein CISIN_1g009750mg                   204   5e-61   Citrus sinensis [apfelsine]
ref|XP_009341554.1|  PREDICTED: probable serine/threonine-protein...    208   5e-61   Pyrus x bretschneideri [bai li]
ref|XP_007199796.1|  hypothetical protein PRUPE_ppa004587mg             208   5e-61   Prunus persica
ref|XP_010266119.1|  PREDICTED: probable serine/threonine-protein...    208   5e-61   Nelumbo nucifera [Indian lotus]
ref|XP_007017989.1|  BR-signaling kinase 1                              207   1e-60   Theobroma cacao [chocolate]
gb|KJB29674.1|  hypothetical protein B456_005G113100                    204   2e-60   Gossypium raimondii
emb|CDX75483.1|  BnaA01g02190D                                          207   2e-60   
gb|EYU38017.1|  hypothetical protein MIMGU_mgv1a004862mg                206   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_009350608.1|  PREDICTED: probable serine/threonine-protein...    204   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_009104299.1|  PREDICTED: probable serine/threonine-protein...    206   3e-60   Brassica rapa
ref|XP_011075006.1|  PREDICTED: probable serine/threonine-protein...    206   3e-60   
gb|KDP24732.1|  hypothetical protein JCGZ_25333                         206   4e-60   Jatropha curcas
gb|KJB29673.1|  hypothetical protein B456_005G113100                    202   4e-60   Gossypium raimondii
ref|XP_006435324.1|  hypothetical protein CICLE_v10000906mg             206   4e-60   Citrus clementina [clementine]
ref|XP_002525749.1|  receptor protein kinase, putative                  205   5e-60   Ricinus communis
ref|XP_004291229.1|  PREDICTED: probable serine/threonine-protein...    206   6e-60   Fragaria vesca subsp. vesca
gb|KDO85049.1|  hypothetical protein CISIN_1g009750mg                   206   8e-60   Citrus sinensis [apfelsine]
ref|XP_010646185.1|  PREDICTED: probable serine/threonine-protein...    205   9e-60   Vitis vinifera
ref|XP_011101028.1|  PREDICTED: probable serine/threonine-protein...    204   9e-60   Sesamum indicum [beniseed]
ref|XP_010526870.1|  PREDICTED: probable serine/threonine-protein...    204   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_011046296.1|  PREDICTED: probable serine/threonine-protein...    203   1e-59   Populus euphratica
ref|XP_009401888.1|  PREDICTED: probable serine/threonine-protein...    203   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010530944.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    204   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_002306223.1|  kinase family protein                              204   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_008382473.1|  PREDICTED: probable serine/threonine-protein...    204   1e-59   Malus domestica [apple tree]
gb|KJB29672.1|  hypothetical protein B456_005G113100                    204   2e-59   Gossypium raimondii
gb|KJB57985.1|  hypothetical protein B456_009G188600                    202   2e-59   Gossypium raimondii
gb|KFK30163.1|  hypothetical protein AALP_AA7G225300                    204   2e-59   Arabis alpina [alpine rockcress]
gb|KHG00998.1|  hypothetical protein F383_22564                         204   2e-59   Gossypium arboreum [tree cotton]
ref|XP_010918220.1|  PREDICTED: probable serine/threonine-protein...    204   2e-59   Elaeis guineensis
gb|KJB15932.1|  hypothetical protein B456_002G205100                    204   2e-59   Gossypium raimondii
ref|XP_008377092.1|  PREDICTED: probable serine/threonine-protein...    204   2e-59   Malus domestica [apple tree]
gb|KDP36831.1|  hypothetical protein JCGZ_08122                         204   2e-59   Jatropha curcas
ref|XP_009401887.1|  PREDICTED: probable serine/threonine-protein...    204   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007041656.1|  BR-signaling kinase 1 isoform 2                    202   3e-59   
gb|EYU17513.1|  hypothetical protein MIMGU_mgv1a005152mg                203   3e-59   Erythranthe guttata [common monkey flower]
ref|XP_011046295.1|  PREDICTED: probable serine/threonine-protein...    203   3e-59   Populus euphratica
ref|XP_006412130.1|  hypothetical protein EUTSA_v10024929mg             204   3e-59   Eutrema salsugineum [saltwater cress]
gb|KJB57984.1|  hypothetical protein B456_009G188600                    203   5e-59   Gossypium raimondii
ref|XP_003519690.1|  PREDICTED: probable serine/threonine-protein...    203   6e-59   Glycine max [soybeans]
ref|XP_010690264.1|  PREDICTED: probable serine/threonine-protein...    202   6e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008448316.1|  PREDICTED: probable serine/threonine-protein...    203   6e-59   Cucumis melo [Oriental melon]
ref|XP_008448319.1|  PREDICTED: probable serine/threonine-protein...    202   7e-59   
ref|XP_008448317.1|  PREDICTED: probable serine/threonine-protein...    202   7e-59   Cucumis melo [Oriental melon]
ref|XP_006575761.1|  PREDICTED: probable serine/threonine-protein...    202   7e-59   Glycine max [soybeans]
ref|XP_008448315.1|  PREDICTED: probable serine/threonine-protein...    203   8e-59   Cucumis melo [Oriental melon]
gb|AET01057.2|  LRR receptor-like kinase                                203   8e-59   Medicago truncatula
ref|XP_011088682.1|  PREDICTED: probable serine/threonine-protein...    202   8e-59   Sesamum indicum [beniseed]
ref|XP_004290043.1|  PREDICTED: probable serine/threonine-protein...    202   9e-59   Fragaria vesca subsp. vesca
ref|XP_010692837.1|  PREDICTED: probable serine/threonine-protein...    201   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010446962.1|  PREDICTED: probable serine/threonine-protein...    202   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006284955.1|  hypothetical protein CARUB_v10006257mg             202   1e-58   Capsella rubella
ref|XP_007041655.1|  BR-signaling kinase 1 isoform 1                    202   1e-58   
ref|XP_010103334.1|  putative serine/threonine-protein kinase           202   2e-58   Morus notabilis
ref|XP_010432311.1|  PREDICTED: probable serine/threonine-protein...    201   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002510650.1|  receptor protein kinase, putative                  201   2e-58   Ricinus communis
ref|XP_010437502.1|  PREDICTED: probable serine/threonine-protein...    201   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_003618098.1|  Receptor like protein kinase                       202   3e-58   
gb|KHG04837.1|  hypothetical protein F383_29489                         201   3e-58   Gossypium arboreum [tree cotton]
emb|CDP14516.1|  unnamed protein product                                201   3e-58   Coffea canephora [robusta coffee]
ref|XP_008791986.1|  PREDICTED: probable serine/threonine-protein...    201   4e-58   Phoenix dactylifera
ref|XP_008464872.1|  PREDICTED: probable serine/threonine-protein...    201   5e-58   Cucumis melo [Oriental melon]
ref|XP_002867085.1|  hypothetical protein ARALYDRAFT_328224             201   5e-58   
emb|CDY17529.1|  BnaC03g65340D                                          200   5e-58   Brassica napus [oilseed rape]
gb|KDO68274.1|  hypothetical protein CISIN_1g0105291mg                  192   7e-58   Citrus sinensis [apfelsine]
ref|XP_009108623.1|  PREDICTED: probable serine/threonine-protein...    199   7e-58   Brassica rapa
ref|XP_009108622.1|  PREDICTED: probable serine/threonine-protein...    200   8e-58   Brassica rapa
gb|AFK46540.1|  unknown                                                 200   8e-58   Medicago truncatula
ref|XP_009413047.1|  PREDICTED: probable serine/threonine-protein...    200   8e-58   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX76321.1|  BnaA08g10790D                                          200   8e-58   
ref|XP_006855115.1|  hypothetical protein AMTR_s00031p00205960          193   9e-58   
ref|XP_008221154.1|  PREDICTED: probable serine/threonine-protein...    199   1e-57   Prunus mume [ume]
ref|XP_007222343.1|  hypothetical protein PRUPE_ppa004797mg             199   1e-57   
ref|XP_009400327.1|  PREDICTED: probable serine/threonine-protein...    199   1e-57   
gb|EPS73400.1|  hypothetical protein M569_01345                         198   2e-57   Genlisea aurea
ref|XP_004491635.1|  PREDICTED: probable serine/threonine-protein...    199   2e-57   Cicer arietinum [garbanzo]
ref|XP_002312914.1|  kinase family protein                              198   2e-57   Populus trichocarpa [western balsam poplar]
gb|KHG04795.1|  putative inactive receptor-like kinase SSP              198   3e-57   Gossypium arboreum [tree cotton]
ref|XP_004491634.1|  PREDICTED: probable serine/threonine-protein...    199   4e-57   
ref|XP_004158304.1|  PREDICTED: probable serine/threonine-protein...    190   5e-57   
ref|XP_007142560.1|  hypothetical protein PHAVU_008G291100g             198   6e-57   Phaseolus vulgaris [French bean]
ref|XP_009334288.1|  PREDICTED: probable serine/threonine-protein...    197   6e-57   Pyrus x bretschneideri [bai li]
ref|XP_011034902.1|  PREDICTED: probable serine/threonine-protein...    197   7e-57   Populus euphratica
ref|XP_010548144.1|  PREDICTED: probable serine/threonine-protein...    197   7e-57   Tarenaya hassleriana [spider flower]
ref|XP_002300657.1|  hypothetical protein POPTR_0002s01310g             197   8e-57   Populus trichocarpa [western balsam poplar]
gb|KJB47748.1|  hypothetical protein B456_008G040100                    197   1e-56   Gossypium raimondii
ref|XP_003544865.1|  PREDICTED: probable serine/threonine-protein...    196   2e-56   Glycine max [soybeans]
ref|XP_003544864.1|  PREDICTED: probable serine/threonine-protein...    196   2e-56   Glycine max [soybeans]
ref|XP_009384615.1|  PREDICTED: probable serine/threonine-protein...    196   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006486634.1|  PREDICTED: probable serine/threonine-protein...    195   6e-56   Citrus sinensis [apfelsine]
ref|XP_006828955.1|  hypothetical protein AMTR_s00001p00232510          194   6e-56   Amborella trichopoda
ref|XP_006422467.1|  hypothetical protein CICLE_v10028235mg             194   7e-56   Citrus clementina [clementine]
ref|XP_006486632.1|  PREDICTED: probable serine/threonine-protein...    195   8e-56   Citrus sinensis [apfelsine]
gb|AFN88212.1|  putative serine/threonine-protein kinase                191   1e-55   Phaseolus vulgaris [French bean]
ref|XP_009594040.1|  PREDICTED: probable serine/threonine-protein...    193   3e-55   Nicotiana tomentosiformis
ref|XP_011045207.1|  PREDICTED: probable serine/threonine-protein...    192   4e-55   Populus euphratica
ref|XP_011045216.1|  PREDICTED: probable serine/threonine-protein...    192   5e-55   Populus euphratica
ref|XP_004144226.1|  PREDICTED: probable serine/threonine-protein...    191   2e-54   Cucumis sativus [cucumbers]
ref|XP_004139949.1|  PREDICTED: probable serine/threonine-protein...    190   5e-54   Cucumis sativus [cucumbers]
ref|XP_004154543.1|  PREDICTED: probable serine/threonine-protein...    189   9e-54   
ref|XP_006651012.1|  PREDICTED: probable serine/threonine-protein...    188   1e-53   
ref|XP_011041263.1|  PREDICTED: probable serine/threonine-protein...    188   4e-53   Populus euphratica
ref|XP_011041262.1|  PREDICTED: probable serine/threonine-protein...    188   4e-53   Populus euphratica
ref|XP_002468567.1|  hypothetical protein SORBIDRAFT_01g048160          187   5e-53   Sorghum bicolor [broomcorn]
ref|XP_003574272.1|  PREDICTED: probable serine/threonine-protein...    187   6e-53   Brachypodium distachyon [annual false brome]
ref|NP_001048870.1|  Os03g0132800                                       187   6e-53   
ref|XP_009397594.1|  PREDICTED: probable serine/threonine-protein...    187   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA43200.1|  TPA: putative protein kinase superfamily protein       179   1e-52   
ref|XP_003558885.1|  PREDICTED: probable serine/threonine-protein...    186   1e-52   Brachypodium distachyon [annual false brome]
gb|EAZ25481.1|  hypothetical protein OsJ_09304                          185   3e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985825.1|  PREDICTED: probable serine/threonine-protein...    183   1e-51   Setaria italica
ref|XP_004985824.1|  PREDICTED: probable serine/threonine-protein...    184   1e-51   Setaria italica
ref|XP_002307775.2|  hypothetical protein POPTR_0005s27070g             184   1e-51   Populus trichocarpa [western balsam poplar]
gb|KGN55487.1|  hypothetical protein Csa_4G653480                       181   2e-51   Cucumis sativus [cucumbers]
gb|ACF87849.1|  unknown                                                 182   5e-51   Zea mays [maize]
gb|AFW89597.1|  putative protein kinase superfamily protein             180   6e-51   
ref|XP_009781086.1|  PREDICTED: probable serine/threonine-protein...    181   7e-51   Nicotiana sylvestris
ref|XP_004145595.1|  PREDICTED: probable serine/threonine-protein...    181   8e-51   Cucumis sativus [cucumbers]
ref|NP_001141394.1|  uncharacterized LOC100273485                       181   1e-50   Zea mays [maize]
ref|NP_001151339.1|  ATP binding protein                                181   2e-50   
ref|XP_008658054.1|  PREDICTED: uncharacterized protein LOC100192...    181   2e-50   
ref|XP_004157122.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    180   3e-50   
ref|XP_008452940.1|  PREDICTED: probable serine/threonine-protein...    179   3e-50   
ref|XP_002467567.1|  hypothetical protein SORBIDRAFT_01g030290          179   6e-50   Sorghum bicolor [broomcorn]
ref|XP_009781084.1|  PREDICTED: probable serine/threonine-protein...    178   9e-50   Nicotiana sylvestris
ref|XP_002975669.1|  hypothetical protein SELMODRAFT_103506             177   1e-49   
ref|XP_009781085.1|  PREDICTED: probable serine/threonine-protein...    177   2e-49   Nicotiana sylvestris
ref|XP_001772928.1|  predicted protein                                  176   3e-49   
ref|XP_004983786.1|  PREDICTED: probable serine/threonine-protein...    177   4e-49   Setaria italica
ref|XP_009781087.1|  PREDICTED: probable serine/threonine-protein...    176   4e-49   Nicotiana sylvestris
tpg|DAA46127.1|  TPA: putative protein kinase superfamily protein       171   5e-49   
ref|XP_008375673.1|  PREDICTED: probable serine/threonine-protein...    170   5e-49   
ref|XP_008384888.1|  PREDICTED: probable serine/threonine-protein...    176   5e-49   
gb|EYU40299.1|  hypothetical protein MIMGU_mgv1a005192mg                174   6e-49   Erythranthe guttata [common monkey flower]
ref|XP_010066320.1|  PREDICTED: probable serine/threonine-protein...    176   6e-49   Eucalyptus grandis [rose gum]
ref|XP_010066321.1|  PREDICTED: probable serine/threonine-protein...    176   6e-49   Eucalyptus grandis [rose gum]
emb|CDP09344.1|  unnamed protein product                                176   6e-49   Coffea canephora [robusta coffee]
ref|XP_009629803.1|  PREDICTED: probable serine/threonine-protein...    176   7e-49   Nicotiana tomentosiformis
ref|XP_010275290.1|  PREDICTED: probable serine/threonine-protein...    176   7e-49   
ref|XP_004246370.1|  PREDICTED: probable serine/threonine-protein...    176   7e-49   Solanum lycopersicum
ref|XP_004229508.1|  PREDICTED: probable serine/threonine-protein...    176   8e-49   Solanum lycopersicum
ref|XP_004147901.1|  PREDICTED: probable serine/threonine-protein...    175   1e-48   Cucumis sativus [cucumbers]
ref|XP_010097731.1|  putative serine/threonine-protein kinase           176   1e-48   
ref|XP_006847686.1|  hypothetical protein AMTR_s00149p00051550          175   1e-48   Amborella trichopoda
gb|ADE76295.1|  unknown                                                 175   1e-48   Picea sitchensis
gb|EYU40298.1|  hypothetical protein MIMGU_mgv1a005192mg                175   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_009337366.1|  PREDICTED: probable serine/threonine-protein...    174   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_009337367.1|  PREDICTED: probable serine/threonine-protein...    174   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_007219059.1|  hypothetical protein PRUPE_ppa004847mg             174   2e-48   Prunus persica
ref|XP_010104360.1|  putative serine/threonine-protein kinase           174   2e-48   Morus notabilis
ref|XP_006363095.1|  PREDICTED: probable serine/threonine-protein...    174   3e-48   Solanum tuberosum [potatoes]
ref|XP_007210970.1|  hypothetical protein PRUPE_ppa022548mg             174   3e-48   Prunus persica
ref|XP_008673168.1|  PREDICTED: uncharacterized LOC100280241 isof...    174   3e-48   Zea mays [maize]
ref|XP_006354609.1|  PREDICTED: probable serine/threonine-protein...    174   4e-48   Solanum tuberosum [potatoes]
gb|KJB74454.1|  hypothetical protein B456_011G2959002                   168   4e-48   Gossypium raimondii
ref|XP_001770164.1|  predicted protein                                  173   5e-48   
ref|XP_004162757.1|  PREDICTED: probable serine/threonine-protein...    173   5e-48   
gb|AFW87784.1|  putative protein kinase superfamily protein             166   6e-48   
ref|XP_009781644.1|  PREDICTED: probable serine/threonine-protein...    173   6e-48   Nicotiana sylvestris
ref|XP_010087901.1|  putative serine/threonine-protein kinase           172   6e-48   
ref|XP_004294233.1|  PREDICTED: probable serine/threonine-protein...    173   6e-48   Fragaria vesca subsp. vesca
ref|XP_009769483.1|  PREDICTED: probable serine/threonine-protein...    173   7e-48   Nicotiana sylvestris
ref|XP_011460883.1|  PREDICTED: probable serine/threonine-protein...    173   7e-48   Fragaria vesca subsp. vesca
ref|XP_008448868.1|  PREDICTED: probable serine/threonine-protein...    173   8e-48   Cucumis melo [Oriental melon]
gb|KJB36863.1|  hypothetical protein B456_006G179500                    173   8e-48   Gossypium raimondii
gb|KDP28924.1|  hypothetical protein JCGZ_14695                         173   1e-47   Jatropha curcas
ref|XP_002276280.1|  PREDICTED: probable serine/threonine-protein...    172   1e-47   Vitis vinifera
ref|XP_011093461.1|  PREDICTED: probable serine/threonine-protein...    172   1e-47   Sesamum indicum [beniseed]
ref|XP_002527892.1|  receptor protein kinase, putative                  172   1e-47   Ricinus communis
ref|XP_008438236.1|  PREDICTED: probable serine/threonine-protein...    172   1e-47   Cucumis melo [Oriental melon]
ref|XP_010535431.1|  PREDICTED: probable serine/threonine-protein...    172   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_010650958.1|  PREDICTED: probable serine/threonine-protein...    172   1e-47   Vitis vinifera
gb|KJB74460.1|  hypothetical protein B456_011G2959002                   167   1e-47   Gossypium raimondii
ref|XP_008232240.1|  PREDICTED: probable serine/threonine-protein...    172   2e-47   Prunus mume [ume]
ref|XP_010262700.1|  PREDICTED: probable serine/threonine-protein...    172   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010101852.1|  putative serine/threonine-protein kinase           172   2e-47   Morus notabilis
gb|AES90840.2|  LRR receptor-like kinase                                172   2e-47   Medicago truncatula
ref|XP_002526522.1|  receptor protein kinase, putative                  172   2e-47   Ricinus communis
ref|XP_007008711.1|  BR-signaling kinase 2 isoform 1                    174   2e-47   
ref|XP_008238295.1|  PREDICTED: probable serine/threonine-protein...    172   2e-47   Prunus mume [ume]
ref|XP_009374330.1|  PREDICTED: probable serine/threonine-protein...    172   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009374328.1|  PREDICTED: probable serine/threonine-protein...    172   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009374327.1|  PREDICTED: probable serine/threonine-protein...    172   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009374331.1|  PREDICTED: probable serine/threonine-protein...    172   2e-47   Pyrus x bretschneideri [bai li]
emb|CDY12866.1|  BnaA09g14080D                                          164   2e-47   Brassica napus [oilseed rape]
ref|XP_010269970.1|  PREDICTED: probable serine/threonine-protein...    172   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_004983586.1|  PREDICTED: probable serine/threonine-protein...    172   2e-47   Setaria italica
ref|XP_001753441.1|  predicted protein                                  171   2e-47   
ref|XP_008355642.1|  PREDICTED: probable serine/threonine-protein...    172   3e-47   
ref|XP_008355637.1|  PREDICTED: probable serine/threonine-protein...    172   3e-47   
ref|XP_008355649.1|  PREDICTED: probable serine/threonine-protein...    171   3e-47   
ref|XP_008355658.1|  PREDICTED: probable serine/threonine-protein...    171   3e-47   
ref|XP_004300263.1|  PREDICTED: probable serine/threonine-protein...    171   3e-47   Fragaria vesca subsp. vesca
ref|XP_003608643.1|  Protein kinase-like protein                        172   3e-47   
ref|XP_009613653.1|  PREDICTED: probable serine/threonine-protein...    171   3e-47   Nicotiana tomentosiformis
ref|XP_007155758.1|  hypothetical protein PHAVU_003G229100g             171   4e-47   Phaseolus vulgaris [French bean]
ref|XP_008219944.1|  PREDICTED: probable serine/threonine-protein...    171   6e-47   Prunus mume [ume]
ref|XP_008219936.1|  PREDICTED: probable serine/threonine-protein...    171   6e-47   
ref|XP_007207418.1|  hypothetical protein PRUPE_ppa004824mg             171   6e-47   Prunus persica
ref|XP_007134779.1|  hypothetical protein PHAVU_010G075300g             171   6e-47   Phaseolus vulgaris [French bean]
gb|EPS63745.1|  hypothetical protein M569_11039                         170   7e-47   Genlisea aurea
ref|XP_010677274.1|  PREDICTED: probable serine/threonine-protein...    170   8e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011085053.1|  PREDICTED: probable serine/threonine-protein...    170   9e-47   Sesamum indicum [beniseed]
ref|XP_011085061.1|  PREDICTED: probable serine/threonine-protein...    170   9e-47   Sesamum indicum [beniseed]
ref|XP_006662088.1|  PREDICTED: probable serine/threonine-protein...    170   9e-47   Oryza brachyantha
ref|XP_006287612.1|  hypothetical protein CARUB_v10000824mg             170   9e-47   Capsella rubella
ref|XP_003524482.1|  PREDICTED: probable serine/threonine-protein...    170   1e-46   Glycine max [soybeans]
ref|XP_010056495.1|  PREDICTED: probable serine/threonine-protein...    170   1e-46   Eucalyptus grandis [rose gum]
ref|NP_191980.2|  BR-signaling kinase 3                                 170   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875018.1|  kinase family protein                              170   1e-46   
gb|AAC13615.1|  F6N23.9 gene product                                    170   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|EEC67482.1|  hypothetical protein OsI_34730                          170   1e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_002280602.1|  PREDICTED: probable serine/threonine-protein...    170   1e-46   Vitis vinifera
ref|NP_001065455.1|  Os10g0571300                                       170   1e-46   
ref|XP_003549974.1|  PREDICTED: probable serine/threonine-protein...    169   2e-46   Glycine max [soybeans]
ref|XP_006464341.1|  PREDICTED: probable serine/threonine-protein...    168   2e-46   
ref|XP_003574368.1|  PREDICTED: probable serine/threonine-protein...    169   2e-46   Brachypodium distachyon [annual false brome]
gb|KHG04747.1|  hypothetical protein F383_01426                         169   2e-46   Gossypium arboreum [tree cotton]
gb|EPS71043.1|  hypothetical protein M569_03708                         169   2e-46   Genlisea aurea
ref|XP_006445512.1|  hypothetical protein CICLE_v10019840mg             168   2e-46   
gb|KDP24521.1|  hypothetical protein JCGZ_25085                         169   2e-46   Jatropha curcas
ref|XP_006401013.1|  hypothetical protein EUTSA_v10013377mg             169   2e-46   Eutrema salsugineum [saltwater cress]
gb|KDO76141.1|  hypothetical protein CISIN_1g0113532mg                  164   2e-46   Citrus sinensis [apfelsine]
ref|XP_006445511.1|  hypothetical protein CICLE_v10019840mg             167   2e-46   
ref|XP_010427322.1|  PREDICTED: probable serine/threonine-protein...    169   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006396266.1|  hypothetical protein EUTSA_v10028608mg             169   3e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010256740.1|  PREDICTED: probable serine/threonine-protein...    169   3e-46   
ref|XP_006280371.1|  hypothetical protein CARUB_v10026298mg             167   4e-46   
ref|XP_006445513.1|  hypothetical protein CICLE_v10019840mg             169   4e-46   Citrus clementina [clementine]
ref|XP_001769037.1|  predicted protein                                  166   4e-46   
ref|XP_006464340.1|  PREDICTED: probable serine/threonine-protein...    169   4e-46   Citrus sinensis [apfelsine]
ref|NP_001148892.1|  ATP binding protein                                169   4e-46   
ref|XP_002467458.1|  hypothetical protein SORBIDRAFT_01g028460          169   4e-46   Sorghum bicolor [broomcorn]
gb|KDO76139.1|  hypothetical protein CISIN_1g0113532mg                  165   4e-46   Citrus sinensis [apfelsine]
ref|XP_008385086.1|  PREDICTED: probable serine/threonine-protein...    168   4e-46   
gb|AFW87785.1|  putative protein kinase superfamily protein             169   4e-46   
ref|XP_009111467.1|  PREDICTED: probable serine/threonine-protein...    168   4e-46   Brassica rapa
emb|CDY07203.1|  BnaCnng02180D                                          168   4e-46   
ref|XP_011028219.1|  PREDICTED: probable serine/threonine-protein...    168   4e-46   Populus euphratica
ref|XP_009126720.1|  PREDICTED: probable serine/threonine-protein...    168   5e-46   Brassica rapa
emb|CDY32670.1|  BnaA02g07320D                                          168   5e-46   Brassica napus [oilseed rape]
emb|CDY02851.1|  BnaC02g10380D                                          168   6e-46   
ref|XP_002509803.1|  receptor protein kinase, putative                  163   6e-46   
ref|XP_009626367.1|  PREDICTED: probable serine/threonine-protein...    168   6e-46   
ref|XP_006280372.1|  hypothetical protein CARUB_v10026298mg             168   7e-46   Capsella rubella
ref|XP_006827662.1|  hypothetical protein AMTR_s00009p00252980          168   7e-46   Amborella trichopoda
gb|KDO76140.1|  hypothetical protein CISIN_1g0113532mg                  165   7e-46   Citrus sinensis [apfelsine]
ref|XP_009134536.1|  PREDICTED: probable serine/threonine-protein...    167   8e-46   Brassica rapa
gb|KDO76138.1|  hypothetical protein CISIN_1g0113532mg                  165   8e-46   Citrus sinensis [apfelsine]
ref|XP_002520456.1|  receptor protein kinase, putative                  167   9e-46   Ricinus communis
emb|CDY67218.1|  BnaC09g53790D                                          167   9e-46   Brassica napus [oilseed rape]
emb|CDX74345.1|  BnaA03g27020D                                          167   9e-46   
ref|XP_002866308.1|  hypothetical protein ARALYDRAFT_496029             167   1e-45   
emb|CDY51145.1|  BnaA09g51800D                                          167   1e-45   Brassica napus [oilseed rape]
ref|XP_004509007.1|  PREDICTED: probable serine/threonine-protein...    167   1e-45   Cicer arietinum [garbanzo]
ref|XP_006385621.1|  kinase family protein                              167   1e-45   
gb|KDP25437.1|  hypothetical protein JCGZ_20593                         167   1e-45   Jatropha curcas
emb|CDX91898.1|  BnaC03g32000D                                          167   1e-45   
gb|KJB37545.1|  hypothetical protein B456_006G209500                    167   1e-45   Gossypium raimondii
ref|XP_008788683.1|  PREDICTED: probable serine/threonine-protein...    167   1e-45   
ref|NP_200709.2|  brassinosteroid-signaling kinase 5                    167   1e-45   
ref|XP_010540278.1|  PREDICTED: probable serine/threonine-protein...    167   1e-45   
ref|XP_009120410.1|  PREDICTED: probable serine/threonine-protein...    167   1e-45   
gb|EYU26629.1|  hypothetical protein MIMGU_mgv1a005339mg                167   1e-45   
ref|XP_004133947.1|  PREDICTED: probable serine/threonine-protein...    167   1e-45   
ref|XP_009627922.1|  PREDICTED: probable serine/threonine-protein...    167   2e-45   
ref|XP_003520945.1|  PREDICTED: probable serine/threonine-protein...    167   2e-45   
gb|KHN32516.1|  Putative serine/threonine-protein kinase                167   2e-45   
ref|XP_009382808.1|  PREDICTED: probable serine/threonine-protein...    167   2e-45   
ref|XP_008464075.1|  PREDICTED: probable serine/threonine-protein...    167   2e-45   
gb|EYU26628.1|  hypothetical protein MIMGU_mgv1a005339mg                167   2e-45   
ref|XP_007051830.1|  BR-signaling kinase 3                              167   2e-45   
ref|XP_004509006.1|  PREDICTED: probable serine/threonine-protein...    167   2e-45   
emb|CDP06541.1|  unnamed protein product                                167   2e-45   
ref|XP_001757342.1|  predicted protein                                  162   2e-45   
ref|XP_010934997.1|  PREDICTED: probable serine/threonine-protein...    166   2e-45   
ref|XP_006439590.1|  hypothetical protein CICLE_v10019894mg             165   2e-45   
ref|XP_011094943.1|  PREDICTED: probable serine/threonine-protein...    166   2e-45   
ref|XP_008658549.1|  PREDICTED: probable serine/threonine-protein...    166   2e-45   
ref|XP_009396196.1|  PREDICTED: probable serine/threonine-protein...    166   2e-45   
ref|XP_011081147.1|  PREDICTED: probable serine/threonine-protein...    166   2e-45   
ref|XP_010477276.1|  PREDICTED: probable serine/threonine-protein...    157   2e-45   
ref|XP_008799360.1|  PREDICTED: probable serine/threonine-protein...    166   3e-45   
ref|XP_004302682.1|  PREDICTED: probable serine/threonine-protein...    166   3e-45   
ref|XP_006848031.1|  hypothetical protein AMTR_s00029p00181840          166   3e-45   
ref|XP_010273058.1|  PREDICTED: probable serine/threonine-protein...    166   3e-45   
ref|XP_010529125.1|  PREDICTED: probable serine/threonine-protein...    166   3e-45   
gb|KDO76133.1|  hypothetical protein CISIN_1g0113532mg                  166   4e-45   
dbj|BAK00086.1|  predicted protein                                      166   4e-45   
ref|XP_006439591.1|  hypothetical protein CICLE_v10019894mg             166   4e-45   
gb|KDO76134.1|  hypothetical protein CISIN_1g0113532mg                  166   4e-45   
ref|XP_006476603.1|  PREDICTED: probable serine/threonine-protein...    166   4e-45   
gb|KEH29001.1|  LRR receptor-like kinase                                164   4e-45   
gb|KDP46579.1|  hypothetical protein JCGZ_08551                         166   5e-45   
gb|KDO76136.1|  hypothetical protein CISIN_1g0113532mg                  165   5e-45   
ref|XP_009373443.1|  PREDICTED: probable serine/threonine-protein...    166   5e-45   
ref|XP_004143136.1|  PREDICTED: probable serine/threonine-protein...    165   6e-45   
gb|EEE51445.1|  hypothetical protein OsJ_32540                          169   6e-45   
gb|KDO86129.1|  hypothetical protein CISIN_1g011068mg                   162   6e-45   
gb|ACJ85588.1|  unknown                                                 164   6e-45   
ref|XP_010273050.1|  PREDICTED: probable serine/threonine-protein...    166   6e-45   
ref|XP_002308195.1|  kinase family protein                              165   7e-45   
ref|XP_006381227.1|  hypothetical protein POPTR_0006s09500g             165   7e-45   
gb|KJB52104.1|  hypothetical protein B456_008G246800                    164   7e-45   
ref|XP_009794755.1|  PREDICTED: probable serine/threonine-protein...    165   7e-45   
ref|XP_002322938.1|  kinase family protein                              165   8e-45   
gb|EEC78283.1|  hypothetical protein OsI_17982                          165   8e-45   
ref|XP_010443652.1|  PREDICTED: probable serine/threonine-protein...    165   9e-45   
ref|XP_007016247.1|  Kinase protein with tetratricopeptide repeat...    165   9e-45   
ref|XP_002299839.1|  kinase family protein                              164   9e-45   
gb|EPS66661.1|  hypothetical protein M569_08114                         164   1e-44   
gb|KEH18870.1|  LRR receptor-like kinase                                164   1e-44   
ref|XP_004298792.1|  PREDICTED: probable serine/threonine-protein...    164   1e-44   
ref|XP_007219058.1|  hypothetical protein PRUPE_ppa004843mg             164   1e-44   
gb|KEH29000.1|  LRR receptor-like kinase                                164   1e-44   
ref|XP_011032200.1|  PREDICTED: probable serine/threonine-protein...    164   1e-44   
ref|XP_011032201.1|  PREDICTED: probable serine/threonine-protein...    164   1e-44   
ref|XP_009395438.1|  PREDICTED: probable serine/threonine-protein...    164   1e-44   
gb|AAX61122.1|  stress-inducible protein kinase                         161   1e-44   
ref|XP_008244902.1|  PREDICTED: probable serine/threonine-protein...    164   1e-44   
gb|KJB52101.1|  hypothetical protein B456_008G246800                    164   1e-44   
ref|XP_004513275.1|  PREDICTED: probable serine/threonine-protein...    164   1e-44   
gb|EEE61937.1|  hypothetical protein OsJ_16683                          164   1e-44   
ref|XP_001782381.1|  predicted protein                                  164   1e-44   
ref|XP_010685653.1|  PREDICTED: probable serine/threonine-protein...    164   1e-44   
gb|KJB49493.1|  hypothetical protein B456_008G122000                    162   2e-44   
ref|XP_011019187.1|  PREDICTED: probable serine/threonine-protein...    164   2e-44   
ref|XP_002314137.1|  kinase family protein                              164   2e-44   
gb|KDO86130.1|  hypothetical protein CISIN_1g011068mg                   164   2e-44   
gb|KJB16992.1|  hypothetical protein B456_002G259200                    164   2e-44   
emb|CAJ86160.1|  H0913C04.1                                             164   2e-44   
ref|XP_007209958.1|  hypothetical protein PRUPE_ppa004862mg             164   2e-44   
ref|XP_010530337.1|  PREDICTED: probable serine/threonine-protein...    164   2e-44   
ref|XP_010483518.1|  PREDICTED: probable serine/threonine-protein...    164   2e-44   
ref|XP_010530338.1|  PREDICTED: probable serine/threonine-protein...    164   2e-44   
ref|XP_011029267.1|  PREDICTED: probable serine/threonine-protein...    164   2e-44   
ref|XP_009630032.1|  PREDICTED: probable serine/threonine-protein...    164   2e-44   
ref|XP_009796958.1|  PREDICTED: probable serine/threonine-protein...    163   2e-44   
gb|EYU41809.1|  hypothetical protein MIMGU_mgv1a004097mg                164   3e-44   
ref|XP_010553513.1|  PREDICTED: probable serine/threonine-protein...    163   3e-44   
gb|KFK27443.1|  hypothetical protein AALP_AA8G383000                    163   3e-44   
ref|XP_008373543.1|  PREDICTED: probable serine/threonine-protein...    163   3e-44   
ref|XP_006445068.1|  hypothetical protein CICLE_v10019852mg             163   3e-44   
ref|XP_006445067.1|  hypothetical protein CICLE_v10019852mg             163   4e-44   
ref|XP_004250894.1|  PREDICTED: probable serine/threonine-protein...    163   4e-44   
emb|CDP09128.1|  unnamed protein product                                163   4e-44   
ref|XP_001754196.1|  predicted protein                                  162   4e-44   
ref|XP_011035233.1|  PREDICTED: probable serine/threonine-protein...    163   4e-44   
ref|XP_011035234.1|  PREDICTED: probable serine/threonine-protein...    163   4e-44   
ref|XP_002321250.2|  hypothetical protein POPTR_0014s17740g             163   4e-44   
ref|XP_011010377.1|  PREDICTED: probable serine/threonine-protein...    163   4e-44   
ref|XP_006356355.1|  PREDICTED: probable serine/threonine-protein...    163   5e-44   
gb|AAG13605.1|AC051633_21  protein kinase-like protein                  163   5e-44   
gb|KJB49494.1|  hypothetical protein B456_008G122000                    163   5e-44   
ref|XP_002320126.1|  kinase family protein                              162   5e-44   
ref|XP_002270065.1|  PREDICTED: probable serine/threonine-protein...    162   5e-44   
ref|XP_003580850.1|  PREDICTED: probable serine/threonine-protein...    162   5e-44   
gb|KDO86128.1|  hypothetical protein CISIN_1g011068mg                   162   6e-44   
ref|XP_006350809.1|  PREDICTED: probable serine/threonine-protein...    162   6e-44   
ref|XP_008238842.1|  PREDICTED: probable serine/threonine-protein...    162   7e-44   
ref|XP_011036082.1|  PREDICTED: probable serine/threonine-protein...    162   7e-44   
ref|XP_003543546.1|  PREDICTED: probable serine/threonine-protein...    162   7e-44   
gb|KHN21909.1|  Putative serine/threonine-protein kinase                162   7e-44   
gb|EYU23482.1|  hypothetical protein MIMGU_mgv1a005326mg                162   8e-44   
ref|XP_010941215.1|  PREDICTED: probable serine/threonine-protein...    162   8e-44   
ref|XP_004510799.1|  PREDICTED: probable serine/threonine-protein...    162   8e-44   
gb|EYU23481.1|  hypothetical protein MIMGU_mgv1a005326mg                162   8e-44   
ref|XP_006339002.1|  PREDICTED: probable serine/threonine-protein...    162   8e-44   
ref|NP_001236708.1|  TPR-containing protein kinase                      162   8e-44   
ref|XP_007040223.1|  Kinase protein with tetratricopeptide repeat...    162   8e-44   
ref|XP_004249553.1|  PREDICTED: probable serine/threonine-protein...    162   8e-44   
ref|XP_007040220.1|  Kinase protein with tetratricopeptide repeat...    162   9e-44   
gb|ABF50637.1|  tetratricopeptide repeat-containing protein kinase 1    162   9e-44   
ref|XP_008366761.1|  PREDICTED: probable serine/threonine-protein...    162   1e-43   
ref|XP_008239954.1|  PREDICTED: probable serine/threonine-protein...    162   1e-43   
ref|XP_008787537.1|  PREDICTED: probable serine/threonine-protein...    160   1e-43   
ref|XP_007205108.1|  hypothetical protein PRUPE_ppa004740mg             162   1e-43   
ref|XP_004507143.1|  PREDICTED: probable serine/threonine-protein...    162   1e-43   
ref|XP_004507142.1|  PREDICTED: probable serine/threonine-protein...    162   1e-43   
ref|XP_007026838.1|  Kinase protein with tetratricopeptide repeat...    162   1e-43   
ref|XP_007132022.1|  hypothetical protein PHAVU_011G060100g             162   1e-43   
ref|XP_008668669.1|  PREDICTED: probable serine/threonine-protein...    162   1e-43   
gb|ACR36895.1|  unknown                                                 162   1e-43   
emb|CDP09742.1|  unnamed protein product                                161   1e-43   
ref|XP_010934763.1|  PREDICTED: probable serine/threonine-protein...    162   1e-43   
ref|XP_002447350.1|  hypothetical protein SORBIDRAFT_06g033460          161   2e-43   
ref|XP_006414164.1|  hypothetical protein EUTSA_v10025008mg             160   2e-43   
ref|XP_008778787.1|  PREDICTED: probable serine/threonine-protein...    161   2e-43   
ref|XP_009768644.1|  PREDICTED: probable serine/threonine-protein...    161   2e-43   
ref|XP_010314694.1|  PREDICTED: probable serine/threonine-protein...    161   2e-43   
ref|XP_010695172.1|  PREDICTED: probable serine/threonine-protein...    161   2e-43   
ref|XP_004507141.1|  PREDICTED: probable serine/threonine-protein...    161   2e-43   
ref|XP_010695169.1|  PREDICTED: probable serine/threonine-protein...    161   2e-43   
gb|EMT03854.1|  Putative serine/threonine-protein kinase                155   2e-43   
ref|NP_001149017.1|  protein kinase APK1B                               161   2e-43   
ref|XP_010089111.1|  putative serine/threonine-protein kinase           161   2e-43   
ref|XP_011469028.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    161   2e-43   
ref|XP_010940472.1|  PREDICTED: probable serine/threonine-protein...    159   2e-43   
ref|XP_011023359.1|  PREDICTED: probable serine/threonine-protein...    160   3e-43   
ref|XP_010661771.1|  PREDICTED: probable serine/threonine-protein...    160   3e-43   
ref|XP_011023358.1|  PREDICTED: probable serine/threonine-protein...    160   3e-43   
dbj|BAJ85945.1|  predicted protein                                      160   3e-43   
ref|XP_002299534.1|  kinase family protein                              160   3e-43   
ref|XP_010661772.1|  PREDICTED: probable serine/threonine-protein...    160   3e-43   
dbj|BAK00076.1|  predicted protein                                      160   3e-43   
ref|XP_003528859.1|  PREDICTED: probable serine/threonine-protein...    160   3e-43   
ref|XP_006480926.1|  PREDICTED: probable serine/threonine-protein...    160   3e-43   
ref|XP_004143908.1|  PREDICTED: probable serine/threonine-protein...    160   4e-43   
ref|XP_006429250.1|  hypothetical protein CICLE_v10011574mg             160   4e-43   
ref|XP_009134535.1|  PREDICTED: probable serine/threonine-protein...    160   4e-43   
ref|XP_003521048.1|  PREDICTED: probable serine/threonine-protein...    160   4e-43   
ref|XP_006424976.1|  hypothetical protein CICLE_v10028295mg             160   5e-43   
ref|XP_006424975.1|  hypothetical protein CICLE_v10028295mg             160   5e-43   
ref|XP_004242068.2|  PREDICTED: probable serine/threonine-protein...    160   5e-43   
ref|XP_011022704.1|  PREDICTED: probable serine/threonine-protein...    160   5e-43   
gb|KDO66709.1|  hypothetical protein CISIN_1g011349mg                   158   5e-43   
ref|XP_006414165.1|  hypothetical protein EUTSA_v10025008mg             160   5e-43   
gb|KEH30209.1|  LRR receptor-like kinase                                158   5e-43   
ref|XP_006349787.1|  PREDICTED: probable serine/threonine-protein...    160   6e-43   
ref|XP_011022702.1|  PREDICTED: probable serine/threonine-protein...    160   6e-43   
gb|KJB55794.1|  hypothetical protein B456_009G094800                    159   6e-43   
gb|KHG14731.1|  hypothetical protein F383_06315                         160   6e-43   
ref|XP_002301354.1|  kinase family protein                              160   6e-43   
ref|XP_004492722.1|  PREDICTED: probable serine/threonine-protein...    160   6e-43   
gb|KDO66707.1|  hypothetical protein CISIN_1g011349mg                   158   7e-43   
ref|XP_002303586.2|  kinase family protein                              159   7e-43   
gb|KJB55795.1|  hypothetical protein B456_009G094800                    159   7e-43   
ref|XP_010940470.1|  PREDICTED: probable serine/threonine-protein...    159   7e-43   
ref|XP_010053259.1|  PREDICTED: probable serine/threonine-protein...    159   8e-43   
ref|XP_008437265.1|  PREDICTED: probable serine/threonine-protein...    159   8e-43   
ref|XP_009358810.1|  PREDICTED: probable serine/threonine-protein...    159   8e-43   
ref|NP_171679.1|  brassinosteroid-signaling kinase 4                    159   9e-43   
gb|KDO66708.1|  hypothetical protein CISIN_1g011349mg                   158   9e-43   
ref|XP_009412569.1|  PREDICTED: probable serine/threonine-protein...    159   9e-43   
ref|XP_006356351.1|  PREDICTED: probable serine/threonine-protein...    162   1e-42   
ref|XP_008370030.1|  PREDICTED: probable serine/threonine-protein...    159   1e-42   
tpg|DAA35281.1|  TPA: putative protein kinase superfamily protein       161   2e-42   
gb|KDO66706.1|  hypothetical protein CISIN_1g011349mg                   159   2e-42   
ref|XP_008375097.1|  PREDICTED: probable serine/threonine-protein...    150   2e-42   
gb|KEH30208.1|  LRR receptor-like kinase                                158   2e-42   
ref|XP_002511845.1|  receptor protein kinase, putative                  158   2e-42   
emb|CDY01839.1|  BnaC06g28790D                                          158   2e-42   
ref|XP_007135047.1|  hypothetical protein PHAVU_010G097200g             158   2e-42   
ref|XP_009789548.1|  PREDICTED: probable serine/threonine-protein...    158   2e-42   
ref|XP_009337369.1|  PREDICTED: probable serine/threonine-protein...    158   3e-42   
ref|XP_008801372.1|  PREDICTED: probable serine/threonine-protein...    158   3e-42   
ref|XP_010528620.1|  PREDICTED: probable serine/threonine-protein...    158   3e-42   
ref|XP_006403626.1|  hypothetical protein EUTSA_v10010321mg             158   3e-42   
ref|XP_009594297.1|  PREDICTED: probable serine/threonine-protein...    157   4e-42   
ref|XP_009112750.1|  PREDICTED: probable serine/threonine-protein...    157   4e-42   
ref|XP_009346992.1|  PREDICTED: probable serine/threonine-protein...    157   4e-42   
emb|CDY68942.1|  BnaAnng28860D                                          157   4e-42   
ref|XP_009101507.1|  PREDICTED: probable serine/threonine-protein...    157   5e-42   
emb|CDY66348.1|  BnaC04g54930D                                          157   5e-42   
ref|XP_010449528.1|  PREDICTED: probable serine/threonine-protein...    157   5e-42   
ref|XP_010044037.1|  PREDICTED: probable serine/threonine-protein...    157   5e-42   
ref|XP_007160056.1|  hypothetical protein PHAVU_002G289000g             157   6e-42   
ref|NP_176539.4|  Protein kinase protein with tetratricopeptide r...    157   6e-42   
ref|XP_002887955.1|  kinase family protein                              157   6e-42   
ref|XP_010255400.1|  PREDICTED: probable serine/threonine-protein...    157   6e-42   
emb|CDY25502.1|  BnaC09g11270D                                          157   6e-42   
emb|CDX96069.1|  BnaA07g26620D                                          157   6e-42   
ref|XP_010553263.1|  PREDICTED: probable serine/threonine-protein...    157   6e-42   
emb|CDY34359.1|  BnaA09g11010D                                          157   7e-42   
ref|XP_010055633.1|  PREDICTED: probable serine/threonine-protein...    157   7e-42   
ref|XP_009112941.1|  PREDICTED: probable serine/threonine-protein...    157   7e-42   
ref|XP_010931161.1|  PREDICTED: probable serine/threonine-protein...    157   7e-42   
ref|XP_009606616.1|  PREDICTED: probable serine/threonine-protein...    157   7e-42   
gb|KFK31458.1|  hypothetical protein AALP_AA6G114300                    157   7e-42   
ref|XP_006302192.1|  hypothetical protein CARUB_v10020201mg             157   7e-42   
ref|XP_009419726.1|  PREDICTED: probable serine/threonine-protein...    157   7e-42   
emb|CDX77672.1|  BnaC07g19260D                                          157   7e-42   
ref|XP_006391738.1|  hypothetical protein EUTSA_v10023428mg             157   8e-42   
ref|XP_009342509.1|  PREDICTED: probable serine/threonine-protein...    157   8e-42   
emb|CDY44497.1|  BnaC01g10520D                                          157   8e-42   
gb|KJB19968.1|  hypothetical protein B456_003G126600                    155   8e-42   
ref|XP_010105949.1|  putative serine/threonine-protein kinase           157   9e-42   
ref|XP_009123286.1|  PREDICTED: probable serine/threonine-protein...    149   9e-42   
ref|XP_010430453.1|  PREDICTED: probable serine/threonine-protein...    156   1e-41   
gb|KFK40503.1|  hypothetical protein AALP_AA2G004300                    156   1e-41   



>ref|XP_009771504.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Nicotiana sylvestris]
Length=264

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 123/159 (77%), Gaps = 7/159 (4%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLS-SNGKDsgggggggaaseggasVFAEFSLSE  233
            MGCW S+ S   P S  DHR    H     SNG          A S+GG   F+EFSL+E
Sbjct  1    MGCWHSSLSSKDPTS--DHRHVHTHKPPRFSNGT----TAAAAAVSDGGVPAFSEFSLAE  54

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LK ATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTK AWPD KQFADEA GVG
Sbjct  55   LKTATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKLAWPDPKQFADEAWGVG  114

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RH+R+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  115  KLRHRRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  153



>ref|XP_009771502.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Nicotiana sylvestris]
Length=272

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 123/159 (77%), Gaps = 7/159 (4%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLS-SNGKDsgggggggaaseggasVFAEFSLSE  233
            MGCW S+ S   P S  DHR    H     SNG          A S+GG   F+EFSL+E
Sbjct  1    MGCWHSSLSSKDPTS--DHRHVHTHKPPRFSNG----TTAAAAAVSDGGVPAFSEFSLAE  54

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LK ATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTK AWPD KQFADEA GVG
Sbjct  55   LKTATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKLAWPDPKQFADEAWGVG  114

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RH+R+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  115  KLRHRRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  153



>ref|XP_009618839.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
Length=497

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 127/158 (80%), Gaps = 8/158 (5%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC QS+  ++   SEKD R G      +SNG        G A  +GG  VF+EFSLSEL
Sbjct  1    MGCCQSSIQQELS-SEKDQRHGGVSHPRASNG-------TGAAVGDGGVPVFSEFSLSEL  52

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSSEFIVSESGEKAPN+VYKGRLQNRRWIAVKKFTKTAWPD KQFADEA GVGK
Sbjct  53   KAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKTAWPDPKQFADEASGVGK  112

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRLANLIGYC DGDERLLVAE+MPNDTLAKHLFHW
Sbjct  113  LRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHW  150



>ref|XP_009777631.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana sylvestris]
Length=497

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 127/158 (80%), Gaps = 8/158 (5%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC QS+  ++   SEKD R G      +SNG        G A  +GG  VF+EFSLSEL
Sbjct  1    MGCCQSSILQELS-SEKDQRHGGVSHPRASNG-------TGAAVGDGGVPVFSEFSLSEL  52

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSSEFIVSESGEKAPN+VYKGRLQNRRWIAVKKFTKTAWPD KQFADEA GVGK
Sbjct  53   KAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKTAWPDPKQFADEASGVGK  112

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRLANLIGYC DGDERLLVAE+MPNDTLAKHLFHW
Sbjct  113  LRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHW  150



>ref|XP_009606854.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
Length=501

 Score =   223 bits (568),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 123/159 (77%), Gaps = 7/159 (4%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLS-SNGKDsgggggggaaseggasVFAEFSLSE  233
            MGCW S+ S   P S  DHR    H     SNG          A S+GG   F+EFSL+E
Sbjct  1    MGCWHSSLSSKDPTS--DHRHVHTHKPPRFSNG----TTAAAPAVSDGGVPAFSEFSLAE  54

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LK ATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTK AWPD KQFADEA GVG
Sbjct  55   LKTATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKLAWPDPKQFADEAWGVG  114

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RHKR+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  115  KLRHKRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  153



>ref|XP_006342111.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Solanum tuberosum]
Length=498

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 127/158 (80%), Gaps = 7/158 (4%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC QS+  K+   SEKD R G        N + S G G G A  +GG  VF+EFSLSEL
Sbjct  1    MGCCQSSILKELS-SEKDQRHG------VVNARPSNGTGAGAAVGDGGVPVFSEFSLSEL  53

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSSEFIVSESGEKAPN+VYKGRLQNRRWIAVKKFTK+AWPD KQFADEA GVG 
Sbjct  54   KAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKSAWPDPKQFADEASGVGN  113

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRLANLIGYC DGDERLLVAE+MPNDTLAKHLFHW
Sbjct  114  LRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHW  151



>ref|XP_004238413.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Solanum lycopersicum]
Length=498

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 127/158 (80%), Gaps = 7/158 (4%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC QS+  K+   SEKD R G        N + S G G G A  +GG  VF+EFSLSEL
Sbjct  1    MGCCQSSILKELS-SEKDQRHG------VVNARASNGTGAGAAVGDGGVPVFSEFSLSEL  53

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSSEFIVSESGEKAPN+VYKGRLQNRRWIAVKKFTK+AWPD KQFADEA GVG 
Sbjct  54   KAATNNFSSEFIVSESGEKAPNMVYKGRLQNRRWIAVKKFTKSAWPDPKQFADEASGVGN  113

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRLANLIGYC DGDERLLVAE+MPNDTLAKHLFHW
Sbjct  114  LRHKRLANLIGYCSDGDERLLVAEYMPNDTLAKHLFHW  151



>emb|CAN74078.1| hypothetical protein VITISV_000979 [Vitis vinifera]
Length=508

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKD---HRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSL  227
            MGC QS+  K R  SEKD      G  HT  S+    +  G G G    GG   F+EFSL
Sbjct  1    MGCCQSSLFK-RTRSEKDRYPQTTGLNHTPPSNGTDAAAAGVGDGGGGAGGVPAFSEFSL  59

Query  228  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKG  407
            ++LKAATNNFSS+FIVSESGEKAPNVVYKGRLQNRRWIAVKKFTK AWPD KQFADEA G
Sbjct  60   ADLKAATNNFSSDFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKLAWPDPKQFADEAWG  119

Query  408  VGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            VGK RH+RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  120  VGKLRHRRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  160



>ref|XP_002285926.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Vitis vinifera]
 emb|CBI18875.3| unnamed protein product [Vitis vinifera]
Length=508

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 126/161 (78%), Gaps = 4/161 (2%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKD---HRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSL  227
            MGC QS+  K R  S+KD      G  HT  S+    +  G G G    GG   F+EFSL
Sbjct  1    MGCCQSSLFK-RTRSDKDRYPQTTGLNHTPPSNGTDAAAAGVGDGGEGAGGVPAFSEFSL  59

Query  228  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKG  407
            ++LKAATNNFSS+FIVSESGEKAPNVVYKGRLQNRRWIAVKKFTK AWPD KQFADEA G
Sbjct  60   ADLKAATNNFSSDFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKLAWPDPKQFADEAWG  119

Query  408  VGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            VGK RH+RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  120  VGKLRHRRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  160



>emb|CDP07307.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 122/164 (74%), Gaps = 17/164 (10%)
 Frame = +3

Query  57   MGCWQSTFSK-DRPISEKDHRQG-----QGHTLLSSNGKDsgggggggaaseggasVFAE  218
            MGC QS      RP  +  H  G     Q H   SSNG +  G  G           F+E
Sbjct  1    MGCCQSFLPMGSRPRDKDQHHYGGAVGGQPHHPRSSNGTEGAGAQG-----------FSE  49

Query  219  FSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADE  398
            FSL+ELKAATNNFSS+FIVSESGEKAPNVVY+GRLQNRRWIAVKKFTK AWPD KQFA+E
Sbjct  50   FSLAELKAATNNFSSDFIVSESGEKAPNVVYRGRLQNRRWIAVKKFTKMAWPDPKQFAEE  109

Query  399  AKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            AKGVGK RHKRLANLIGYC DGDERLLVAEFMPNDTLAKHLFHW
Sbjct  110  AKGVGKLRHKRLANLIGYCSDGDERLLVAEFMPNDTLAKHLFHW  153



>ref|XP_008236113.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Prunus mume]
Length=502

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 119/158 (75%), Gaps = 4/158 (3%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC +S  S+ +P    D  Q Q H   S           G     GGA  F+EFS S+L
Sbjct  1    MGCCESKVSEKQP----DKLQIQAHANNSRTPTHHQNPSPGSDPETGGAPPFSEFSFSDL  56

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSS+FIVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GVGK
Sbjct  57   KAATNNFSSDFIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGVGK  116

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RH+RLANLIGYCCDGDERLLVAE+MP DTLAKHLFHW
Sbjct  117  LRHRRLANLIGYCCDGDERLLVAEYMPTDTLAKHLFHW  154



>ref|XP_010094592.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB56346.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=501

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 125/165 (76%), Gaps = 19/165 (12%)
 Frame = +3

Query  57   MGCWQSTF---SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSL  227
            MGC  S+    + D       H+Q Q +   SSNG D+ GG  G          F+EFSL
Sbjct  1    MGCCASSLRGPNADTRNHPHQHQQAQNNN--SSNGTDAAGGSPG----------FSEFSL  48

Query  228  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN----RRWIAVKKFTKTAWPDXKQFAD  395
            ++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQN    RRWIAVKKFTK AWPD +QFAD
Sbjct  49   ADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQNQNNNRRWIAVKKFTKLAWPDPQQFAD  108

Query  396  EAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            EA+GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  109  EARGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  153



>ref|NP_567980.1| BR-signaling kinase 1 [Arabidopsis thaliana]
 sp|Q944A7.1|Y4523_ARATH RecName: Full=Probable serine/threonine-protein kinase At4g35230 
[Arabidopsis thaliana]
 gb|AAL27496.1|AF439824_1 AT4g35230/F23E12_210 [Arabidopsis thaliana]
 gb|AAM98327.1| At4g35230/F23E12_210 [Arabidopsis thaliana]
 gb|AEE86482.1| BR-signaling kinase 1 [Arabidopsis thaliana]
Length=512

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 124/165 (75%), Gaps = 8/165 (5%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQ-------GHTLLSSNGKDsgggggggaaseggasVFA  215
            MGC QS FS D P+  KD  Q Q       G    + NG   G  G GG    GG   F+
Sbjct  1    MGCCQSLFSGDNPLG-KDGVQPQPLSQNNHGGATTADNGGSGGASGVGGGGGGGGIPSFS  59

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFAD  395
            EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP+ KQFA+
Sbjct  60   EFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPEPKQFAE  119

Query  396  EAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  120  EAWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  164



>emb|CDX69121.1| BnaC01g03320D [Brassica napus]
Length=506

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC QS  S +     KD  Q    T     G  +   GG G  + GG   F+EFS S+L
Sbjct  1    MGCCQSLCSDEHQPLGKDGAQPPQATQNHRGGATTADNGGAGGVAGGGIPSFSEFSFSDL  60

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GVGK
Sbjct  61   KAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGVGK  120

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FRH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  121  FRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  158



>gb|EYU38018.1| hypothetical protein MIMGU_mgv1a004862mg [Erythranthe guttata]
Length=393

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 119/160 (74%), Gaps = 3/160 (2%)
 Frame = +3

Query  57   MGCWQSTF--SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLS  230
            MGC  S F  ++  P  EK    G G  LLS+       GG     +  G   F+EFS +
Sbjct  1    MGCCVSKFQPTETHPEKEKTKTHGPGQ-LLSTRPPPPAVGGAEPGLASSGVPSFSEFSFA  59

Query  231  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGV  410
            +LK ATNNFS +FIVSESGEKAPN+VYKGRLQNRRWIAVKKF K AWPD KQFA+EA GV
Sbjct  60   DLKTATNNFSPDFIVSESGEKAPNIVYKGRLQNRRWIAVKKFPKLAWPDPKQFAEEAWGV  119

Query  411  GKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            GK R++RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  120  GKLRNRRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  159



>emb|CAA18746.1| putative protein [Arabidopsis thaliana]
 emb|CAB80240.1| putative protein [Arabidopsis thaliana]
Length=524

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 124/165 (75%), Gaps = 8/165 (5%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQ-------GHTLLSSNGKDsgggggggaaseggasVFA  215
            MGC QS FS D P+  KD  Q Q       G    + NG   G  G GG    GG   F+
Sbjct  1    MGCCQSLFSGDNPLG-KDGVQPQPLSQNNHGGATTADNGGSGGASGVGGGGGGGGIPSFS  59

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFAD  395
            EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP+ KQFA+
Sbjct  60   EFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPEPKQFAE  119

Query  396  EAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  120  EAWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  164



>ref|XP_010061148.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Eucalyptus grandis]
 gb|KCW68068.1| hypothetical protein EUGRSUZ_F01752 [Eucalyptus grandis]
Length=524

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 131/176 (74%), Gaps = 18/176 (10%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHR---QGQGHTLLSSN--------GKD----sgggggggaas  191
            MGC +S+F KD    +KDHR   Q +G    S+N        G D     G G GG    
Sbjct  1    MGCCKSSFLKDAGSDDKDHRPHHQRRGGYPASANSLRQQPANGTDHSGGGGAGAGGAGGG  60

Query  192  eggasVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTK  362
             G A  F+EFSL++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQN   RRWIAVKKFTK
Sbjct  61   VGSAGFFSEFSLADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQNQNNRRWIAVKKFTK  120

Query  363  TAWPDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             AWPD KQFA+EA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  LAWPDPKQFAEEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  176



>ref|XP_008360691.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Malus domestica]
Length=503

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 120/158 (76%), Gaps = 3/158 (2%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC +S  S+ +P  EK   Q   H   S N         G     GGA  F+EFS ++L
Sbjct  1    MGCCESKVSEKQP-PEKIQTQQLAHN--SRNPTHHPNPTSGSDPETGGAPPFSEFSFADL  57

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GVGK
Sbjct  58   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGVGK  117

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RH+RLANLIGYCCDGDERLLVAE+MP DTLAKHLFHW
Sbjct  118  LRHRRLANLIGYCCDGDERLLVAEYMPTDTLAKHLFHW  155



>ref|XP_007199795.1| hypothetical protein PRUPE_ppa004587mg [Prunus persica]
 gb|EMJ00994.1| hypothetical protein PRUPE_ppa004587mg [Prunus persica]
Length=447

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 119/158 (75%), Gaps = 4/158 (3%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC +S  ++ +P    +  Q Q H   S           G     GGA  F+EFS S+L
Sbjct  1    MGCCESKVTEKQP----EKLQTQAHANNSRTPTHHPNPSPGSDPETGGAPPFSEFSFSDL  56

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GVGK
Sbjct  57   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGVGK  116

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RH+RLANLIGYCCDGDERLLVAE+MP DTLAKHLFHW
Sbjct  117  LRHRRLANLIGYCCDGDERLLVAEYMPTDTLAKHLFHW  154



>ref|XP_010242854.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nelumbo nucifera]
Length=500

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC +S+   +    +K+ +Q Q +     N        G   A+ GG   F+EFSLS+L
Sbjct  1    MGCCESSLLTEAD-PDKEKKQNQHNQNPPFNHPPPSADDGPAGAAAGGVPPFSEFSLSDL  59

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            +AATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVKKFTKTAWPD KQFADEA GVGK
Sbjct  60   RAATNNFSSDNIVSESGEKAPNLVYKGRLQNRQWIAVKKFTKTAWPDPKQFADEALGVGK  119

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RH+R+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  120  LRHQRIANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  157



>gb|KDO85050.1| hypothetical protein CISIN_1g009750mg [Citrus sinensis]
Length=365

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 119/180 (66%), Gaps = 38/180 (21%)
 Frame = +3

Query  57   MGCWQSTFSKDR------------------PISEKDHRQGQGHTLLSSNGKDsggggggg  182
            MGC +STF K                    P    +  +G G     S+G          
Sbjct  1    MGCCESTFLKGHLSVDTKNRHHHQQNHRNHPTQPSNGTEGSGGLAAGSDGAP--------  52

Query  183  aaseggasVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ----NRRWIAVK  350
                     FAEFSL++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQ    NRRWIAVK
Sbjct  53   --------AFAEFSLADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQDGNDNRRWIAVK  104

Query  351  KFTKTAWPDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KFTK AWPD KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  105  KFTKHAWPDPKQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  164



>ref|XP_009341554.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Pyrus x bretschneideri]
Length=503

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC  S  S+ +P  EK   Q   H   S N         G     GGA  F+EFS ++L
Sbjct  1    MGCCASKVSEKQP-PEKIQTQQLAHN--SRNPTHHPNPTSGSDPETGGAPPFSEFSFADL  57

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GVGK
Sbjct  58   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGVGK  117

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RH+RLANLIGYCCDGDERLLVAE+MP DTLAKHLFHW
Sbjct  118  LRHRRLANLIGYCCDGDERLLVAEYMPTDTLAKHLFHW  155



>ref|XP_007199796.1| hypothetical protein PRUPE_ppa004587mg [Prunus persica]
 gb|EMJ00995.1| hypothetical protein PRUPE_ppa004587mg [Prunus persica]
Length=502

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 119/158 (75%), Gaps = 4/158 (3%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC +S  ++ +P    +  Q Q H   S           G     GGA  F+EFS S+L
Sbjct  1    MGCCESKVTEKQP----EKLQTQAHANNSRTPTHHPNPSPGSDPETGGAPPFSEFSFSDL  56

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GVGK
Sbjct  57   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGVGK  116

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RH+RLANLIGYCCDGDERLLVAE+MP DTLAKHLFHW
Sbjct  117  LRHRRLANLIGYCCDGDERLLVAEYMPTDTLAKHLFHW  154



>ref|XP_010266119.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nelumbo nucifera]
Length=503

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSLS+L+AATNNFSS+FIVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQF
Sbjct  51   FSEFSLSDLRAATNNFSSDFIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQF  110

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH+RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  111  AEEAWGVGKLRHRRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  157



>ref|XP_007017989.1| BR-signaling kinase 1 [Theobroma cacao]
 gb|EOY15214.1| BR-signaling kinase 1 [Theobroma cacao]
Length=517

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 125/175 (71%), Gaps = 23/175 (13%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKD--------------HRQGQGHTLLSSNGKDsgggggggaase  194
            MGC +S+F K R    K               H Q        SNG DS GGG GG    
Sbjct  1    MGCCESSFLKGRGSRRKTNYNHHHNSSSNNNRHAQANNGPPQPSNGTDSVGGGAGGVPD-  59

Query  195  ggasVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKT  365
                 FAEFSL+ELKAATNNFSS+FIVSESGEKAPNVVYKGRLQN   RRWIA+KKFTK 
Sbjct  60   -----FAEFSLTELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDNNRRWIAIKKFTKL  114

Query  366  AWPDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            AWPD KQFA+EA GVGK RHKR+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  115  AWPDPKQFAEEAWGVGKLRHKRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  169



>gb|KJB29674.1| hypothetical protein B456_005G113100 [Gossypium raimondii]
Length=404

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDX  380
            F+EFSL+ELKAATNNFSS+FIVSE GEKAPNVVYKGRLQN   RRWIA+KKFT+ AWPD 
Sbjct  62   FSEFSLAELKAATNNFSSDFIVSECGEKAPNVVYKGRLQNDNNRRWIAIKKFTRLAWPDP  121

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KQFADEA+GVG  RHKR+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  122  KQFADEARGVGNLRHKRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  171



>emb|CDX75483.1| BnaA01g02190D [Brassica napus]
Length=510

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS S+LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQF
Sbjct  57   FSEFSFSDLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQF  116

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGKFRH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  117  AEEAWGVGKFRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  163



>gb|EYU38017.1| hypothetical protein MIMGU_mgv1a004862mg [Erythranthe guttata]
Length=507

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 119/160 (74%), Gaps = 3/160 (2%)
 Frame = +3

Query  57   MGCWQSTF--SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLS  230
            MGC  S F  ++  P  EK    G G  LLS+       GG     +  G   F+EFS +
Sbjct  1    MGCCVSKFQPTETHPEKEKTKTHGPGQ-LLSTRPPPPAVGGAEPGLASSGVPSFSEFSFA  59

Query  231  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGV  410
            +LK ATNNFS +FIVSESGEKAPN+VYKGRLQNRRWIAVKKF K AWPD KQFA+EA GV
Sbjct  60   DLKTATNNFSPDFIVSESGEKAPNIVYKGRLQNRRWIAVKKFPKLAWPDPKQFAEEAWGV  119

Query  411  GKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            GK R++RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  120  GKLRNRRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  159



>ref|XP_009350608.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Pyrus x bretschneideri]
Length=420

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 118/158 (75%), Gaps = 3/158 (2%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC +S  S+++   EK   Q   H   S           G     GG   F+EFS ++L
Sbjct  1    MGCCESKVSENQQ-PEKIQTQHLAHN--SQTPTHHTNPTSGSDPETGGTPPFSEFSFADL  57

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GVGK
Sbjct  58   KAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGVGK  117

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RH+RLANLIGYCCDGDERLLVAE+MP DTLAKHLFHW
Sbjct  118  LRHRRLANLIGYCCDGDERLLVAEYMPTDTLAKHLFHW  155



>ref|XP_009104299.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Brassica rapa]
Length=512

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 123/165 (75%), Gaps = 7/165 (4%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQG-------QGHTLLSSNGKDsgggggggaaseggasVFA  215
            MGC QS  S +     KD  Q        +G    + NG   GGG  GG    GG   F+
Sbjct  1    MGCCQSLCSDEHQPLGKDGAQPPQVTQNHRGGATTADNGGIGGGGVAGGGGGGGGIPSFS  60

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFAD  395
            EFS S+LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+
Sbjct  61   EFSFSDLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAE  120

Query  396  EAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            EA GVGKFRH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  121  EAWGVGKFRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  165



>ref|XP_011075006.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Sesamum indicum]
Length=478

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF LSELK+ATNNFSSE IVSESGEKAPNVVY+GRLQNRRWIAVKKFTK AWPD KQF
Sbjct  24   FTEFLLSELKSATNNFSSENIVSESGEKAPNVVYEGRLQNRRWIAVKKFTKMAWPDPKQF  83

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EAK VGK RHKRLANLIGYCCDGDERLLVAEFMPN+TLAKHLFHW
Sbjct  84   AEEAKEVGKLRHKRLANLIGYCCDGDERLLVAEFMPNETLAKHLFHW  130



>gb|KDP24732.1| hypothetical protein JCGZ_25333 [Jatropha curcas]
Length=500

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS S+LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQF
Sbjct  46   FSEFSFSDLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQF  105

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  106  AEEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  152



>gb|KJB29673.1| hypothetical protein B456_005G113100 [Gossypium raimondii]
Length=380

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDX  380
            F+EFSL+ELKAATNNFSS+FIVSE GEKAPNVVYKGRLQN   RRWIA+KKFT+ AWPD 
Sbjct  62   FSEFSLAELKAATNNFSSDFIVSECGEKAPNVVYKGRLQNDNNRRWIAIKKFTRLAWPDP  121

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KQFADEA+GVG  RHKR+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  122  KQFADEARGVGNLRHKRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  171



>ref|XP_006435324.1| hypothetical protein CICLE_v10000906mg [Citrus clementina]
 ref|XP_006473759.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Citrus sinensis]
 gb|ESR48564.1| hypothetical protein CICLE_v10000906mg [Citrus clementina]
 gb|KDO85048.1| hypothetical protein CISIN_1g009750mg [Citrus sinensis]
Length=512

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 120/180 (67%), Gaps = 38/180 (21%)
 Frame = +3

Query  57   MGCWQSTFSKDR------------------PISEKDHRQGQGHTLLSSNGKDsggggggg  182
            MGC +STF K                    P    +  +G G     S+G          
Sbjct  1    MGCCESTFLKGHLSVDTKNRHHHQQNHRNHPTQPSNGTEGSGGLAAGSDG----------  50

Query  183  aaseggasVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ----NRRWIAVK  350
                  A  FAEFSL++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQ    NRRWIAVK
Sbjct  51   ------APAFAEFSLADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQDGNDNRRWIAVK  104

Query  351  KFTKTAWPDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KFTK AWPD KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  105  KFTKHAWPDPKQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  164



>ref|XP_002525749.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF36648.1| receptor protein kinase, putative [Ricinus communis]
Length=500

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 119/159 (75%), Gaps = 7/159 (4%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC +S+  ++  P  EKD  + Q       N  ++            G   F+EFS S+
Sbjct  1    MGCCESSLVTETHP--EKDQTKKQTQI----NNHNNPSPSSVLLDPSTGIPSFSEFSFSD  54

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LKAAT+NFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GVG
Sbjct  55   LKAATDNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGVG  114

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  115  KLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  153



>ref|XP_004291229.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Fragaria vesca subsp. vesca]
Length=529

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 102/110 (93%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDX  380
            F+EFSL+EL+AATNNFSS+FIVSESGEKAPNVVYKGRLQN   RRWIAVKKF K AWPD 
Sbjct  74   FSEFSLAELRAATNNFSSDFIVSESGEKAPNVVYKGRLQNNNNRRWIAVKKFAKLAWPDP  133

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  134  KQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  183



>gb|KDO85049.1| hypothetical protein CISIN_1g009750mg [Citrus sinensis]
Length=527

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 120/180 (67%), Gaps = 38/180 (21%)
 Frame = +3

Query  57   MGCWQSTFSKDR------------------PISEKDHRQGQGHTLLSSNGKDsggggggg  182
            MGC +STF K                    P    +  +G G     S+G          
Sbjct  1    MGCCESTFLKGHLSVDTKNRHHHQQNHRNHPTQPSNGTEGSGGLAAGSDG----------  50

Query  183  aaseggasVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ----NRRWIAVK  350
                  A  FAEFSL++L+AATNNFSS+FIVSESGEKAPNVVYKGRLQ    NRRWIAVK
Sbjct  51   ------APAFAEFSLADLRAATNNFSSDFIVSESGEKAPNVVYKGRLQDGNDNRRWIAVK  104

Query  351  KFTKTAWPDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KFTK AWPD KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  105  KFTKHAWPDPKQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  164



>ref|XP_010646185.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Vitis vinifera]
 emb|CBI37790.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 120/159 (75%), Gaps = 8/159 (5%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC +S+F ++  P  +  H     H   +             + ++GG   F+EFS S+
Sbjct  1    MGCCESSFLTETHPEKDDQHHHNNSHNTQNP-------PFSPPSPADGGVPSFSEFSFSD  53

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GVG
Sbjct  54   LKAATNNFSSDSIVSESGEKAPNIVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGVG  113

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            + RH+RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  114  RLRHQRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  152



>ref|XP_011101028.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Sesamum indicum]
Length=494

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            FAEFSL+ELK+ATNNFSS+ IVSESGEKAPNVVY+GRLQN+RWIAVKKFTK AWPD KQF
Sbjct  41   FAEFSLAELKSATNNFSSDNIVSESGEKAPNVVYEGRLQNQRWIAVKKFTKMAWPDPKQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EAK VGK RHKRLANLIGYCCDGDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  AEEAKEVGKLRHKRLANLIGYCCDGDERLLVAEFMPNETLAKHLFHW  147



>ref|XP_010526870.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Tarenaya hassleriana]
Length=500

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LK ATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQF
Sbjct  50   FSEFSFADLKVATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQF  109

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  110  AEEAWGVGKLRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  156



>ref|XP_011046296.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Populus euphratica]
Length=433

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 119/160 (74%), Gaps = 11/160 (7%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQG-QGHTLLSSNGKDsgggggggaaseggasVFAEFSLS  230
            MGC  S+F S+  P  EKDH++  Q     + +G               G   F EFS S
Sbjct  1    MGCCSSSFLSETHP--EKDHKKTHQQQPPRNPSGS-------AVLDPATGVPSFCEFSFS  51

Query  231  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGV  410
            +L+ ATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GV
Sbjct  52   DLRTATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGV  111

Query  411  GKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            GK RHK+LANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  112  GKLRHKKLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  151



>ref|XP_009401888.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=448

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             FAEFSL+ELKAATN FS+E IVSESG+KAPN+VYKGRLQNRRWIAVKKFT+TAWPD KQ
Sbjct  56   AFAEFSLAELKAATNGFSAENIVSESGDKAPNLVYKGRLQNRRWIAVKKFTRTAWPDPKQ  115

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA GVGK RH+RLANLIGYCC+GDERLLVAE+MPNDTLAKHLFHW
Sbjct  116  FAEEAWGVGKLRHRRLANLIGYCCEGDERLLVAEYMPNDTLAKHLFHW  163



>ref|XP_010530944.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At4g35230 [Tarenaya hassleriana]
Length=503

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LKAATNNFSS+ IVSESGE+APN+VYKGRLQNRRWIAVKKFTK AWPD KQF
Sbjct  49   FSEFSFADLKAATNNFSSDNIVSESGERAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQF  108

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  109  AEEAWGVGKLRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  155



>ref|XP_002306223.1| kinase family protein [Populus trichocarpa]
 gb|EEE86734.1| kinase family protein [Populus trichocarpa]
Length=499

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 119/160 (74%), Gaps = 11/160 (7%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQG-QGHTLLSSNGKDsgggggggaaseggasVFAEFSLS  230
            MGC  S+F S+  P  EKDH++  Q     + +G               G   F EFS S
Sbjct  1    MGCCSSSFLSETHP--EKDHKKTHQQQPPRNPSGS-------AVLDPATGVPSFCEFSFS  51

Query  231  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGV  410
            +LK ATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GV
Sbjct  52   DLKTATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGV  111

Query  411  GKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            GK RHK+LANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  112  GKLRHKKLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  151



>ref|XP_008382473.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Malus domestica]
Length=503

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LKAATNNFSS++IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQF
Sbjct  49   FSEFSFADLKAATNNFSSDYIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQF  108

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH+RLANLIGYCCDGDERLLVAE+MP DTLAKHLFHW
Sbjct  109  AEEAWGVGKLRHRRLANLIGYCCDGDERLLVAEYMPTDTLAKHLFHW  155



>gb|KJB29672.1| hypothetical protein B456_005G113100 [Gossypium raimondii]
Length=519

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDX  380
            F+EFSL+ELKAATNNFSS+FIVSE GEKAPNVVYKGRLQN   RRWIA+KKFT+ AWPD 
Sbjct  62   FSEFSLAELKAATNNFSSDFIVSECGEKAPNVVYKGRLQNDNNRRWIAIKKFTRLAWPDP  121

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KQFADEA+GVG  RHKR+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  122  KQFADEARGVGNLRHKRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  171



>gb|KJB57985.1| hypothetical protein B456_009G188600 [Gossypium raimondii]
Length=407

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 102/110 (93%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDX  380
            F+EFSL+ELKAATNNFSS+FIVSESGEKAPNVVYKGRLQN   RRWIA+KKF K AWP+ 
Sbjct  60   FSEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWIAIKKFAKLAWPNP  119

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  120  KQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  169



>gb|KFK30163.1| hypothetical protein AALP_AA7G225300 [Arabis alpina]
Length=511

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 123/164 (75%), Gaps = 7/164 (4%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasV------FAE  218
            MGC QS  S   P+  KD  Q Q  T   S   D+GG GGG AA             F+E
Sbjct  1    MGCCQSLCSGKNPLV-KDPTQPQQLTHGGSTAVDNGGIGGGVAAGGVVVGTGGGIPSFSE  59

Query  219  FSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADE  398
            FSL++LK+AT NFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+E
Sbjct  60   FSLADLKSATTNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEE  119

Query  399  AKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  120  AWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  163



>gb|KHG00998.1| hypothetical protein F383_22564 [Gossypium arboreum]
Length=521

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDX  380
            F+EFSL+ELKAATNNFSS+FIVSE GEKAPNVVYKGRLQN   RRWIA+KKFT+ AWPD 
Sbjct  64   FSEFSLAELKAATNNFSSDFIVSECGEKAPNVVYKGRLQNDNNRRWIAIKKFTRLAWPDP  123

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KQFADEA+GVG  RHKR+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  124  KQFADEARGVGNLRHKRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  173



>ref|XP_010918220.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Elaeis guineensis]
Length=513

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F+EFSL+ELKAATN F SE IVSESGEKAPN+VYKGRLQ+RRWIAVKKFTK AWPD KQ
Sbjct  63   AFSEFSLAELKAATNGFGSENIVSESGEKAPNLVYKGRLQDRRWIAVKKFTKMAWPDPKQ  122

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FADEA GVGK RH+RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  123  FADEAGGVGKMRHRRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  170



>gb|KJB15932.1| hypothetical protein B456_002G205100 [Gossypium raimondii]
Length=503

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 122/163 (75%), Gaps = 13/163 (8%)
 Frame = +3

Query  57   MGCWQST-FSKDRPISEKDHRQGQGH----TLLSSNGKDsgggggggaaseggasVFAEF  221
            MGC QS+  ++  P +++  +Q Q H      +S  G D     G  +        F+EF
Sbjct  1    MGCCQSSCLTETHPENDQSRQQQQEHRNHSQAVSGAGPDPAVANGVPS--------FSEF  52

Query  222  SLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEA  401
            SL++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVKKFTK AWPD KQF +EA
Sbjct  53   SLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRKWIAVKKFTKMAWPDSKQFVEEA  112

Query  402  KGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             GVGK RH+RLANLIGYCCDGDERLLVAE+M NDTLAKHLFHW
Sbjct  113  CGVGKLRHRRLANLIGYCCDGDERLLVAEYMINDTLAKHLFHW  155



>ref|XP_008377092.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Malus domestica]
Length=510

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDX  380
            F+EFSL++LK+ATNNFSS+FIVSESGEKAPNVVYKGRLQN   RRWIAVKKF+K AWPD 
Sbjct  55   FSEFSLADLKSATNNFSSDFIVSESGEKAPNVVYKGRLQNQNNRRWIAVKKFSKLAWPDP  114

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  115  KQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  164



>gb|KDP36831.1| hypothetical protein JCGZ_08122 [Jatropha curcas]
Length=509

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 119/161 (74%), Gaps = 3/161 (2%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC QS+F + R   EK       H   + +      G     A+ GG   F EFSL++L
Sbjct  1    MGCCQSSFFEVRVPEEKASNNHNNHHHQNHHPCHPSNGTEPSTAASGGIPSFIEFSLADL  60

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDXKQFADEAKG  407
            KAATNNFS EFIVSESGEKAPNVVYKGRLQN   R WIAVKKFTK AWPD +QFADEA G
Sbjct  61   KAATNNFSPEFIVSESGEKAPNVVYKGRLQNQDNRTWIAVKKFTKLAWPDPQQFADEAWG  120

Query  408  VGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            VGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  VGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  161



>ref|XP_009401887.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=511

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             FAEFSL+ELKAATN FS+E IVSESG+KAPN+VYKGRLQNRRWIAVKKFT+TAWPD KQ
Sbjct  56   AFAEFSLAELKAATNGFSAENIVSESGDKAPNLVYKGRLQNRRWIAVKKFTRTAWPDPKQ  115

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA GVGK RH+RLANLIGYCC+GDERLLVAE+MPNDTLAKHLFHW
Sbjct  116  FAEEAWGVGKLRHRRLANLIGYCCEGDERLLVAEYMPNDTLAKHLFHW  163



>ref|XP_007041656.1| BR-signaling kinase 1 isoform 2 [Theobroma cacao]
 gb|EOX97487.1| BR-signaling kinase 1 isoform 2 [Theobroma cacao]
Length=452

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 123/159 (77%), Gaps = 6/159 (4%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC QS+F ++  P  EKD  Q Q       N   SG G G   A+  G   F+EFSL++
Sbjct  1    MGCCQSSFLTETHP--EKDQTQQQQE---PRNHNQSGSGAGLDPAAANGVPSFSEFSLAD  55

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVKKFTK AWPD KQFA+EA GVG
Sbjct  56   LKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRKWIAVKKFTKMAWPDPKQFAEEAWGVG  115

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RH RLANLIGYCCDGDERLLVAE+M NDTLAKHLFHW
Sbjct  116  KLRHGRLANLIGYCCDGDERLLVAEYMINDTLAKHLFHW  154



>gb|EYU17513.1| hypothetical protein MIMGU_mgv1a005152mg [Erythranthe guttata]
Length=495

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 117/167 (70%), Gaps = 29/167 (17%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKD---------HRQGQGHTLLSSNGKDsgggggggaaseggasV  209
            MGCW S   + R  SEKD         HR+       SS G                   
Sbjct  1    MGCWVSKEHRRRS-SEKDQWQQQQQHGHRRSSSVNGASSGG-------------------  40

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            FAEFSL+EL+AATNNFSSE IVSESGEKAPNVVY+GRLQN R IAVKKFTK AWPD KQF
Sbjct  41   FAEFSLAELRAATNNFSSENIVSESGEKAPNVVYEGRLQNHRGIAVKKFTKMAWPDPKQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EAK VGK RHKRLANLIGYCCDGDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  AEEAKEVGKLRHKRLANLIGYCCDGDERLLVAEFMPNETLAKHLFHW  147



>ref|XP_011046295.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Populus euphratica]
Length=499

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 119/160 (74%), Gaps = 11/160 (7%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQG-QGHTLLSSNGKDsgggggggaaseggasVFAEFSLS  230
            MGC  S+F S+  P  EKDH++  Q     + +G               G   F EFS S
Sbjct  1    MGCCSSSFLSETHP--EKDHKKTHQQQPPRNPSGS-------AVLDPATGVPSFCEFSFS  51

Query  231  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGV  410
            +L+ ATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQFA+EA GV
Sbjct  52   DLRTATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQFAEEAWGV  111

Query  411  GKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            GK RHK+LANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  112  GKLRHKKLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  151



>ref|XP_006412130.1| hypothetical protein EUTSA_v10024929mg [Eutrema salsugineum]
 gb|ESQ53583.1| hypothetical protein EUTSA_v10024929mg [Eutrema salsugineum]
Length=519

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQF
Sbjct  65   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQF  124

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  125  AEEAWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  171



>gb|KJB57984.1| hypothetical protein B456_009G188600 [Gossypium raimondii]
Length=517

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 102/110 (93%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDX  380
            F+EFSL+ELKAATNNFSS+FIVSESGEKAPNVVYKGRLQN   RRWIA+KKF K AWP+ 
Sbjct  60   FSEFSLAELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDTNRRWIAIKKFAKLAWPNP  119

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  120  KQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  169



>ref|XP_003519690.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoformX1 [Glycine max]
 gb|KHN29875.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=509

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 1/108 (1%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVKKFTKTAWPDXKQ  386
            F+EFSL+ELKAATNNFSSE+IVSESGEKAPN+VYKGRLQN+ RWIAVKKF+K+AWPD KQ
Sbjct  56   FSEFSLAELKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQSRWIAVKKFSKSAWPDPKQ  115

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA GVGK RH RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  116  FVEEASGVGKLRHPRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  163



>ref|XP_010690264.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Beta vulgaris subsp. vulgaris]
Length=504

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             FAEFS ++LK+ATNNF+SEFIVSESGEKAPN+VYKGRL+N++WIAVKKFTK AWPD KQ
Sbjct  50   AFAEFSFADLKSATNNFNSEFIVSESGEKAPNLVYKGRLKNQQWIAVKKFTKLAWPDPKQ  109

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA GVGK RH+RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  110  FAEEAWGVGKLRHQRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  157



>ref|XP_008448316.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Cucumis melo]
Length=517

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 113/159 (71%), Gaps = 1/159 (1%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC +STF ++  P   +  +    +  +          G          S F+EFS S+
Sbjct  1    MGCCESTFLTETHPEKLQSQQPAPPYVAVEPPPPLPPAVGPEPTQLGEMVSTFSEFSFSD  60

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LKAAT+NF+S FIVSESGEKAPN+VYKGRL NR+WIAVKKFTK AWPD KQF +EA GVG
Sbjct  61   LKAATDNFNSNFIVSESGEKAPNIVYKGRLHNRKWIAVKKFTKVAWPDAKQFVEEASGVG  120

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RH R ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  KLRHPRFANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  159



>ref|XP_008448319.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X4 [Cucumis melo]
Length=499

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 113/159 (71%), Gaps = 1/159 (1%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC +STF ++  P   +  +    +  +          G          S F+EFS S+
Sbjct  1    MGCCESTFLTETHPEKLQSQQPAPPYVAVEPPPPLPPAVGPEPTQLGEMVSTFSEFSFSD  60

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LKAAT+NF+S FIVSESGEKAPN+VYKGRL NR+WIAVKKFTK AWPD KQF +EA GVG
Sbjct  61   LKAATDNFNSNFIVSESGEKAPNIVYKGRLHNRKWIAVKKFTKVAWPDAKQFVEEASGVG  120

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RH R ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  KLRHPRFANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  159



>ref|XP_008448317.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X3 [Cucumis melo]
Length=502

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 113/159 (71%), Gaps = 1/159 (1%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC +STF ++  P   +  +    +  +          G          S F+EFS S+
Sbjct  1    MGCCESTFLTETHPEKLQSQQPAPPYVAVEPPPPLPPAVGPEPTQLGEMVSTFSEFSFSD  60

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LKAAT+NF+S FIVSESGEKAPN+VYKGRL NR+WIAVKKFTK AWPD KQF +EA GVG
Sbjct  61   LKAATDNFNSNFIVSESGEKAPNIVYKGRLHNRKWIAVKKFTKVAWPDAKQFVEEASGVG  120

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RH R ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  KLRHPRFANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  159



>ref|XP_006575761.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X2 [Glycine max]
Length=503

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 1/108 (1%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVKKFTKTAWPDXKQ  386
            F+EFSL+ELKAATNNFSSE+IVSESGEKAPN+VYKGRLQN+ RWIAVKKF+K+AWPD KQ
Sbjct  56   FSEFSLAELKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQSRWIAVKKFSKSAWPDPKQ  115

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA GVGK RH RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  116  FVEEASGVGKLRHPRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  163



>ref|XP_008448315.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Cucumis melo]
Length=520

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 113/159 (71%), Gaps = 1/159 (1%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC +STF ++  P   +  +    +  +          G          S F+EFS S+
Sbjct  1    MGCCESTFLTETHPEKLQSQQPAPPYVAVEPPPPLPPAVGPEPTQLGEMVSTFSEFSFSD  60

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LKAAT+NF+S FIVSESGEKAPN+VYKGRL NR+WIAVKKFTK AWPD KQF +EA GVG
Sbjct  61   LKAATDNFNSNFIVSESGEKAPNIVYKGRLHNRKWIAVKKFTKVAWPDAKQFVEEASGVG  120

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RH R ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  KLRHPRFANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  159



>gb|AET01057.2| LRR receptor-like kinase [Medicago truncatula]
Length=524

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN-RRWIAVKKFTKTAWPDXK  383
             F+EFSLS+LKAATNNFSSE+IVSESGEKAPN+VYKGRLQN +RWIAVKKF K AWPD K
Sbjct  68   TFSEFSLSDLKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQKRWIAVKKFGKAAWPDPK  127

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QF +EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  128  QFVEEASGVGKLRHPRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  176



>ref|XP_011088682.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Sesamum indicum]
Length=505

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 113/158 (72%), Gaps = 1/158 (1%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC  S F       EK+  Q  G   L S  +       G  A  G    FAEFSL++L
Sbjct  1    MGCCASKFPPTETHPEKEKSQNHGPASLLS-ARTPPPPPAGVPADPGVIPSFAEFSLADL  59

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            K ATN+F+ +FIVSESGEKAPNVVYKGRL NRRWIAVKKF K AWPD KQFA+EA  VGK
Sbjct  60   KTATNSFTPDFIVSESGEKAPNVVYKGRLHNRRWIAVKKFPKLAWPDPKQFAEEAWAVGK  119

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RH RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  120  LRHPRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  157



>ref|XP_004290043.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Fragaria vesca subsp. vesca]
Length=507

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS S+LK ATNNFSS++IVSESGEKAPNVVYKGRL NRRWIAVKKFTK AWPD KQF
Sbjct  53   FSEFSFSDLKTATNNFSSDYIVSESGEKAPNVVYKGRLNNRRWIAVKKFTKLAWPDPKQF  112

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH+RLANLIGYCCDGDERLLVAE+MP DTLAKHLFHW
Sbjct  113  AEEAWGVGKLRHRRLANLIGYCCDGDERLLVAEYMPTDTLAKHLFHW  159



>ref|XP_010692837.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Beta vulgaris subsp. vulgaris]
Length=489

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 116/158 (73%), Gaps = 17/158 (11%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC+QST     P    +H  G G +    +G                +++F EFSL EL
Sbjct  1    MGCFQSTLVP--PKQPLNHANGAGDSSDIGDG---------------TSALFLEFSLQEL  43

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            KAAT+NFSS+ IVSE GEKAPNVVY+GRLQNRR I+VKKF+K AWPD KQFA+EAKGVGK
Sbjct  44   KAATDNFSSKSIVSEGGEKAPNVVYRGRLQNRRLISVKKFSKLAWPDPKQFAEEAKGVGK  103

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHK+LANLIGYCCDGDERLLVAEFM NDTLAKHLFHW
Sbjct  104  LRHKKLANLIGYCCDGDERLLVAEFMSNDTLAKHLFHW  141



>ref|XP_010446962.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Camelina sativa]
Length=518

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP+ KQF
Sbjct  63   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPEPKQF  122

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  123  AEEAWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  169



>ref|XP_006284955.1| hypothetical protein CARUB_v10006257mg [Capsella rubella]
 gb|EOA17853.1| hypothetical protein CARUB_v10006257mg [Capsella rubella]
Length=518

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP+ KQF
Sbjct  64   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPEPKQF  123

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  124  AEEAWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  170



>ref|XP_007041655.1| BR-signaling kinase 1 isoform 1 [Theobroma cacao]
 gb|EOX97486.1| BR-signaling kinase 1 isoform 1 [Theobroma cacao]
Length=521

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 123/159 (77%), Gaps = 6/159 (4%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC QS+F ++  P  EKD  Q Q       N   SG G G   A+  G   F+EFSL++
Sbjct  1    MGCCQSSFLTETHP--EKDQTQQQQE---PRNHNQSGSGAGLDPAAANGVPSFSEFSLAD  55

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVKKFTK AWPD KQFA+EA GVG
Sbjct  56   LKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRKWIAVKKFTKMAWPDPKQFAEEAWGVG  115

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RH RLANLIGYCCDGDERLLVAE+M NDTLAKHLFHW
Sbjct  116  KLRHGRLANLIGYCCDGDERLLVAEYMINDTLAKHLFHW  154



>ref|XP_010103334.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB95401.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=514

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F EFSL++LKAATNNFS++FIVSESG KAPNVVYKGRL NR WIAVKKFTK AWPD KQ
Sbjct  60   TFCEFSLADLKAATNNFSADFIVSESGAKAPNVVYKGRLHNRSWIAVKKFTKLAWPDPKQ  119

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA+GVG+ RH+R+ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  120  FAEEARGVGEMRHRRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  167



>ref|XP_010432311.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Camelina sativa]
 ref|XP_010432312.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Camelina sativa]
Length=514

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP+ KQF
Sbjct  60   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPEPKQF  119

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  120  AEEAWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  166



>ref|XP_002510650.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF52837.1| receptor protein kinase, putative [Ricinus communis]
Length=513

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 120/173 (69%), Gaps = 23/173 (13%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEK---------DHRQGQGHTLLSSNGKDsgggggggaaseggasV  209
            MGC  S+  +   ISEK         +  Q Q H     NGK +     G ++       
Sbjct  1    MGCCHSSLFQVPFISEKKEPNHNYSKNQNQDQNHQ--PPNGKGAACPPAGTSSG------  52

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ------NRRWIAVKKFTKTAW  371
            F  FS ++LKAATNNFSSEFIVSESGEKAPNVVYKGRLQ      NR WIAVKKFTK AW
Sbjct  53   FTIFSFADLKAATNNFSSEFIVSESGEKAPNVVYKGRLQKQDNNNNRTWIAVKKFTKLAW  112

Query  372  PDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            PD KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  113  PDPKQFADEALGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  165



>ref|XP_010437502.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Camelina sativa]
Length=516

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP+ KQF
Sbjct  62   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPEPKQF  121

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  122  AEEAWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  168



>ref|XP_003618098.1| Receptor like protein kinase [Medicago truncatula]
Length=586

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN-RRWIAVKKFTKTAWPDXK  383
             F+EFSLS+LKAATNNFSSE+IVSESGEKAPN+VYKGRLQN +RWIAVKKF K AWPD K
Sbjct  68   TFSEFSLSDLKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQKRWIAVKKFGKAAWPDPK  127

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QF +EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  128  QFVEEASGVGKLRHPRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  176



>gb|KHG04837.1| hypothetical protein F383_29489 [Gossypium arboreum]
Length=503

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 122/163 (75%), Gaps = 13/163 (8%)
 Frame = +3

Query  57   MGCWQST-FSKDRPISEKDHRQGQ---GHT-LLSSNGKDsgggggggaaseggasVFAEF  221
            MGC QS+  ++  P  ++  +Q Q    H+  +S  G D     G  +        F+EF
Sbjct  1    MGCCQSSCLTETHPEKDQSRQQQQEPRNHSQAVSGAGPDPAVANGVPS--------FSEF  52

Query  222  SLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEA  401
            SL++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNR+WIAVKKFTK AWPD KQF +EA
Sbjct  53   SLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRKWIAVKKFTKMAWPDSKQFVEEA  112

Query  402  KGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             GVGK RH+RLANLIGYCCDGDERLLVAE+M NDTLAKHLFHW
Sbjct  113  CGVGKLRHRRLANLIGYCCDGDERLLVAEYMINDTLAKHLFHW  155



>emb|CDP14516.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL++LKAATNNFS +FIVSESGEKA N+VYKGRLQNRRWIAVKKFTK AWPD KQF
Sbjct  64   FSEFSLADLKAATNNFSPDFIVSESGEKAHNLVYKGRLQNRRWIAVKKFTKLAWPDPKQF  123

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH+RLANLIGYCCDGDERLLVAE+MPND+LAKHLFHW
Sbjct  124  AEEAWGVGKLRHRRLANLIGYCCDGDERLLVAEYMPNDSLAKHLFHW  170



>ref|XP_008791986.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Phoenix dactylifera]
Length=511

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL ELKAATN F S  IVSESGEKAPN+VYKGRLQNRRWIAVKKFTKTAWPD KQF
Sbjct  62   FSEFSLVELKAATNGFGSGNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKTAWPDPKQF  121

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH+RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  122  AEEAWGVGKLRHRRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  168



>ref|XP_008464872.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Cucumis melo]
Length=509

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 3/111 (3%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPD  377
             F+EFS ++LKAATNNFSS++IVSESGEKAPNVVYKGRLQN   RRWIAVKKFTK AWPD
Sbjct  51   AFSEFSFADLKAATNNFSSDYIVSESGEKAPNVVYKGRLQNQNNRRWIAVKKFTKLAWPD  110

Query  378  XKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             KQF +EA GVGK RHKRLANLIGYCC+GDERLL+AE+MPNDTLAKHLFHW
Sbjct  111  PKQFVEEASGVGKLRHKRLANLIGYCCEGDERLLIAEYMPNDTLAKHLFHW  161



>ref|XP_002867085.1| hypothetical protein ARALYDRAFT_328224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43344.1| hypothetical protein ARALYDRAFT_328224 [Arabidopsis lyrata subsp. 
lyrata]
Length=524

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP+ KQF
Sbjct  60   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKLAWPEPKQF  119

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  120  AEEAWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  166



>emb|CDY17529.1| BnaC03g65340D [Brassica napus]
Length=507

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP  KQF
Sbjct  51   FSEFSFADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPHPKQF  110

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  111  AEEAWGVGKLRHNRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  157



>gb|KDO68274.1| hypothetical protein CISIN_1g0105291mg, partial [Citrus sinensis]
Length=239

 Score =   192 bits (489),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = +3

Query  57   MGCWQSTFSKD--RPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLS  230
            MGC +S+F K+  R   E  + +       +S   D+         +   A +F+EFS  
Sbjct  1    MGCCESSFLKETQRERDEVMNERPLTQRKEASTESDTATPTATVQPTNEEAPLFSEFSFL  60

Query  231  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGV  410
            +L+AATNNFSS+ IVSESGEKA NVVYKGRL+NR+WIAVKKFTK AWPD  QF +EA+GV
Sbjct  61   DLRAATNNFSSDNIVSESGEKAANVVYKGRLENRQWIAVKKFTKVAWPDPTQFKEEAEGV  120

Query  411  GKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            GK R KRLANLIGYCC GDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  GKLRRKRLANLIGYCCAGDERLLVAEYMPNDTLAKHLFHW  160



>ref|XP_009108623.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Brassica rapa]
Length=487

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 115/168 (68%), Gaps = 21/168 (13%)
 Frame = +3

Query  57   MGCWQSTFSKDR----------PISEKDHRQGQGHTLLSSNGKDsgggggggaaseggas  206
            MGC QS    ++          P   + HR G        NG D G              
Sbjct  1    MGCCQSLCPDEQNPLRKDGAQPPQPAQTHRGGATTAAGLDNGGDGGVIPS----------  50

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F+EFSL++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP  KQ
Sbjct  51   -FSEFSLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPHPKQ  109

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA GVGK RH RLANLIGYCCD DERLLVAEFMPNDTLAKHLFHW
Sbjct  110  FAEEAWGVGKLRHNRLANLIGYCCDRDERLLVAEFMPNDTLAKHLFHW  157



>ref|XP_009108622.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Brassica rapa]
Length=505

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 115/168 (68%), Gaps = 21/168 (13%)
 Frame = +3

Query  57   MGCWQSTFSKDR----------PISEKDHRQGQGHTLLSSNGKDsgggggggaaseggas  206
            MGC QS    ++          P   + HR G        NG D G              
Sbjct  1    MGCCQSLCPDEQNPLRKDGAQPPQPAQTHRGGATTAAGLDNGGDGGVIPS----------  50

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F+EFSL++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP  KQ
Sbjct  51   -FSEFSLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPHPKQ  109

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA GVGK RH RLANLIGYCCD DERLLVAEFMPNDTLAKHLFHW
Sbjct  110  FAEEAWGVGKLRHNRLANLIGYCCDRDERLLVAEFMPNDTLAKHLFHW  157



>gb|AFK46540.1| unknown [Medicago truncatula]
Length=524

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN-RRWIAVKKFTKTAWPDXK  383
             F+EFS S+LKAATNNFSSE+IVSESGEKAPN+VYKGRLQN +RWIAVKKF K AWPD K
Sbjct  68   TFSEFSPSDLKAATNNFSSEYIVSESGEKAPNLVYKGRLQNQKRWIAVKKFGKAAWPDPK  127

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QF +EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  128  QFVEEASGVGKLRHPRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  176



>ref|XP_009413047.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Musa acuminata subsp. malaccensis]
Length=513

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             FAEFSL ELKAATN F++E IVSESG+KAPN+VYKGRLQ+RRWIAVKKF +TAWPD KQ
Sbjct  58   AFAEFSLEELKAATNGFAAESIVSESGDKAPNLVYKGRLQHRRWIAVKKFARTAWPDPKQ  117

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA+GVGK RH+RLANLIGYCCDGD RLLVAE+MPNDTLAKHLFHW
Sbjct  118  FAEEARGVGKLRHRRLANLIGYCCDGDNRLLVAEYMPNDTLAKHLFHW  165



>emb|CDX76321.1| BnaA08g10790D [Brassica napus]
Length=507

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 115/168 (68%), Gaps = 21/168 (13%)
 Frame = +3

Query  57   MGCWQSTFSKDR----------PISEKDHRQGQGHTLLSSNGKDsgggggggaaseggas  206
            MGC QS    ++          P   + HR G        NG D G              
Sbjct  1    MGCCQSLCPDEQNPLRKDGAQPPQPAQTHRGGATTAAGLDNGGDGGVIPS----------  50

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F+EFSL++LKAATNNFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWP  KQ
Sbjct  51   -FSEFSLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPHPKQ  109

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA GVGK RH RLANLIGYCCD DERLLVAEFMPNDTLAKHLFHW
Sbjct  110  FAEEAWGVGKLRHNRLANLIGYCCDRDERLLVAEFMPNDTLAKHLFHW  157



>ref|XP_006855115.1| hypothetical protein AMTR_s00031p00205960 [Amborella trichopoda]
 gb|ERN16582.1| hypothetical protein AMTR_s00031p00205960 [Amborella trichopoda]
Length=260

 Score =   193 bits (490),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             FAEFSLS+L+AA +NFS EFIVSE GEKAPN+VYKGRL ++RWIA+KKFT+ AWPD KQ
Sbjct  49   AFAEFSLSDLRAAASNFSPEFIVSEGGEKAPNLVYKGRLPDKRWIAIKKFTRMAWPDAKQ  108

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FADEA GVGK RH RLANLIGYCCDGDERLLVAE+MPN+TLA+HLFHW
Sbjct  109  FADEAWGVGKLRHPRLANLIGYCCDGDERLLVAEYMPNETLARHLFHW  156



>ref|XP_008221154.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Prunus mume]
Length=502

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 123/166 (74%), Gaps = 19/166 (11%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHT-----LLSSNGKDsgggggggaaseggasVFAEF  221
            MGC +S+F + R   +  HR+    T       +SNG +S G   G          F+EF
Sbjct  1    MGCCESSFIRGRQ-HQYLHRRNTTATDNNQAPQASNGTESAGAVLG----------FSEF  49

Query  222  SLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRR---WIAVKKFTKTAWPDXKQFA  392
            SL++LK ATNNFSS+FIVSESG+KAPNVVYKGRLQN+    WIA+KKFTK AWPD KQFA
Sbjct  50   SLADLKNATNNFSSDFIVSESGDKAPNVVYKGRLQNQNSPSWIAIKKFTKLAWPDPKQFA  109

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            DEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  110  DEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  155



>ref|XP_007222343.1| hypothetical protein PRUPE_ppa004797mg [Prunus persica]
 gb|EMJ23542.1| hypothetical protein PRUPE_ppa004797mg [Prunus persica]
Length=491

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 119/165 (72%), Gaps = 17/165 (10%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQG----HTLLSSNGKDsgggggggaaseggasVFAEFS  224
            MGC +S+F + R      HR            +SNG +S G   G          F+EFS
Sbjct  1    MGCCESSFIRGRQQQYLHHRNTTATDNNQAPQASNGTESAGAVLG----------FSEFS  50

Query  225  LSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRR---WIAVKKFTKTAWPDXKQFAD  395
            L++LK ATNNFS +FIVSESG+KAPNVVYKGRLQN+    WIA+KKFTK AWPD KQFAD
Sbjct  51   LADLKNATNNFSYDFIVSESGDKAPNVVYKGRLQNQNSPSWIAIKKFTKLAWPDPKQFAD  110

Query  396  EAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            EA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  111  EAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  155



>ref|XP_009400327.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Musa acuminata subsp. malaccensis]
Length=502

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 117/159 (74%), Gaps = 6/159 (4%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC  S+   ++ P+ ++ H+     +L     + S         S      FA+FSL+E
Sbjct  1    MGCCNSSLLPENHPVEKRSHQ-----SLQQQQRRPSLSLQAAVEGSGREVPAFAQFSLAE  55

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LKAATN F+ +  VSESG+KAPNVVYKGRLQ+RRWIAVKKF +TAWPD KQFA+EA GVG
Sbjct  56   LKAATNGFNPQNAVSESGDKAPNVVYKGRLQSRRWIAVKKFARTAWPDPKQFAEEASGVG  115

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RH+RLANLIGYCCDG+ERLLVAE+MPNDTLAKHLFHW
Sbjct  116  KLRHRRLANLIGYCCDGEERLLVAEYMPNDTLAKHLFHW  154



>gb|EPS73400.1| hypothetical protein M569_01345 [Genlisea aurea]
Length=484

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 117/160 (73%), Gaps = 24/160 (15%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLL--SSNGKDsgggggggaaseggasVFAEFSLS  230
            MGC  ST     P SEK  RQ     LL  S NG  + G              FAEFSL+
Sbjct  1    MGCCIST---KHPSSEKGQRQ-----LLQPSVNGGSAMG--------------FAEFSLA  38

Query  231  ELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGV  410
            +LK+ATNNFSSE IVS SGEKAPN+VY+GRL N RWIAVKKFTK AWPD KQFA+EAK V
Sbjct  39   DLKSATNNFSSENIVSGSGEKAPNLVYQGRLHNNRWIAVKKFTKMAWPDPKQFAEEAKQV  98

Query  411  GKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            GK RHKRLANLIGYCC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  99   GKLRHKRLANLIGYCCEGDERLLVAEFMPNETLAKHLFHW  138



>ref|XP_004491635.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X2 [Cicer arietinum]
Length=535

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 3/111 (3%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPD  377
             F+EFSL++LK+ATNNFSSE+IVSESGEKAPN+VYKG+LQN   +RWIAVKKF+K AWPD
Sbjct  77   TFSEFSLTDLKSATNNFSSEYIVSESGEKAPNLVYKGKLQNQNQKRWIAVKKFSKAAWPD  136

Query  378  XKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             KQF +EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  137  PKQFVEEASGVGKLRHPRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  187



>ref|XP_002312914.1| kinase family protein [Populus trichocarpa]
 gb|EEE86869.1| kinase family protein [Populus trichocarpa]
Length=498

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 115/159 (72%), Gaps = 10/159 (6%)
 Frame = +3

Query  57   MGCW-QSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC   S  ++  P  EKDH++      L+ +G               G   F EFS  +
Sbjct  1    MGCCCSSILAETHP--EKDHKKTHQQHPLNPSGS-------IVLDPATGIPSFCEFSFPD  51

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            LK ATNNFS + IVSESGEKAPN+VYKGRLQNRR IAVKKFTK AWPD KQFA+EA GVG
Sbjct  52   LKTATNNFSPDNIVSESGEKAPNLVYKGRLQNRRSIAVKKFTKMAWPDPKQFAEEAWGVG  111

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            KFRHK+LANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  112  KFRHKKLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  150



>gb|KHG04795.1| putative inactive receptor-like kinase SSP [Gossypium arboreum]
Length=502

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL++LKAATNNFSS+ IVSESGEKAPN+VYKGRL+NR+WIAVKKFTK AWPD KQF
Sbjct  48   FSEFSLADLKAATNNFSSDNIVSESGEKAPNLVYKGRLKNRKWIAVKKFTKMAWPDPKQF  107

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RHKRLANLIGYCCDGDERLLVAE+M NDTLAKHLFHW
Sbjct  108  AEEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMINDTLAKHLFHW  154



>ref|XP_004491634.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X1 [Cicer arietinum]
Length=562

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 3/111 (3%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPD  377
             F+EFSL++LK+ATNNFSSE+IVSESGEKAPN+VYKG+LQN   +RWIAVKKF+K AWPD
Sbjct  77   TFSEFSLTDLKSATNNFSSEYIVSESGEKAPNLVYKGKLQNQNQKRWIAVKKFSKAAWPD  136

Query  378  XKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             KQF +EA GVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  137  PKQFVEEASGVGKLRHPRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  187



>ref|XP_004158304.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
Length=235

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 99/111 (89%), Gaps = 3/111 (3%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPD  377
             F+EFS ++LKAATNNFSS++IVSESG+KAPNVV+KGRLQN   RRWIAVKKF K AWPD
Sbjct  44   AFSEFSFADLKAATNNFSSDYIVSESGDKAPNVVFKGRLQNQNNRRWIAVKKFAKFAWPD  103

Query  378  XKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             KQF +EA GVGK RHKRLANLIGYCC+G+ER L+AE+MPNDTLAKHLFHW
Sbjct  104  PKQFVEEASGVGKLRHKRLANLIGYCCEGEERFLIAEYMPNDTLAKHLFHW  154



>ref|XP_007142560.1| hypothetical protein PHAVU_008G291100g [Phaseolus vulgaris]
 gb|ESW14554.1| hypothetical protein PHAVU_008G291100g [Phaseolus vulgaris]
Length=538

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVKKFTKTAWPDXK  383
             FAEFSL ELKAATNNFSSE+IVS SGEKAPN+VYKGRL N+ RWIAVKKF+K AWPD K
Sbjct  65   TFAEFSLPELKAATNNFSSEYIVSGSGEKAPNLVYKGRLHNQSRWIAVKKFSKAAWPDPK  124

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QF +EA GVGK RH RLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  125  QFVEEASGVGKLRHPRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  173



>ref|XP_009334288.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Pyrus x bretschneideri]
Length=505

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 117/161 (73%), Gaps = 5/161 (3%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC +S+F   R    + H         ++N       G   AA  G    F+EFSL++L
Sbjct  1    MGCCESSFIHAR--QHQHHPLDTFSAFAAANRTPQPSNGRADAAGAGAVPGFSEFSLADL  58

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPDXKQFADEAKG  407
            K ATNNFSS FIVS+SGEKAPNVVYKGRLQN   RRWIAVKKF+K AW D KQFADEA G
Sbjct  59   KGATNNFSSNFIVSKSGEKAPNVVYKGRLQNQDNRRWIAVKKFSKLAWSDPKQFADEAWG  118

Query  408  VGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            VGK RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  119  VGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  159



>ref|XP_011034902.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Populus euphratica]
Length=523

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 99/113 (88%), Gaps = 6/113 (5%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN------RRWIAVKKFTKTAW  371
            F EFSL++LKAATNNFS EFIVSESGEKAPNVVYKGRLQN      R WIAVKKFTK AW
Sbjct  61   FTEFSLADLKAATNNFSPEFIVSESGEKAPNVVYKGRLQNHDNNNNRSWIAVKKFTKLAW  120

Query  372  PDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            PD KQFADEA GVGK RHKRLANLIGYCC GDERLLVAE++PNDTLAKHLFHW
Sbjct  121  PDPKQFADEAWGVGKLRHKRLANLIGYCCVGDERLLVAEYLPNDTLAKHLFHW  173



>ref|XP_010548144.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Tarenaya hassleriana]
Length=492

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS ++LK AT+NFSS+ IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQF
Sbjct  38   FSEFSFADLKTATSNFSSDNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQF  97

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA  VGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  98   AEEAWRVGKLRHSRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  144



>ref|XP_002300657.1| hypothetical protein POPTR_0002s01310g [Populus trichocarpa]
 gb|EEE79930.1| hypothetical protein POPTR_0002s01310g [Populus trichocarpa]
Length=520

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 99/113 (88%), Gaps = 6/113 (5%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN------RRWIAVKKFTKTAW  371
            F EFSL++LKAATNNFS EFIVSESGEKAPNVVYKGRLQN      R WIAVKKFTK AW
Sbjct  61   FTEFSLADLKAATNNFSPEFIVSESGEKAPNVVYKGRLQNHDNNNNRSWIAVKKFTKLAW  120

Query  372  PDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            PD KQFADEA GVGK RHKRLANLIG+CC GDERLLVAE++PNDTLAKHLFHW
Sbjct  121  PDPKQFADEALGVGKLRHKRLANLIGFCCVGDERLLVAEYLPNDTLAKHLFHW  173



>gb|KJB47748.1| hypothetical protein B456_008G040100 [Gossypium raimondii]
 gb|KJB47749.1| hypothetical protein B456_008G040100 [Gossypium raimondii]
Length=502

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL+ LKAATNNFSS+ IVSESGEKAPN+VYKGRL+NR+WIAVKKFTK AWPD KQF
Sbjct  48   FSEFSLAGLKAATNNFSSDNIVSESGEKAPNLVYKGRLKNRKWIAVKKFTKMAWPDPKQF  107

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVGK RHKRLANLIGYCCDGDERLLVAE+M NDTLAKHLFHW
Sbjct  108  AEEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMINDTLAKHLFHW  154



>ref|XP_003544865.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform 2 [Glycine max]
Length=479

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 100/108 (93%), Gaps = 1/108 (1%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVKKFTKTAWPDXKQ  386
            F+EFSL+ELKAATNNFSS++IVSESGEKAPN+VYKGRLQN  RWIAVKKF+K+AWPD KQ
Sbjct  42   FSEFSLAELKAATNNFSSDYIVSESGEKAPNLVYKGRLQNHSRWIAVKKFSKSAWPDPKQ  101

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA GVGK RH RLA LIG+CCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  102  FVEEASGVGKLRHPRLAILIGFCCDGDERLLVAEYMPNDTLAKHLFHW  149



>ref|XP_003544864.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform 1 [Glycine max]
 gb|KHN46875.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=497

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 100/108 (93%), Gaps = 1/108 (1%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVKKFTKTAWPDXKQ  386
            F+EFSL+ELKAATNNFSS++IVSESGEKAPN+VYKGRLQN  RWIAVKKF+K+AWPD KQ
Sbjct  42   FSEFSLAELKAATNNFSSDYIVSESGEKAPNLVYKGRLQNHSRWIAVKKFSKSAWPDPKQ  101

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA GVGK RH RLA LIG+CCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  102  FVEEASGVGKLRHPRLAILIGFCCDGDERLLVAEYMPNDTLAKHLFHW  149



>ref|XP_009384615.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Musa acuminata subsp. malaccensis]
Length=516

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             FAEFSL+ELKAATN F +  IVSESG+KAPN+VYKGRL+NRRWIAVKKF++TAWPD KQ
Sbjct  61   AFAEFSLAELKAATNGFDAGNIVSESGDKAPNLVYKGRLKNRRWIAVKKFSRTAWPDPKQ  120

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA GVGK RH+RLANLIGYCC+GDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  FAEEAWGVGKLRHRRLANLIGYCCEGDERLLVAEYMPNDTLAKHLFHW  168



>ref|XP_006486634.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X3 [Citrus sinensis]
Length=506

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 118/169 (70%), Gaps = 20/169 (12%)
 Frame = +3

Query  57   MGCWQSTFSKD-----------RPISEKDHRQGQGHTLLSSNGKDsgggggggaasegga  203
            MGC +S+F K+           RP++++           +S   D+         +   A
Sbjct  1    MGCCESSFLKETQRERDEVMNERPLTQRKE---------ASTESDTATPTATVQPTNEEA  51

Query  204  sVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXK  383
             +F+EFS  +L+AATNNFSS+ IVSESGEKA NVVYKGRL+NR+WIAVKKFTK AWPD  
Sbjct  52   PLFSEFSFLDLRAATNNFSSDNIVSESGEKAANVVYKGRLENRQWIAVKKFTKVAWPDPT  111

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QF +EA+GVGK R KRLANLIGYCC GDERLLVAE+MPNDTLAKHLFHW
Sbjct  112  QFKEEAEGVGKLRRKRLANLIGYCCAGDERLLVAEYMPNDTLAKHLFHW  160



>ref|XP_006828955.1| hypothetical protein AMTR_s00001p00232510 [Amborella trichopoda]
 gb|ERM96371.1| hypothetical protein AMTR_s00001p00232510 [Amborella trichopoda]
Length=492

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 115/158 (73%), Gaps = 14/158 (9%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC +ST  +  P       Q Q   L +++ K++   G            F+E SL +L
Sbjct  1    MGCCESTLKETHP------DQDQHQELATASDKEALEVGNVP--------AFSELSLEDL  46

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            +AAT NF+SE IVSESG+KAPNVVYKGRL N++WIAVKKF+K AWPD KQFA+EA GVGK
Sbjct  47   RAATQNFNSELIVSESGDKAPNVVYKGRLHNKQWIAVKKFSKMAWPDPKQFAEEAWGVGK  106

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RH+R+ANLIGYCCD DERLLVAE+MPNDTLAKHLFHW
Sbjct  107  LRHRRVANLIGYCCDSDERLLVAEYMPNDTLAKHLFHW  144



>ref|XP_006422467.1| hypothetical protein CICLE_v10028235mg [Citrus clementina]
 ref|XP_006486633.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X2 [Citrus sinensis]
 gb|ESR35707.1| hypothetical protein CICLE_v10028235mg [Citrus clementina]
Length=508

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 118/169 (70%), Gaps = 20/169 (12%)
 Frame = +3

Query  57   MGCWQSTFSKD-----------RPISEKDHRQGQGHTLLSSNGKDsgggggggaasegga  203
            MGC +S+F K+           RP++++           +S   D+         +   A
Sbjct  1    MGCCESSFLKETQRERDEVMNERPLTQRKE---------ASTESDTATPTATVQPTNEEA  51

Query  204  sVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXK  383
             +F+EFS  +L+AATNNFSS+ IVSESGEKA NVVYKGRL+NR+WIAVKKFTK AWPD  
Sbjct  52   PLFSEFSFLDLRAATNNFSSDNIVSESGEKAANVVYKGRLENRQWIAVKKFTKVAWPDPT  111

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QF +EA+GVGK R KRLANLIGYCC GDERLLVAE+MPNDTLAKHLFHW
Sbjct  112  QFKEEAEGVGKLRRKRLANLIGYCCAGDERLLVAEYMPNDTLAKHLFHW  160



>ref|XP_006486632.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X1 [Citrus sinensis]
Length=515

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 118/169 (70%), Gaps = 20/169 (12%)
 Frame = +3

Query  57   MGCWQSTFSKD-----------RPISEKDHRQGQGHTLLSSNGKDsgggggggaasegga  203
            MGC +S+F K+           RP++++           +S   D+         +   A
Sbjct  1    MGCCESSFLKETQRERDEVMNERPLTQRKE---------ASTESDTATPTATVQPTNEEA  51

Query  204  sVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXK  383
             +F+EFS  +L+AATNNFSS+ IVSESGEKA NVVYKGRL+NR+WIAVKKFTK AWPD  
Sbjct  52   PLFSEFSFLDLRAATNNFSSDNIVSESGEKAANVVYKGRLENRQWIAVKKFTKVAWPDPT  111

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QF +EA+GVGK R KRLANLIGYCC GDERLLVAE+MPNDTLAKHLFHW
Sbjct  112  QFKEEAEGVGKLRRKRLANLIGYCCAGDERLLVAEYMPNDTLAKHLFHW  160



>gb|AFN88212.1| putative serine/threonine-protein kinase [Phaseolus vulgaris]
Length=376

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-RWIAVKKFTKTAWPDXKQ  386
            FAEFSL ELKAATNNFSSE+IVSESGEKAPN+VYKGRL N+ RWIAVKKF+K AWPD KQ
Sbjct  64   FAEFSLPELKAATNNFSSEYIVSESGEKAPNLVYKGRLHNQSRWIAVKKFSKAAWPDPKQ  123

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHL  521
            F +EA GVGK RH RLANLIGYCCDGDERLLVAE+MPNDTLAKHL
Sbjct  124  FVEEASGVGKLRHPRLANLIGYCCDGDERLLVAEYMPNDTLAKHL  168



>ref|XP_009594040.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
Length=508

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL++LK ATNNFSSE IVSESGEKAPNVVYKGRLQN   IAVKKF++ AWPD K F
Sbjct  54   FSEFSLTDLKTATNNFSSELIVSESGEKAPNVVYKGRLQNCHCIAVKKFSRLAWPDPKLF  113

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A+EA GVG+ RHKRLANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  114  AEEAWGVGRLRHKRLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  160



>ref|XP_011045207.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Populus euphratica]
Length=500

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 113/161 (70%), Gaps = 13/161 (8%)
 Frame = +3

Query  57   MGCWQST-FSKDRPISEKDHRQG--QGHTLLSSNGKDsgggggggaaseggasVFAEFSL  227
            MGC  S+  ++  P  EKDH++   Q H L  S                 G   F EFS 
Sbjct  1    MGCCSSSILAETHP--EKDHKKTHQQQHPLNPSGS--------IVLDPATGIPSFCEFSF  50

Query  228  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKG  407
             +L+ ATNNFS   IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQ A+EA G
Sbjct  51   PDLRTATNNFSPGNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQLAEEAWG  110

Query  408  VGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             GK RHK+LANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  111  GGKLRHKKLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  151



>ref|XP_011045216.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Populus euphratica]
Length=478

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 113/161 (70%), Gaps = 13/161 (8%)
 Frame = +3

Query  57   MGCWQST-FSKDRPISEKDHRQG--QGHTLLSSNGKDsgggggggaaseggasVFAEFSL  227
            MGC  S+  ++  P  EKDH++   Q H L  S                 G   F EFS 
Sbjct  1    MGCCSSSILAETHP--EKDHKKTHQQQHPLNPSGS--------IVLDPATGIPSFCEFSF  50

Query  228  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKG  407
             +L+ ATNNFS   IVSESGEKAPN+VYKGRLQNRRWIAVKKFTK AWPD KQ A+EA G
Sbjct  51   PDLRTATNNFSPGNIVSESGEKAPNLVYKGRLQNRRWIAVKKFTKMAWPDPKQLAEEAWG  110

Query  408  VGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             GK RHK+LANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  111  GGKLRHKKLANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  151



>ref|XP_004144226.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
 gb|KGN47553.1| hypothetical protein Csa_6G358660 [Cucumis sativus]
Length=509

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 99/111 (89%), Gaps = 3/111 (3%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN---RRWIAVKKFTKTAWPD  377
             F+EFS ++LKAATNNFSS++IVSESG+KAPNVV+KGRLQN   RRWIAVKKF K AWPD
Sbjct  51   AFSEFSFADLKAATNNFSSDYIVSESGDKAPNVVFKGRLQNQNNRRWIAVKKFAKFAWPD  110

Query  378  XKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             KQF +EA GVGK RHKRLANLIGYCC+G+ER L+AE+MPNDTLAKHLFHW
Sbjct  111  PKQFVEEASGVGKLRHKRLANLIGYCCEGEERFLIAEYMPNDTLAKHLFHW  161



>ref|XP_004139949.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
 gb|KGN46722.1| hypothetical protein Csa_6G127340 [Cucumis sativus]
Length=514

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F+EFS S+LKAAT+NF+S FIVSES EKA N+VYKGRL NR+WIAVKKF+  AWPD KQ
Sbjct  52   TFSEFSFSDLKAATDNFNSNFIVSESSEKALNIVYKGRLHNRKWIAVKKFSNVAWPDAKQ  111

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA GVGK RH R ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  112  FVEEASGVGKLRHPRFANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  159



>ref|XP_004154543.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
Length=514

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F+EFS S+LKAAT+NF+S FIVSES EKA N+VYKGRL NR+WIAVKKF+  AWPD KQ
Sbjct  52   TFSEFSFSDLKAATDNFNSNFIVSESSEKAFNIVYKGRLHNRKWIAVKKFSNVAWPDAKQ  111

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA GVGK RH R ANLIGYCCDGDERLLVAE+MPNDTLAKHLFHW
Sbjct  112  FVEEASGVGKLRHPRFANLIGYCCDGDERLLVAEYMPNDTLAKHLFHW  159



>ref|XP_006651012.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Oryza brachyantha]
Length=501

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 97/108 (90%), Gaps = 1/108 (1%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN-RRWIAVKKFTKTAWPDXKQ  386
            FAEFSL+EL+AAT  F++E IVSESGEKAPN VY+GRLQ+ RR IAVKKF K AWPD KQ
Sbjct  43   FAEFSLAELRAATGGFAAENIVSESGEKAPNFVYRGRLQSSRRAIAVKKFPKMAWPDPKQ  102

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EAKGVGK RH+RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  103  FEEEAKGVGKLRHRRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  150



>ref|XP_011041263.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Populus euphratica]
Length=524

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 98/113 (87%), Gaps = 6/113 (5%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRR------WIAVKKFTKTAW  371
            F EFS ++L+AATNNFS EFIVSESGEKA NVVYKGRLQN+       WIAVKKFTK AW
Sbjct  66   FTEFSFADLQAATNNFSPEFIVSESGEKASNVVYKGRLQNQNNSNNISWIAVKKFTKLAW  125

Query  372  PDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            PD KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTL+KHLFHW
Sbjct  126  PDPKQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLSKHLFHW  178



>ref|XP_011041262.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Populus euphratica]
Length=532

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 98/113 (87%), Gaps = 6/113 (5%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRR------WIAVKKFTKTAW  371
            F EFS ++L+AATNNFS EFIVSESGEKA NVVYKGRLQN+       WIAVKKFTK AW
Sbjct  66   FTEFSFADLQAATNNFSPEFIVSESGEKASNVVYKGRLQNQNNSNNISWIAVKKFTKLAW  125

Query  372  PDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            PD KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTL+KHLFHW
Sbjct  126  PDPKQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLSKHLFHW  178



>ref|XP_002468567.1| hypothetical protein SORBIDRAFT_01g048160 [Sorghum bicolor]
 gb|EER95565.1| hypothetical protein SORBIDRAFT_01g048160 [Sorghum bicolor]
Length=516

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXK  383
            +  EFSL+EL+AAT  F++E IVSESGEKAPN VYKGRL+ +RR IAVKKFTK AWPD K
Sbjct  58   LLKEFSLAELRAATGGFAAENIVSESGEKAPNFVYKGRLEASRRAIAVKKFTKMAWPDPK  117

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QFA+EAKGVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  118  QFAEEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  166



>ref|XP_003574272.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Brachypodium distachyon]
Length=522

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 98/113 (87%), Gaps = 6/113 (5%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN------RRWIAVKKFTKTAW  371
            FAEFSL++L+AAT  F++E IVSESGEKAPN+VY+GRLQ       RR IAVKKF K AW
Sbjct  57   FAEFSLADLRAATGGFAAENIVSESGEKAPNLVYRGRLQGASGGAARRAIAVKKFAKLAW  116

Query  372  PDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            PD KQFA+EA+GVGK RH+RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  117  PDPKQFAEEARGVGKLRHRRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  169



>ref|NP_001048870.1| Os03g0132800 [Oryza sativa Japonica Group]
 gb|ABF93827.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10784.1| Os03g0132800 [Oryza sativa Japonica Group]
 gb|EAY88407.1| hypothetical protein OsI_09868 [Oryza sativa Indica Group]
 dbj|BAH00780.1| unnamed protein product [Oryza sativa Japonica Group]
Length=531

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXK  383
             FAEFSL+EL+AAT  F++E IVSESGEKAPN VY+GRLQ  RR IAVKKF K AWPD K
Sbjct  52   AFAEFSLAELRAATGGFAAENIVSESGEKAPNFVYRGRLQRTRRAIAVKKFPKMAWPDPK  111

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QF +EAKGVGK RH+RLANLIGYCCDGDERLLVAEFMPNDTLAKH+FHW
Sbjct  112  QFEEEAKGVGKLRHRRLANLIGYCCDGDERLLVAEFMPNDTLAKHVFHW  160



>ref|XP_009397594.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Musa acuminata subsp. malaccensis]
Length=534

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F++FS +ELKAAT+ FS + IVSESG+KAPNVVYKGRLQNRR I VKKF +TAWPD KQ
Sbjct  79   AFSQFSFAELKAATDGFSPQNIVSESGDKAPNVVYKGRLQNRRRIVVKKFARTAWPDPKQ  138

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FA+EA G GK RH+RLANLIGYCCDG+ERLLVAE+MPNDTLAKHLFHW
Sbjct  139  FAEEAWGAGKLRHRRLANLIGYCCDGEERLLVAEYMPNDTLAKHLFHW  186



>tpg|DAA43200.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=244

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXKQFA  392
            EFSL+EL+AAT  F++  IVSESGEKAPN VY+GRL   RR IAVKKFTK AWPD KQFA
Sbjct  57   EFSLAELRAATAGFAAGNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFA  116

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKGVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  117  EEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  162



>ref|XP_003558885.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Brachypodium distachyon]
Length=512

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQN-RRWIAVKKFTKTAWPDXK  383
             F E+SL+EL AAT  F+ E IVSESGEKAPN VYKGRL++ RR IAVKKFTK AWPD K
Sbjct  56   AFKEYSLAELSAATGGFARENIVSESGEKAPNFVYKGRLRSTRRAIAVKKFTKMAWPDSK  115

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QFA+EA+GVGK RH+RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  116  QFAEEARGVGKLRHRRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  164



>gb|EAZ25481.1| hypothetical protein OsJ_09304 [Oryza sativa Japonica Group]
Length=531

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXK  383
             FAEFSL+EL+AAT  F++E IVSESGEKAPN VY+GRLQ  RR IAVKKF K AWPD K
Sbjct  52   AFAEFSLAELRAATGGFAAENIVSESGEKAPNFVYRGRLQRTRRAIAVKKFPKMAWPDPK  111

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QF +EAKGVGK R++RLANLIGYCCDGDERLLVAEFMPNDTLAKH+FHW
Sbjct  112  QFEEEAKGVGKLRYRRLANLIGYCCDGDERLLVAEFMPNDTLAKHVFHW  160



>ref|XP_004985825.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X2 [Setaria italica]
Length=503

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXKQFA  392
            EFSL+EL+AAT  F +E IVSESGEKAPN VYKGRL+ +RR IAVKKFTK AWPD KQFA
Sbjct  60   EFSLAELRAATGGFVAENIVSESGEKAPNFVYKGRLEHSRRAIAVKKFTKAAWPDAKQFA  119

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKG GK RH R+ANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  120  EEAKGAGKLRHCRMANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  165



>ref|XP_004985824.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X1 [Setaria italica]
Length=517

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXKQFA  392
            EFSL+EL+AAT  F +E IVSESGEKAPN VYKGRL+ +RR IAVKKFTK AWPD KQFA
Sbjct  60   EFSLAELRAATGGFVAENIVSESGEKAPNFVYKGRLEHSRRAIAVKKFTKAAWPDAKQFA  119

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKG GK RH R+ANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  120  EEAKGAGKLRHCRMANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  165



>ref|XP_002307775.2| hypothetical protein POPTR_0005s27070g [Populus trichocarpa]
 gb|EEE94771.2| hypothetical protein POPTR_0005s27070g [Populus trichocarpa]
Length=524

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 98/113 (87%), Gaps = 6/113 (5%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRR------WIAVKKFTKTAW  371
            F EFS ++LKAATNNFS EFIVSESGEKA NVVYKGRLQN+       WIAVKKFTK AW
Sbjct  66   FTEFSFADLKAATNNFSPEFIVSESGEKASNVVYKGRLQNQNNSNNRSWIAVKKFTKLAW  125

Query  372  PDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            PD KQFADEA GVGK RHKRLANLIGYCCDGDERLLVAE+MPNDTL+KHLFHW
Sbjct  126  PDPKQFADEAWGVGKLRHKRLANLIGYCCDGDERLLVAEYMPNDTLSKHLFHW  178



>gb|KGN55487.1| hypothetical protein Csa_4G653480 [Cucumis sativus]
Length=427

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 97/110 (88%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVKKFTKTAWPDX  380
            F EFS ++LKAATNNFS + IVSES +K+PNVVYKGRLQ   N+R++AVKKFTK AWPD 
Sbjct  49   FLEFSFADLKAATNNFSIDHIVSESSDKSPNVVYKGRLQKENNQRFVAVKKFTKAAWPDH  108

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +QFADEA GVGK R+KRLANLIGYCC+GDERLLVAE+MPN TLAKHLFHW
Sbjct  109  QQFADEASGVGKLRNKRLANLIGYCCEGDERLLVAEYMPNCTLAKHLFHW  158



>gb|ACF87849.1| unknown [Zea mays]
Length=512

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXKQFA  392
            EFSL+EL+AAT  F++  IVSESGEKAPN VY+GRL+  RR IAVKKFTK AWPD KQFA
Sbjct  57   EFSLAELRAATAGFAAGNIVSESGEKAPNFVYRGRLEAGRRAIAVKKFTKMAWPDPKQFA  116

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKGVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  117  EEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  162



>gb|AFW89597.1| putative protein kinase superfamily protein [Zea mays]
Length=431

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXKQFA  392
            EFSL+EL+AAT  F+ + IVSESG+KAPN VY+GRL+ +RR IAVKKF K AWPD KQFA
Sbjct  55   EFSLAELRAATAGFAPDNIVSESGDKAPNFVYRGRLEPSRRAIAVKKFAKMAWPDPKQFA  114

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKGVGK RH+RLANLIGYCCDG+ERLLVAEFMPNDTLAKHLFHW
Sbjct  115  EEAKGVGKLRHRRLANLIGYCCDGEERLLVAEFMPNDTLAKHLFHW  160



>ref|XP_009781086.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X3 [Nicotiana sylvestris]
Length=495

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC QS F + +    +K+  Q    T L++NG             +     F EFSL+E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLAANGD---------QVDQDQVPAFKEFSLAE  51

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            L+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K+F++ +WPD +QF  EA GVG
Sbjct  52   LRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIKRFSRQSWPDAQQFVAEAAGVG  111

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  112  KVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  150



>ref|XP_004145595.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Cucumis sativus]
Length=506

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 97/110 (88%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVKKFTKTAWPDX  380
            F EFS ++LKAATNNFS + IVSES +K+PNVVYKGRLQ   N+R++AVKKFTK AWPD 
Sbjct  49   FLEFSFADLKAATNNFSIDHIVSESSDKSPNVVYKGRLQKENNQRFVAVKKFTKAAWPDH  108

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +QFADEA GVGK R+KRLANLIGYCC+GDERLLVAE+MPN TLAKHLFHW
Sbjct  109  QQFADEASGVGKLRNKRLANLIGYCCEGDERLLVAEYMPNCTLAKHLFHW  158



>ref|NP_001141394.1| uncharacterized LOC100273485 [Zea mays]
 gb|ACF86244.1| unknown [Zea mays]
 tpg|DAA43199.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=512

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXKQFA  392
            EFSL+EL+AAT  F++  IVSESGEKAPN VY+GRL   RR IAVKKFTK AWPD KQFA
Sbjct  57   EFSLAELRAATAGFAAGNIVSESGEKAPNFVYRGRLDAGRRAIAVKKFTKMAWPDPKQFA  116

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKGVGK RH RLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  117  EEAKGVGKLRHCRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  162



>ref|NP_001151339.1| ATP binding protein [Zea mays]
 gb|ACG42426.1| ATP binding protein [Zea mays]
Length=510

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXKQFA  392
            EFSL+EL+AAT  F+ + IVSESG+KAPN VY+GRL+ +RR IAVKKF K AWPD KQFA
Sbjct  55   EFSLAELRAATAGFAPDNIVSESGDKAPNFVYRGRLEPSRRAIAVKKFAKMAWPDPKQFA  114

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKGVGK RH+RLANLIGYCCDG+ERLLVAEFMPNDTLAKHLFHW
Sbjct  115  EEAKGVGKLRHRRLANLIGYCCDGEERLLVAEFMPNDTLAKHLFHW  160



>ref|XP_008658054.1| PREDICTED: uncharacterized protein LOC100192644 isoform X1 [Zea 
mays]
 gb|ACR36090.1| unknown [Zea mays]
 gb|AFW89596.1| putative protein kinase superfamily protein [Zea mays]
Length=510

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  EFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-NRRWIAVKKFTKTAWPDXKQFA  392
            EFSL+EL+AAT  F+ + IVSESG+KAPN VY+GRL+ +RR IAVKKF K AWPD KQFA
Sbjct  55   EFSLAELRAATAGFAPDNIVSESGDKAPNFVYRGRLEPSRRAIAVKKFAKMAWPDPKQFA  114

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKGVGK RH+RLANLIGYCCDG+ERLLVAEFMPNDTLAKHLFHW
Sbjct  115  EEAKGVGKLRHRRLANLIGYCCDGEERLLVAEFMPNDTLAKHLFHW  160



>ref|XP_004157122.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At4g35230-like [Cucumis sativus]
Length=506

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 115/169 (68%), Gaps = 22/169 (13%)
 Frame = +3

Query  57   MGCWQSTFSK-DRP----ISEKDH---RQGQGHTLLSSNGKDsgggggggaaseggasVF  212
            MGC QS+  K  +P    I   DH   R+   H     NG DS                F
Sbjct  1    MGCCQSSLLKLKKPSADVIGRGDHSLDRKNHHH----QNGVDSSPADEFVPP-------F  49

Query  213  AEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVKKFTKTAWPDXK  383
             EFS ++LKAATNNFS + IVSES +K+PNVVYKGRLQ   N+R++AV KFTK AWPD +
Sbjct  50   LEFSFADLKAATNNFSIDHIVSESSDKSPNVVYKGRLQKENNQRFVAVXKFTKAAWPDHQ  109

Query  384  QFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            QFADEA GVGK R+KRLANLIGYCC+GDERLLVAE+MPN TLAKHLFHW
Sbjct  110  QFADEASGVGKLRNKRLANLIGYCCEGDERLLVAEYMPNCTLAKHLFHW  158



>ref|XP_008452940.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Cucumis melo]
Length=506

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 96/110 (87%), Gaps = 3/110 (3%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ---NRRWIAVKKFTKTAWPDX  380
            F EFS ++LKAATNNFS++ IVSE  +K+PNVVYKGRLQ   N+R +AVKKFTK AWPD 
Sbjct  49   FVEFSFADLKAATNNFSTDHIVSEKSDKSPNVVYKGRLQKENNQRCVAVKKFTKAAWPDH  108

Query  381  KQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +QFADEA GVGK R+KR+ANLIGYCC+GDERLLVAE+MPN TLAKHLFHW
Sbjct  109  QQFADEASGVGKLRNKRIANLIGYCCEGDERLLVAEYMPNCTLAKHLFHW  158



>ref|XP_002467567.1| hypothetical protein SORBIDRAFT_01g030290 [Sorghum bicolor]
 gb|EER94565.1| hypothetical protein SORBIDRAFT_01g030290 [Sorghum bicolor]
Length=524

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 7/115 (6%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQ-------NRRWIAVKKFTKT  365
            VFAEFSL+EL+AAT  F+ + IVSESGEKAPN+VY+G+L+         R IAVKKF K 
Sbjct  59   VFAEFSLAELRAATAGFAPQNIVSESGEKAPNLVYRGQLKAPRGAPAPPRAIAVKKFAKL  118

Query  366  AWPDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            AWPD KQFA+EAKGVG  RH+R+ANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  119  AWPDPKQFAEEAKGVGGLRHRRMANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  173



>ref|XP_009781084.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Nicotiana sylvestris]
Length=500

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 110/164 (67%), Gaps = 15/164 (9%)
 Frame = +3

Query  57   MGCWQSTF------SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAE  218
            MGC QS F      S D+  S+ D +         +NG             +     F E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLAGKPGQANGD---------QVDQDQVPAFKE  51

Query  219  FSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADE  398
            FSL+EL+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K+F++ +WPD +QF  E
Sbjct  52   FSLAELRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIKRFSRQSWPDAQQFVAE  111

Query  399  AKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  112  AAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  155



>ref|XP_002975669.1| hypothetical protein SELMODRAFT_103506, partial [Selaginella 
moellendorffii]
 ref|XP_002978854.1| hypothetical protein SELMODRAFT_109237, partial [Selaginella 
moellendorffii]
 gb|EFJ20301.1| hypothetical protein SELMODRAFT_109237, partial [Selaginella 
moellendorffii]
 gb|EFJ23298.1| hypothetical protein SELMODRAFT_103506, partial [Selaginella 
moellendorffii]
Length=455

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFS  +L+ ATN FS+++IVSESG+KAPN VYKGRL   RWIAVKKF KTAWPD +QF
Sbjct  6    FREFSFEQLREATNGFSADYIVSESGDKAPNHVYKGRLDQNRWIAVKKFPKTAWPDARQF  65

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEA GVG+ RH+RL NLIG CC+GDERLLVAE+MPNDTL KHLFHW
Sbjct  66   MDEAFGVGQVRHERLVNLIGCCCEGDERLLVAEYMPNDTLTKHLFHW  112



>ref|XP_009781085.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Nicotiana sylvestris]
Length=499

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 111/164 (68%), Gaps = 16/164 (10%)
 Frame = +3

Query  57   MGCWQSTF------SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAE  218
            MGC QS F      S D+  S+ D +   G     +NG             +     F E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLGKPG-QANGD---------QVDQDQVPAFKE  50

Query  219  FSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADE  398
            FSL+EL+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K+F++ +WPD +QF  E
Sbjct  51   FSLAELRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIKRFSRQSWPDAQQFVAE  110

Query  399  AKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  111  AAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  154



>ref|XP_001772928.1| predicted protein [Physcomitrella patens]
 gb|EDQ62330.1| predicted protein, partial [Physcomitrella patens]
Length=460

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F EF+L  L+AATN+FSS+ IVSESGEKAPN VYKGRL  +R+IA+K+F K AWPD K 
Sbjct  5    AFREFTLESLRAATNSFSSDQIVSESGEKAPNFVYKGRLDQKRFIAIKRFPKAAWPDAKG  64

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            FADEA  VG+ RH+RL NLIGYCC+GDERLLVAE+MPNDTLAKHLFHW
Sbjct  65   FADEAWKVGQVRHERLVNLIGYCCEGDERLLVAEYMPNDTLAKHLFHW  112



>ref|XP_004983786.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Setaria italica]
Length=530

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 95/113 (84%), Gaps = 6/113 (5%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR------RWIAVKKFTKTAW  371
            FAEFSL++L+AAT  F++  IVSESGEKAPN+VY+G+L+        R IAVKKF K AW
Sbjct  67   FAEFSLADLRAATGGFAAANIVSESGEKAPNLVYRGQLKGPAGGAPPRAIAVKKFAKLAW  126

Query  372  PDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            PD KQFA+EAKGVG  RH+R+ANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW
Sbjct  127  PDPKQFAEEAKGVGSLRHRRMANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  179



>ref|XP_009781087.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X4 [Nicotiana sylvestris]
Length=494

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 111/159 (70%), Gaps = 11/159 (7%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC QS F + +    +K+  Q    T L++  +            +     F EFSL+E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLANGDQ----------VDQDQVPAFKEFSLAE  50

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            L+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K+F++ +WPD +QF  EA GVG
Sbjct  51   LRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIKRFSRQSWPDAQQFVAEAAGVG  110

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  111  KVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  149



>tpg|DAA46127.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=278

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 109/166 (66%), Gaps = 8/166 (5%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaasegga---sVFAEFSL  227
            MGCW+S+       +EK  R         +NG  S       A     +      AEFSL
Sbjct  1    MGCWRSSLRSGPHAAEKPPRHRHRPPPPPTNGPTSSLNAQQAAPPARASGEVPALAEFSL  60

Query  228  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-----RWIAVKKFTKTAWPDXKQFA  392
            +EL+AAT  F+   IVSESGEKAPN+VY+G+L+       R +AVKKF K AWPD KQFA
Sbjct  61   AELRAATAGFAPGNIVSESGEKAPNLVYRGQLRGPGGAPPRAVAVKKFAKLAWPDPKQFA  120

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKGVG  RH+ +ANLIGYCCDGD+RLLVAEFMPNDTLAKHLFHW
Sbjct  121  EEAKGVGGLRHRSMANLIGYCCDGDDRLLVAEFMPNDTLAKHLFHW  166



>ref|XP_008375673.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Malus domestica]
Length=237

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EF L+EL+ ATN F+SE IVSESGEKAPNVVY+G+L+N R++A+K+F+K +WPD  Q
Sbjct  37   VFKEFGLAELRTATNGFNSELIVSESGEKAPNVVYRGKLRNNRFVAIKRFSKLSWPDPHQ  96

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHK+L NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  97   FLAEAAGVGKVRHKKLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  144



>ref|XP_008384888.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Malus domestica]
Length=491

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F ++AWPD +Q
Sbjct  41   VFSEFSLDQLKAATSAFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRSAWPDSRQ  100

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA+ VG+ R++RLANLIG CC+GDERLLVAEFMPN+TL+KHLFHW
Sbjct  101  FLEEARAVGQLRNERLANLIGCCCEGDERLLVAEFMPNETLSKHLFHW  148



>gb|EYU40299.1| hypothetical protein MIMGU_mgv1a005192mg [Erythranthe guttata]
Length=412

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L+EL+ ATN FSSE IVSESGEKAPNVVYKG+L++ R +A+K+F+K +WPD +QF
Sbjct  41   FREFGLAELRGATNGFSSELIVSESGEKAPNVVYKGKLRSNRLVAIKRFSKQSWPDPQQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  101  AAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  147



>ref|XP_010066320.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Eucalyptus grandis]
Length=521

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+ FS+++LK AT  FS +FIVSE GEKAPN+V+KGRL++  WIAVKKFTK AWPD K F
Sbjct  61   FSGFSVADLKTATGGFSRDFIVSEGGEKAPNLVFKGRLKSGAWIAVKKFTKFAWPDPKPF  120

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VGK RH+RLANLIGYCC+GDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  VEEAQSVGKLRHRRLANLIGYCCEGDERLLVAEYMPNDTLAKHLFHW  167



>ref|XP_010066321.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Eucalyptus grandis]
 gb|KCW64182.1| hypothetical protein EUGRSUZ_G01832 [Eucalyptus grandis]
Length=516

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+ FS+++LK AT  FS +FIVSE GEKAPN+V+KGRL++  WIAVKKFTK AWPD K F
Sbjct  61   FSGFSVADLKTATGGFSRDFIVSEGGEKAPNLVFKGRLKSGAWIAVKKFTKFAWPDPKPF  120

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VGK RH+RLANLIGYCC+GDERLLVAE+MPNDTLAKHLFHW
Sbjct  121  VEEAQSVGKLRHRRLANLIGYCCEGDERLLVAEYMPNDTLAKHLFHW  167



>emb|CDP09344.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 109/158 (69%), Gaps = 11/158 (7%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC+QS  +  +   ++  +      L++ +  D                VF EF L+EL
Sbjct  1    MGCFQSKTANVQSPDQEPSQPDSKPDLVNGDQIDQDQVP-----------VFKEFGLAEL  49

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            +AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K+F++ +WPD +QF  EA GVGK
Sbjct  50   RAATNGFSSELIVSESGEKAPNVVYRGKLRNNRLVAIKRFSRQSWPDPQQFVAEAAGVGK  109

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHK+L NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  110  LRHKKLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  147



>ref|XP_009629803.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana tomentosiformis]
Length=494

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 11/159 (7%)
 Frame = +3

Query  57   MGCWQSTF-SKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC QS F + +    +K+  Q    T L++  +            +     F EFSL+E
Sbjct  1    MGCLQSKFKTANVQSPDKEPSQPDSKTDLANGDQ----------VDQDQVPAFKEFSLAE  50

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            L+AATN FSSE IVSESGEKAPNVVY+G+L++ R +A+K+F++ +WPD +QF  EA GVG
Sbjct  51   LRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRIVAIKRFSRQSWPDAQQFVAEAAGVG  110

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RHKRL NLIG C +GDERLL+AE+MPNDTL+KHLFHW
Sbjct  111  KVRHKRLVNLIGCCAEGDERLLIAEYMPNDTLSKHLFHW  149



>ref|XP_010275290.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nelumbo nucifera]
 ref|XP_010275291.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nelumbo nucifera]
Length=491

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 105/158 (66%), Gaps = 12/158 (8%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC QS  S    +   D    Q      +NG  +                F EF+L+EL
Sbjct  1    MGCLQSKTSN---VQSPDEESLQADKPDLANGDQAEQDQVP---------AFKEFALAEL  48

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            + ATN FSS +IVSESGEKAPNVVY+G+L+N R +AVK+F+K +WPD +QF  EA GVGK
Sbjct  49   RTATNGFSSNYIVSESGEKAPNVVYRGKLENNRLVAVKRFSKQSWPDAQQFVAEAAGVGK  108

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  109  VRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  146



>ref|XP_004246370.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Solanum lycopersicum]
Length=491

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EFSL ELK ATN FSSE IVSE GEKAPNVVYKG L+N RW+AVK+F ++AWPD +Q
Sbjct  40   VFTEFSLDELKMATNGFSSENIVSEHGEKAPNVVYKGLLENGRWVAVKRFNRSAWPDSRQ  99

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F DEA+ VG  R +RLANLIG CC+G+E+LLVAEFMPN+TLAKHLFHW
Sbjct  100  FLDEARAVGNLRSERLANLIGCCCEGEEKLLVAEFMPNETLAKHLFHW  147



>ref|XP_004229508.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Solanum lycopersicum]
Length=492

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 111/159 (70%), Gaps = 13/159 (8%)
 Frame = +3

Query  57   MGCWQS-TFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC QS T +   P  +K+  Q    T L++  +            +    VF EFSL+E
Sbjct  1    MGCLQSKTVNVQSP--DKEPSQDDSKTDLANGDQ----------VDQDQVPVFKEFSLAE  48

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            L+AATN FSSE IVSESGEKAPNVVY+G+L++ R  A+K+F++ +WPD +QF  EA GVG
Sbjct  49   LRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRLAAIKRFSRQSWPDAQQFVAEAAGVG  108

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  109  KVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  147



>ref|XP_004147901.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like 
[Cucumis sativus]
 gb|KGN54339.1| hypothetical protein Csa_4G305340 [Cucumis sativus]
Length=491

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS   LKAAT +FSSE IVSE GEKAPNVVYKG+L N RWIAVK+FTK AWPD +QF
Sbjct  41   FSEFSFERLKAATGSFSSENIVSEHGEKAPNVVYKGKLDNGRWIAVKRFTKLAWPDTRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEA+ VG  R +RLANLIG CC+G+ERLLVAEFMPN+TLAKHLFHW
Sbjct  101  LDEARSVGNLRSERLANLIGCCCEGEERLLVAEFMPNETLAKHLFHW  147



>ref|XP_010097731.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB70686.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=507

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EF L+EL+AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K+F+K +WPD  Q
Sbjct  42   VFKEFGLAELRAATNGFSSELIVSESGEKAPNVVYRGKLRNNRLVAIKRFSKQSWPDPNQ  101

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKRL NLIG C +GDERLLVAE+MPND+L+KHLFHW
Sbjct  102  FLTEASGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDSLSKHLFHW  149



>ref|XP_006847686.1| hypothetical protein AMTR_s00149p00051550 [Amborella trichopoda]
 gb|ERN09267.1| hypothetical protein AMTR_s00149p00051550 [Amborella trichopoda]
Length=500

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E+ L+EL+AATN FS E I+SESGEKAPNVVYKG+L N R IA+K+F+K +WPD +QF
Sbjct  40   FKEYGLAELRAATNGFSRELIISESGEKAPNVVYKGKLDNNRLIAIKRFSKESWPDARQF  99

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  100  AAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  146



>gb|ADE76295.1| unknown [Picea sitchensis]
Length=487

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E++L++LKAAT  FSSE+IVSE GEKAPNVV+KG+L+N RWIAVK+F K +WPD +QF
Sbjct  40   FKEYALADLKAATRGFSSEYIVSEGGEKAPNVVFKGKLENNRWIAVKRFPKQSWPDARQF  99

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A EA GVG+ RHKRL NLIG+C + DERLLVAEFMP DTL+KHLFHW
Sbjct  100  AAEAAGVGRVRHKRLVNLIGFCSEADERLLVAEFMPYDTLSKHLFHW  146



>gb|EYU40298.1| hypothetical protein MIMGU_mgv1a005192mg [Erythranthe guttata]
Length=493

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L+EL+ ATN FSSE IVSESGEKAPNVVYKG+L++ R +A+K+F+K +WPD +QF
Sbjct  41   FREFGLAELRGATNGFSSELIVSESGEKAPNVVYKGKLRSNRLVAIKRFSKQSWPDPQQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            A EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  101  AAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  147



>ref|XP_009337366.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Pyrus x bretschneideri]
Length=491

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F ++AWPD +Q
Sbjct  40   VFSEFSLEQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRSAWPDSRQ  99

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA+ VG+ R++RLANL G CC+GDERLLVAEFMPN+TL+KHLFHW
Sbjct  100  FLEEARAVGQLRNERLANLFGCCCEGDERLLVAEFMPNETLSKHLFHW  147



>ref|XP_009337367.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Pyrus x bretschneideri]
Length=490

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F ++AWPD +Q
Sbjct  40   VFSEFSLEQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRSAWPDSRQ  99

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA+ VG+ R++RLANL G CC+GDERLLVAEFMPN+TL+KHLFHW
Sbjct  100  FLEEARAVGQLRNERLANLFGCCCEGDERLLVAEFMPNETLSKHLFHW  147



>ref|XP_007219059.1| hypothetical protein PRUPE_ppa004847mg [Prunus persica]
 gb|EMJ20258.1| hypothetical protein PRUPE_ppa004847mg [Prunus persica]
Length=489

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL+EL+AATN F+SE IVSESGEKAPNVVY+G+L+N R +A+K+F+K +WPD  QF
Sbjct  38   FKEFSLAELRAATNGFNSELIVSESGEKAPNVVYRGKLRNNRLVAIKRFSKQSWPDPHQF  97

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  98   LAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  144



>ref|XP_010104360.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB99780.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=495

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 108/162 (67%), Gaps = 16/162 (10%)
 Frame = +3

Query  57   MGCWQS----TFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFS  224
            MGC  S      S D P S+ D  +        +NG D G               F E+ 
Sbjct  1    MGCLHSKTTHLHSPDDPSSQLDSLKPD-----PANGNDQGDEENRVP-------AFKEYG  48

Query  225  LSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAK  404
            L+EL+ ATN FS+E+IVSESGEKAPNVVY+G+L N R++AVK+F+K +WPD KQF  EA 
Sbjct  49   LNELRKATNGFSTEYIVSESGEKAPNVVYRGKLHNNRFVAVKRFSKQSWPDAKQFVAEAA  108

Query  405  GVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  109  GVGKVRHKRLVNLIGCCVEGDERLLVAEYMPNDTLSKHLFHW  150



>ref|XP_006363095.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like 
[Solanum tuberosum]
Length=491

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EFSL ELK ATN FSSE IVSE GEKAPNVVYKG L+N RW+AVK+F ++AWPD +Q
Sbjct  40   VFTEFSLDELKMATNGFSSENIVSEHGEKAPNVVYKGLLENGRWVAVKRFNRSAWPDSRQ  99

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F DEA+ VG  R  RLANLIG CC+G+E+LLVAEFMPN+TLAKHLFHW
Sbjct  100  FLDEARVVGNLRSDRLANLIGCCCEGEEKLLVAEFMPNETLAKHLFHW  147



>ref|XP_007210970.1| hypothetical protein PRUPE_ppa022548mg [Prunus persica]
 gb|EMJ12169.1| hypothetical protein PRUPE_ppa022548mg [Prunus persica]
Length=495

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 108/163 (66%), Gaps = 18/163 (11%)
 Frame = +3

Query  57   MGCWQST-----FSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEF  221
            MGC  S       S D P S  D      H   S+NG          A  E  A VF E+
Sbjct  1    MGCLHSKTTHLHLSPDDPSSLPD-----THKPDSANGD--------QAELEAQAPVFKEY  47

Query  222  SLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEA  401
            SL EL+ ATN FSSE IVSESGEKAPNVVY+G+L N R +AVK+F+K +WPD +QF  EA
Sbjct  48   SLDELRKATNGFSSECIVSESGEKAPNVVYRGKLDNNRLVAVKRFSKQSWPDAQQFVVEA  107

Query  402  KGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             GVGK RHKRL NL+G C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  108  VGVGKLRHKRLVNLVGCCAEGDERLLVAEYMPNDTLSKHLFHW  150



>ref|XP_008673168.1| PREDICTED: uncharacterized LOC100280241 isoform X1 [Zea mays]
 tpg|DAA46128.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=517

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 109/166 (66%), Gaps = 8/166 (5%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaasegga---sVFAEFSL  227
            MGCW+S+       +EK  R         +NG  S       A     +      AEFSL
Sbjct  1    MGCWRSSLRSGPHAAEKPPRHRHRPPPPPTNGPTSSLNAQQAAPPARASGEVPALAEFSL  60

Query  228  SELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNR-----RWIAVKKFTKTAWPDXKQFA  392
            +EL+AAT  F+   IVSESGEKAPN+VY+G+L+       R +AVKKF K AWPD KQFA
Sbjct  61   AELRAATAGFAPGNIVSESGEKAPNLVYRGQLRGPGGAPPRAVAVKKFAKLAWPDPKQFA  120

Query  393  DEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +EAKGVG  RH+ +ANLIGYCCDGD+RLLVAEFMPNDTLAKHLFHW
Sbjct  121  EEAKGVGGLRHRSMANLIGYCCDGDDRLLVAEFMPNDTLAKHLFHW  166



>ref|XP_006354609.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Solanum tuberosum]
Length=492

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 110/159 (69%), Gaps = 13/159 (8%)
 Frame = +3

Query  57   MGCWQS-TFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSE  233
            MGC QS T +   P  +K+  Q    T L++  +            +     F EFSL+E
Sbjct  1    MGCLQSKTVNVQSP--DKEPSQDDSKTDLANGDQ----------VDQDQVPAFKEFSLAE  48

Query  234  LKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVG  413
            L+AATN FSSE IVSESGEKAPNVVY+G+L++ R  A+K+F++ +WPD +QF  EA GVG
Sbjct  49   LRAATNGFSSELIVSESGEKAPNVVYRGKLRSNRLAAIKRFSRQSWPDAQQFVAEAAGVG  108

Query  414  KFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            K RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  109  KVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  147



>gb|KJB74454.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
 gb|KJB74455.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
 gb|KJB74456.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
 gb|KJB74458.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
Length=252

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 105/158 (66%), Gaps = 14/158 (9%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC+QS       +        Q ++ L  NG+                  F EFSL+EL
Sbjct  1    MGCFQSKIPHQ--LPPPPPPPPQTNSDLDGNGEQQAVP------------AFNEFSLAEL  46

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            +AA+N FS++ IVSESGEKAPNVVY+G+L+N R +A+K+F++ +WPD  QF +EA  VG 
Sbjct  47   RAASNGFSTDLIVSESGEKAPNVVYRGKLKNNRVVAIKRFSRQSWPDPHQFVNEAAMVGN  106

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  107  LRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  144



>ref|XP_001770164.1| predicted protein [Physcomitrella patens]
 gb|EDQ64998.1| predicted protein, partial [Physcomitrella patens]
Length=457

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E++L  L+ ATN+FSSE IVSESGEKAPN VY+G L   RWIA+K+F K AWPD K F
Sbjct  5    FREYALESLREATNSFSSEQIVSESGEKAPNFVYRGSLHQNRWIAIKRFPKAAWPDAKGF  64

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            ADEA  VG+ RHKRL NLIGYCC+GDERLLVAE+MPNDTL++HLFHW
Sbjct  65   ADEAWKVGQVRHKRLVNLIGYCCEGDERLLVAEYMPNDTLSRHLFHW  111



>ref|XP_004162757.1| PREDICTED: probable serine/threonine-protein kinase At5g41260-like 
[Cucumis sativus]
Length=491

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS   LKAAT +FSSE IVSE GEKAPNVVYKG+L N RWIAVK+F K AWPD +QF
Sbjct  41   FSEFSFERLKAATGSFSSENIVSEHGEKAPNVVYKGKLDNGRWIAVKRFAKLAWPDTRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEA+ VG  R +RLANLIG CC+G+ERLLVAEFMPN+TLAKHLFHW
Sbjct  101  LDEARSVGNLRSERLANLIGCCCEGEERLLVAEFMPNETLAKHLFHW  147



>gb|AFW87784.1| putative protein kinase superfamily protein [Zea mays]
Length=218

 Score =   166 bits (421),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EF+L+EL+AAT  FS++ IVSESGEKAPN VY+GRL   R IAVK+F++ +WPD +Q
Sbjct  53   VFREFALAELRAATKGFSADLIVSESGEKAPNAVYRGRLDGGRLIAVKRFSRLSWPDPQQ  112

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  113  FLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  160



>ref|XP_009781644.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nicotiana sylvestris]
Length=488

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 108/158 (68%), Gaps = 15/158 (9%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC+QS     +   E+  ++    T L++  +                  F EF+L++L
Sbjct  1    MGCFQSKTVNVKSTIEEPPKEDDSKTDLANGDQ---------------VPAFKEFALADL  45

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            +AATN FSSE IVSESGEKAPN+VY+G+L++ R +A+K+F+K +WPD  QF  EA GVGK
Sbjct  46   RAATNGFSSELIVSESGEKAPNIVYRGKLRSNRLVAIKRFSKQSWPDPHQFVAEAAGVGK  105

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  106  VRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  143



>ref|XP_010087901.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB30487.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=428

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +L+AAT+ FS E IVSE GEKAPNVVY+G+L++  W+AVK+F K+AWPD +QF
Sbjct  42   FREFSLEQLRAATSGFSPENIVSEHGEKAPNVVYRGKLEDDHWVAVKRFNKSAWPDARQF  101

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEAK VG+ R +RLANLIG CCDGDERLLVAEFMPN+TL+KHLFHW
Sbjct  102  LDEAKTVGQLRSERLANLIGSCCDGDERLLVAEFMPNETLSKHLFHW  148



>ref|XP_004294233.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Fragaria vesca subsp. vesca]
Length=490

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK+F ++AWPD +QF
Sbjct  41   FVEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVKRFNRSAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEA+ VG+ R++RLANLIG CC+GD+RLLVAEFMPN+TL+KHLFHW
Sbjct  101  LDEARAVGQLRNERLANLIGCCCEGDDRLLVAEFMPNETLSKHLFHW  147



>ref|XP_009769483.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nicotiana sylvestris]
Length=491

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL ELK ATN FS E IVSE GEKAPNVVYKG L+N RW+AVK+F ++AWPD +QF
Sbjct  41   FTEFSLDELKIATNGFSPENIVSEHGEKAPNVVYKGLLENGRWVAVKRFNRSAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEAK VG  R +RLANLIG CC+G+E+LLVAEFMPN+TLAKHLFHW
Sbjct  101  LDEAKAVGNLRSERLANLIGCCCEGEEKLLVAEFMPNETLAKHLFHW  147



>ref|XP_011460883.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Fragaria vesca subsp. vesca]
Length=491

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK+F ++AWPD +QF
Sbjct  41   FVEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVKRFNRSAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEA+ VG+ R++RLANLIG CC+GD+RLLVAEFMPN+TL+KHLFHW
Sbjct  101  LDEARAVGQLRNERLANLIGCCCEGDDRLLVAEFMPNETLSKHLFHW  147



>ref|XP_008448868.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Cucumis melo]
Length=491

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFS   LKAAT  FSSE IVSE GEKAPNVVYKG+L N RWIAVK+F K AWPD +QF
Sbjct  41   FSEFSFERLKAATGGFSSENIVSEHGEKAPNVVYKGKLDNGRWIAVKRFNKLAWPDTRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEA+ VG  R +RLANLIG CC+G+ERLLVAEFMPN+TLAKHLFHW
Sbjct  101  LDEARSVGNLRSERLANLIGCCCEGEERLLVAEFMPNETLAKHLFHW  147



>gb|KJB36863.1| hypothetical protein B456_006G179500 [Gossypium raimondii]
Length=491

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LK AT+ FSS+ IVSE GEKAPNVVYKG+L N RW+AVK+F K AWPD +QF
Sbjct  41   FGEFSLEQLKVATSGFSSDNIVSEHGEKAPNVVYKGKLDNDRWVAVKRFNKFAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EAK VG  R +RLANLIG CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  LEEAKAVGSLRSERLANLIGCCCEGDERLLVAEFMPNETLAKHLFHW  147



>gb|KDP28924.1| hypothetical protein JCGZ_14695 [Jatropha curcas]
Length=494

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL+EL+AAT+ FSS+FIVSESG+KAPNVVY+G+L N R +A+K+F++ +WPD  QF
Sbjct  43   FREFSLAELRAATSGFSSDFIVSESGDKAPNVVYRGKLNNNRLVAIKRFSRLSWPDPHQF  102

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  103  VTEASGVGKVRHKRLINLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  149



>ref|XP_002276280.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Vitis vinifera]
 emb|CBI30458.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LKAAT+ FSS+ IVSE GEKAPN+VYKG+L   RWIAVK+F K AWPD +QF
Sbjct  41   FTEFSLDQLKAATSGFSSDNIVSEHGEKAPNIVYKGKLDADRWIAVKRFNKLAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG  R++RLANLIG CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  VEEARSVGNLRNERLANLIGCCCEGDERLLVAEFMPNETLAKHLFHW  147



>ref|XP_011093461.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Sesamum indicum]
Length=492

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L+EL+AATN FSS+ IVSESGEKAPNVVY+G+L++ R +A+K+F+K +WPD +QF
Sbjct  41   FKEFGLAELRAATNGFSSDLIVSESGEKAPNVVYRGKLRSNRLVAIKRFSKQSWPDPQQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  101  VAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  147



>ref|XP_002527892.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF34523.1| receptor protein kinase, putative [Ricinus communis]
Length=491

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LKAAT+ FSSE IVSE GEKAPNVVYKGRL N  WIAVK+F + AWPD +QF
Sbjct  41   FTEFSLDQLKAATSGFSSENIVSEHGEKAPNVVYKGRLDNDHWIAVKRFNRLAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG  R +RLANLIG CC+GDERLLVAEFMP++TLAKHLFHW
Sbjct  101  LEEARSVGSLRSERLANLIGCCCEGDERLLVAEFMPHETLAKHLFHW  147



>ref|XP_008438236.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Cucumis melo]
 ref|XP_008438237.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Cucumis melo]
Length=491

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L EL+AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K+F+K +WPD +QF
Sbjct  41   FKEFELVELRAATNGFSSELIVSESGEKAPNVVYRGKLRNNRLVAIKRFSKQSWPDPQQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK R KRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  101  VTEASGVGKLRFKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  147



>ref|XP_010535431.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Tarenaya hassleriana]
 ref|XP_010535432.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Tarenaya hassleriana]
Length=487

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +L+AAT+ FS++ IVSE G KAPNVVY+GRLQ+ R IAVK+F ++AWPD +QF
Sbjct  37   FTEFSLDQLRAATSGFSTDCIVSEHGVKAPNVVYRGRLQDDRLIAVKRFNRSAWPDPRQF  96

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEAK VG+ R++RLANLIG CCDGDERLLVAEFMPN+TL+KHLFHW
Sbjct  97   LDEAKAVGQLRNERLANLIGCCCDGDERLLVAEFMPNETLSKHLFHW  143



>ref|XP_010650958.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Vitis vinifera]
 emb|CBI16029.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  138  LSSNGKDsgggggggaaseggasVFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKG  317
            L SN +DS     GG         F EFSL +L+AAT+ FSS+ IVSE GEKAPNVVYKG
Sbjct  16   LKSNSQDSFDLENGGKNEGDSLPSFGEFSLDQLRAATSGFSSDNIVSEHGEKAPNVVYKG  75

Query  318  RLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMP  497
            +L++ RWIAVK+F K+AWPD +QF +EA+ VG+ R++RLANLIG CC+G+ERLLVAEFMP
Sbjct  76   KLEDDRWIAVKRFNKSAWPDSRQFLEEARAVGQLRNERLANLIGCCCEGEERLLVAEFMP  135

Query  498  NDTLAKHLFHW  530
            N+TL+KHLFHW
Sbjct  136  NETLSKHLFHW  146



>gb|KJB74460.1| hypothetical protein B456_011G2959002, partial [Gossypium raimondii]
Length=266

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 105/158 (66%), Gaps = 14/158 (9%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC+QS       +        Q ++ L  NG+                  F EFSL+EL
Sbjct  1    MGCFQSKIPHQ--LPPPPPPPPQTNSDLDGNGEQQAVP------------AFNEFSLAEL  46

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            +AA+N FS++ IVSESGEKAPNVVY+G+L+N R +A+K+F++ +WPD  QF +EA  VG 
Sbjct  47   RAASNGFSTDLIVSESGEKAPNVVYRGKLKNNRVVAIKRFSRQSWPDPHQFVNEAAMVGN  106

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  107  LRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  144



>ref|XP_008232240.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Prunus mume]
Length=489

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL+EL+AATN F+SE IVSESGEKAPNVVY+G+L+N R +A+K+F+K +WPD  QF
Sbjct  38   FKEFSLAELRAATNGFNSELIVSESGEKAPNVVYRGKLRNNRLVAIKRFSKQSWPDPHQF  97

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA G GK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  98   LAEAAGFGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  144



>ref|XP_010262700.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nelumbo nucifera]
Length=489

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL  LK AT+ FS+  IVSE GEKAPNVVYKG L+N RWIAVK+F K+AWPD +QF
Sbjct  41   FSEFSLELLKVATSGFSANNIVSEHGEKAPNVVYKGMLENDRWIAVKRFNKSAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANLIG CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  LEEARAVGQLRNERLANLIGCCCEGDERLLVAEFMPNETLAKHLFHW  147



>ref|XP_010101852.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB89989.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=492

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL  LKAATN FSSE IVSE GEKAPNVVYKG+L+  RWIAVK+F K AWPD +QF
Sbjct  41   FSEFSLENLKAATNGFSSENIVSEHGEKAPNVVYKGKLEGSRWIAVKRFNKFAWPDPRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG  R +RLANLIG CC+GDERLLVAEFMP++TLAKHLFHW
Sbjct  101  LEEARLVGNLRSERLANLIGSCCEGDERLLVAEFMPHETLAKHLFHW  147



>gb|AES90840.2| LRR receptor-like kinase [Medicago truncatula]
Length=498

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF E+ L+EL+ AT+ FS+E+IVSESGEKAPNVVYKG+L+N R +AVK+F+K +WPD +Q
Sbjct  44   VFKEYGLNELRRATHEFSTEYIVSESGEKAPNVVYKGKLENNRLVAVKRFSKQSWPDAQQ  103

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKR+ NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  104  FLAEAAGVGKVRHKRMVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  151



>ref|XP_002526522.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF35913.1| receptor protein kinase, putative [Ricinus communis]
Length=511

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL+EL+AATN F++ FIVSESGEKAPNVVYKG+L N R +A+K+F++ +WPD  QF
Sbjct  60   FREFSLAELRAATNGFATHFIVSESGEKAPNVVYKGKLNNNRLVAIKRFSRLSWPDPHQF  119

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVA++MPNDTL+KHLFHW
Sbjct  120  LTEASGVGKLRHKRLVNLIGCCAEGDERLLVADYMPNDTLSKHLFHW  166



>ref|XP_007008711.1| BR-signaling kinase 2 isoform 1 [Theobroma cacao]
 gb|EOY17521.1| BR-signaling kinase 2 isoform 1 [Theobroma cacao]
Length=617

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L EL+AATN FSSE IVSESGEKAPNVVY+G+L+N R +A+K+F++ +WPD  QF
Sbjct  166  FKEFGLVELRAATNGFSSELIVSESGEKAPNVVYRGKLKNNRVVAIKRFSRQSWPDPHQF  225

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  226  VNEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  272



>ref|XP_008238295.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Prunus mume]
Length=495

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            +F E+SL EL+ ATN FSSE IVSESGEKAPNVVY+G+L N R +AVK+F+K +WPD +Q
Sbjct  43   MFKEYSLDELRKATNGFSSECIVSESGEKAPNVVYRGKLDNNRLVAVKRFSKQSWPDAQQ  102

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKRL NL+G C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  103  FVVEAVGVGKLRHKRLVNLVGCCAEGDERLLVAEYMPNDTLSKHLFHW  150



>ref|XP_009374330.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X3 [Pyrus x bretschneideri]
Length=490

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F + AWPD +QF
Sbjct  40   FSEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRLAWPDSRQF  99

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANLIG CC+GD RLLVAEFMPN+TL+KHLFHW
Sbjct  100  LEEARAVGQLRNERLANLIGCCCEGDNRLLVAEFMPNETLSKHLFHW  146



>ref|XP_009374328.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Pyrus x bretschneideri]
Length=491

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F + AWPD +QF
Sbjct  42   FSEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRLAWPDSRQF  101

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANLIG CC+GD RLLVAEFMPN+TL+KHLFHW
Sbjct  102  LEEARAVGQLRNERLANLIGCCCEGDNRLLVAEFMPNETLSKHLFHW  148



>ref|XP_009374327.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Pyrus x bretschneideri]
Length=492

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F + AWPD +QF
Sbjct  42   FSEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRLAWPDSRQF  101

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANLIG CC+GD RLLVAEFMPN+TL+KHLFHW
Sbjct  102  LEEARAVGQLRNERLANLIGCCCEGDNRLLVAEFMPNETLSKHLFHW  148



>ref|XP_009374331.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X4 [Pyrus x bretschneideri]
Length=489

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F + AWPD +QF
Sbjct  40   FSEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRLAWPDSRQF  99

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANLIG CC+GD RLLVAEFMPN+TL+KHLFHW
Sbjct  100  LEEARAVGQLRNERLANLIGCCCEGDNRLLVAEFMPNETLSKHLFHW  146



>emb|CDY12866.1| BnaA09g14080D [Brassica napus]
Length=174

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF+L +LK+AT+ F+ E+IVSE GEKAPNVVY+G+L+N++ IAVK+FT+ AWPD +QF
Sbjct  41   FREFTLDQLKSATSGFAVEYIVSEHGEKAPNVVYRGKLENQKKIAVKRFTRMAWPDARQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R +R+ANL+G CC+GDERLLVAEFMPN+TLAKHLFH 
Sbjct  101  LEEARSVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHC  147



>ref|XP_010269970.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Nelumbo nucifera]
Length=492

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 104/158 (66%), Gaps = 12/158 (8%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC QS  S    +   D    Q      +NG  +                F EF+L+EL
Sbjct  1    MGCLQSKTSN---VQSPDEESLQADKPDLANGDQAEQDQVP---------AFKEFNLTEL  48

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            + ATN F++  IVSESGEKAPNVVYKG+L+N R +AVK+F+K +WPD +QF  EA GVGK
Sbjct  49   RTATNGFNTNNIVSESGEKAPNVVYKGKLENNRLVAVKRFSKQSWPDAQQFVGEAAGVGK  108

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  109  VRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  146



>ref|XP_004983586.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Setaria italica]
Length=505

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EF+L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK+F++ +WPD +Q
Sbjct  53   VFREFALAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRVSWPDPQQ  112

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  113  FVAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  160



>ref|XP_001753441.1| predicted protein [Physcomitrella patens]
 gb|EDQ81664.1| predicted protein [Physcomitrella patens]
Length=477

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL  L+ ATN+FSS+ IVSESGEKAPN VYKGRL    WIA+K+F K AWPD K F
Sbjct  23   FREFSLESLRVATNSFSSDQIVSESGEKAPNFVYKGRLDQNHWIAIKRFPKAAWPDAKGF  82

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEA  VG+ RH+RL NLIGYCC+GDERLLVAE+MPNDTLAKHLFH+
Sbjct  83   MDEAWKVGQVRHQRLVNLIGYCCEGDERLLVAEYMPNDTLAKHLFHY  129



>ref|XP_008355642.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Malus domestica]
Length=491

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F ++AWPD +QF
Sbjct  42   FNEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRSAWPDSRQF  101

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANLIG CC+GD RLLVAEFMPN+TL+KHLFHW
Sbjct  102  LEEARAVGQLRNERLANLIGCCCEGDNRLLVAEFMPNETLSKHLFHW  148



>ref|XP_008355637.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Malus domestica]
Length=492

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F ++AWPD +QF
Sbjct  42   FNEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRSAWPDSRQF  101

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANLIG CC+GD RLLVAEFMPN+TL+KHLFHW
Sbjct  102  LEEARAVGQLRNERLANLIGCCCEGDNRLLVAEFMPNETLSKHLFHW  148



>ref|XP_008355649.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X3 [Malus domestica]
Length=490

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F ++AWPD +QF
Sbjct  40   FNEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRSAWPDSRQF  99

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANLIG CC+GD RLLVAEFMPN+TL+KHLFHW
Sbjct  100  LEEARAVGQLRNERLANLIGCCCEGDNRLLVAEFMPNETLSKHLFHW  146



>ref|XP_008355658.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X4 [Malus domestica]
Length=489

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LKAAT+ FSSE +VSE GEKAPNVVYKG+L++ RWIAVK+F ++AWPD +QF
Sbjct  40   FNEFSLDQLKAATSGFSSENVVSEHGEKAPNVVYKGKLEDGRWIAVKRFNRSAWPDSRQF  99

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANLIG CC+GD RLLVAEFMPN+TL+KHLFHW
Sbjct  100  LEEARAVGQLRNERLANLIGCCCEGDNRLLVAEFMPNETLSKHLFHW  146



>ref|XP_004300263.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Fragaria vesca subsp. vesca]
Length=496

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E+SL EL+ ATN FSS+FIVSESGEKAPNVVYKG+L+N R +AVK+F+K +WPD +QF
Sbjct  43   FKEYSLHELRKATNGFSSDFIVSESGEKAPNVVYKGKLENNRLVAVKRFSKQSWPDAQQF  102

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVA++M NDTL+KHLFHW
Sbjct  103  VAEAAGVGKLRHKRLVNLIGCCAEGDERLLVAQYMSNDTLSKHLFHW  149



>ref|XP_003608643.1| Protein kinase-like protein [Medicago truncatula]
Length=539

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF E+ L+EL+ AT+ FS+E+IVSESGEKAPNVVYKG+L+N R +AVK+F+K +WPD +Q
Sbjct  44   VFKEYGLNELRRATHEFSTEYIVSESGEKAPNVVYKGKLENNRLVAVKRFSKQSWPDAQQ  103

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKR+ NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  104  FLAEAAGVGKVRHKRMVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  151



>ref|XP_009613653.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nicotiana tomentosiformis]
Length=491

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL ELK AT+ FS E IVSE GEKAPNVVYKG L+N RW+AVK+F ++AWPD +QF
Sbjct  41   FTEFSLDELKIATSGFSPENIVSEHGEKAPNVVYKGLLENGRWVAVKRFNRSAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             DEAK VG  R +RLANLIG CC+G+E+LLVAEFMPN+TLAKHLFHW
Sbjct  101  LDEAKAVGNLRSERLANLIGCCCEGEEKLLVAEFMPNETLAKHLFHW  147



>ref|XP_007155758.1| hypothetical protein PHAVU_003G229100g [Phaseolus vulgaris]
 gb|ESW27752.1| hypothetical protein PHAVU_003G229100g [Phaseolus vulgaris]
Length=496

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E+ LSEL+ ATN F++++IVSESGEKAPNVVY+G+L+N R +AVK+F+K +WPD +QF
Sbjct  45   FKEYGLSELRRATNEFNTDYIVSESGEKAPNVVYRGKLENNRLVAVKRFSKLSWPDAQQF  104

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  105  MAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  151



>ref|XP_008219944.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X2 [Prunus mume]
Length=490

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EF+L +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK+F ++AWPD +QF
Sbjct  41   FSEFTLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVKRFNRSAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG  R++RLANLIG CC+GDERLLVAEFMPN+TL+KHLFHW
Sbjct  101  LEEARAVGLLRNERLANLIGCCCEGDERLLVAEFMPNETLSKHLFHW  147



>ref|XP_008219936.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
isoform X1 [Prunus mume]
Length=491

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EF+L +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK+F ++AWPD +QF
Sbjct  41   FSEFTLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVKRFNRSAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG  R++RLANLIG CC+GDERLLVAEFMPN+TL+KHLFHW
Sbjct  101  LEEARAVGLLRNERLANLIGCCCEGDERLLVAEFMPNETLSKHLFHW  147



>ref|XP_007207418.1| hypothetical protein PRUPE_ppa004824mg [Prunus persica]
 gb|EMJ08617.1| hypothetical protein PRUPE_ppa004824mg [Prunus persica]
Length=490

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+EF+L +LKAAT+ FSSE +VSE GEKAPNVVYKG L + RWIAVK+F ++AWPD +QF
Sbjct  41   FSEFTLDQLKAATSGFSSENVVSEHGEKAPNVVYKGTLDDGRWIAVKRFNRSAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG  R++RLANLIG CC+GDERLLVAEFMPN+TL+KHLFHW
Sbjct  101  LEEARAVGLLRNERLANLIGCCCEGDERLLVAEFMPNETLSKHLFHW  147



>ref|XP_007134779.1| hypothetical protein PHAVU_010G075300g [Phaseolus vulgaris]
 gb|ESW06773.1| hypothetical protein PHAVU_010G075300g [Phaseolus vulgaris]
Length=491

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL +LKAATN FSSE IVSE GEKAPNVVYKG+L N +WIA+K+F K AWPD +QF
Sbjct  41   FGEFSLEQLKAATNGFSSENIVSEHGEKAPNVVYKGKLDNGQWIAIKRFNKFAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EAK VG  R +RLANLIGYC +G+ERLLVAEFMP++TLAKHLFHW
Sbjct  101  LEEAKQVGSLRSERLANLIGYCYEGEERLLVAEFMPHETLAKHLFHW  147



>gb|EPS63745.1| hypothetical protein M569_11039 [Genlisea aurea]
Length=488

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFS+ +L+ AT+ FS E IVSE GEKAPNVVYKGRL+N+R IAVK+F ++AWPD +QF
Sbjct  41   FREFSIEQLRLATSGFSIENIVSEHGEKAPNVVYKGRLENQRRIAVKRFNRSAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R++RLANL+G CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  MEEARAVGQLRNRRLANLLGCCCEGDERLLVAEFMPNETLAKHLFHW  147



>ref|XP_010677274.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Beta vulgaris subsp. vulgaris]
Length=497

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E+SL+EL+ ATN FS+E IVSESGEKAPNVVY+GRL+  R+IAVK+F+K +WPD  QF
Sbjct  46   FKEYSLNELRKATNGFSTECIVSESGEKAPNVVYRGRLETNRFIAVKRFSKQSWPDAHQF  105

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA GVGK RH+RLANLIG C +GDERLLVAEFMP+DTL+KHLFH+
Sbjct  106  LEEAAGVGKLRHRRLANLIGCCAEGDERLLVAEFMPHDTLSKHLFHY  152



>ref|XP_011085053.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X1 [Sesamum indicum]
Length=493

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L+EL+AATN FSSE IVSE GEKAPNVVY+G+L++ R  A+K+F+K +WPD +QF
Sbjct  41   FKEFGLAELRAATNGFSSELIVSECGEKAPNVVYRGKLRSNRLAAIKRFSKQSWPDPQQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  101  VAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  147



>ref|XP_011085061.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
isoform X2 [Sesamum indicum]
Length=481

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L+EL+AATN FSSE IVSE GEKAPNVVY+G+L++ R  A+K+F+K +WPD +QF
Sbjct  29   FKEFGLAELRAATNGFSSELIVSECGEKAPNVVYRGKLRSNRLAAIKRFSKQSWPDPQQF  88

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  89   VAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  135



>ref|XP_006662088.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Oryza brachyantha]
Length=505

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EF+L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK+F++ +WPD +Q
Sbjct  53   VFREFALAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQ  112

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  113  FLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  160



>ref|XP_006287612.1| hypothetical protein CARUB_v10000824mg [Capsella rubella]
 gb|EOA20510.1| hypothetical protein CARUB_v10000824mg [Capsella rubella]
Length=490

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E++L +LKAAT+ F+ E+IVSE GEKAPNVVYKG+L+N++ IAVK+FT+ AWPD +QF
Sbjct  41   FREYTLEQLKAATSGFAVEYIVSEHGEKAPNVVYKGKLENQKKIAVKRFTRMAWPDARQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R +R+ANL+G CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  LEEARSVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHW  147



>ref|XP_003524482.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Glycine max]
 gb|KHN21023.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=496

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E+ L EL+ ATN FS+++IVSESGEKAPNVVY+G+L+N R +AVK+F+K +WPD +QF
Sbjct  45   FKEYGLIELRRATNEFSTDYIVSESGEKAPNVVYRGKLENNRLVAVKRFSKLSWPDAQQF  104

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  105  MAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  151



>ref|XP_010056495.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Eucalyptus grandis]
 gb|KCW73265.1| hypothetical protein EUGRSUZ_E01725 [Eucalyptus grandis]
Length=492

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L++L+AATN FSSE IVSE GEKAPNVVY+G+L+N   +A+K+F+K +WPD +QF
Sbjct  41   FKEFPLADLRAATNGFSSELIVSECGEKAPNVVYRGKLRNNCLVAIKRFSKQSWPDPQQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  101  VTEASGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  147



>ref|NP_191980.2| BR-signaling kinase 3 [Arabidopsis thaliana]
 gb|AAL32573.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13274.1| unknown protein [Arabidopsis thaliana]
 gb|AEE81924.1| BR-signaling kinase 3 [Arabidopsis thaliana]
Length=489

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E++L +LKAAT+ F+ E+IVSE GEKAPNVVYKG+L+N++ IAVK+FT+ AWPD +QF
Sbjct  40   FREYTLEQLKAATSGFAVEYIVSEHGEKAPNVVYKGKLENQKKIAVKRFTRMAWPDSRQF  99

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R +R+ANL+G CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  100  LEEARSVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHW  146



>ref|XP_002875018.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51277.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E++L +LKAAT+ F+ E+IVSE GEKAPNVVYKG+L+N++ IAVK+FT+ AWPD +QF
Sbjct  41   FREYTLEQLKAATSGFAVEYIVSEHGEKAPNVVYKGKLENQKKIAVKRFTRMAWPDARQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R +R+ANL+G CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  LEEARSVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHW  147



>gb|AAC13615.1| F6N23.9 gene product [Arabidopsis thaliana]
 emb|CAB80880.1| hypothetical protein [Arabidopsis thaliana]
Length=492

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E++L +LKAAT+ F+ E+IVSE GEKAPNVVYKG+L+N++ IAVK+FT+ AWPD +QF
Sbjct  51   FREYTLEQLKAATSGFAVEYIVSEHGEKAPNVVYKGKLENQKKIAVKRFTRMAWPDSRQF  110

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R +R+ANL+G CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  111  LEEARSVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHW  157



>gb|EEC67482.1| hypothetical protein OsI_34730 [Oryza sativa Indica Group]
Length=493

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EF L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK+F++ +WPD +Q
Sbjct  41   VFREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQ  100

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  101  FLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  148



>ref|XP_002280602.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Vitis vinifera]
 emb|CAN83954.1| hypothetical protein VITISV_008171 [Vitis vinifera]
 emb|CBI33898.3| unnamed protein product [Vitis vinifera]
Length=495

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E+ LSEL+ ATN FSS+ IVSESGEKAPNVVY+G+L + R +AVK+F+K +WPD +QF
Sbjct  44   FKEYGLSELRKATNGFSSDHIVSESGEKAPNVVYRGKLDSNRLVAVKRFSKLSWPDAQQF  103

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  104  VAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  150



>ref|NP_001065455.1| Os10g0571300 [Oryza sativa Japonica Group]
 gb|AAL86491.1|AC077693_30 putative protein kinase [Oryza sativa Japonica Group]
 gb|AAP55105.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27292.1| Os10g0571300 [Oryza sativa Japonica Group]
Length=512

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EF L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK+F++ +WPD +Q
Sbjct  60   VFREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQ  119

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  120  FLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  167



>ref|XP_003549974.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
[Glycine max]
 gb|KHN01674.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=498

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E+ L EL+ ATN FS+++IVSESGEKAPNVVY+G+L+N R +AVK+F+K +WPD +QF
Sbjct  45   FKEYGLIELRRATNEFSTDYIVSESGEKAPNVVYRGKLENNRLVAVKRFSKLSWPDAQQF  104

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVGK RHKR+ NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  105  MAEAAGVGKVRHKRMVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  151



>ref|XP_006464341.1| PREDICTED: probable serine/threonine-protein kinase At4g35230-like 
isoform X2 [Citrus sinensis]
Length=419

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L++L+AATN FSSE IVSESG+KAPNVVY+GRL+N R +A+K+F++ +WPD  QF
Sbjct  46   FKEFVLADLRAATNGFSSELIVSESGDKAPNVVYRGRLKNNRLVAIKRFSRQSWPDPHQF  105

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA G+G  RHKRL NLIG C +GDERLLVA++MPNDTL+KHLFHW
Sbjct  106  VTEAAGLGNVRHKRLVNLIGCCAEGDERLLVAQYMPNDTLSKHLFHW  152



>ref|XP_003574368.1| PREDICTED: probable serine/threonine-protein kinase At4g35230 
[Brachypodium distachyon]
Length=512

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF EF L+EL+AAT  FS++ IVSESGEKAPNVVY+GRL   R IAVK+F++ +WPD +Q
Sbjct  60   VFREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDPQQ  119

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F  EA GVGK RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  120  FLAEAGGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  167



>gb|KHG04747.1| hypothetical protein F383_01426 [Gossypium arboreum]
 gb|KHG09571.1| hypothetical protein F383_06576 [Gossypium arboreum]
Length=488

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 105/158 (66%), Gaps = 14/158 (9%)
 Frame = +3

Query  57   MGCWQSTFSKDRPISEKDHRQGQGHTLLSSNGKDsgggggggaaseggasVFAEFSLSEL  236
            MGC+QS       +        Q ++ L  NG+                  F EFSL+EL
Sbjct  1    MGCFQSKIPHQ--LPPPPPPPPQTNSDLDGNGEQQAVP------------AFNEFSLAEL  46

Query  237  KAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQFADEAKGVGK  416
            +AA+N FS++ IVSESGEKAPNVVY+G+L+N R +A+K+F++ +WPD  QF +EA  VG 
Sbjct  47   RAASNGFSTDLIVSESGEKAPNVVYRGKLKNNRVVAIKRFSRQSWPDPHQFVNEAAMVGN  106

Query  417  FRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             RHKRL NLIG C +GDERLLVAE+MPNDTL+KHLFHW
Sbjct  107  LRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHW  144



>gb|EPS71043.1| hypothetical protein M569_03708 [Genlisea aurea]
Length=496

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L+EL+AATN FSSE IVSESGEKAPNVVYKG+L+N + +A+K+F+K +WPD +QF
Sbjct  42   FKEFGLAELRAATNGFSSELIVSESGEKAPNVVYKGKLRNNQLVAIKRFSKQSWPDPQQF  101

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA GVG+ RHKRL NLIG C +GDERLLVAE+M NDTL+KHLFHW
Sbjct  102  MAEAAGVGRVRHKRLVNLIGCCSEGDERLLVAEYMHNDTLSKHLFHW  148



>ref|XP_006445512.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
 gb|ESR58752.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
Length=419

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L++L+AATN FSSE IVSESG+KAPNVVY+GRL+N R +A+K+F++ +WPD  QF
Sbjct  46   FKEFVLADLRAATNGFSSELIVSESGDKAPNVVYRGRLKNNRLVAIKRFSRQSWPDPHQF  105

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA G+G  RHKRL NLIG C +GDERLLVA++MPNDTL+KHLFHW
Sbjct  106  VTEAAGLGNVRHKRLVNLIGCCAEGDERLLVAQYMPNDTLSKHLFHW  152



>gb|KDP24521.1| hypothetical protein JCGZ_25085 [Jatropha curcas]
Length=491

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFSL  LKAAT+ F+S+ IVSE GEKAPNVVYKG+L N RWIAVK+F + AWPD +QF
Sbjct  41   FTEFSLDHLKAATSGFASDNIVSEHGEKAPNVVYKGKLDNDRWIAVKRFNRLAWPDSRQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG  R +RLANLIG CC+GDERLLVAEFMP++TLA+HLFHW
Sbjct  101  LEEARSVGSLRSERLANLIGCCCEGDERLLVAEFMPHETLARHLFHW  147



>ref|XP_006401013.1| hypothetical protein EUTSA_v10013377mg [Eutrema salsugineum]
 gb|ESQ42466.1| hypothetical protein EUTSA_v10013377mg [Eutrema salsugineum]
Length=489

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
             F EFS  +L+AAT+ FS++ IVSE G KAPNVVYKGRL++ RWIAVK+F ++AWPD +Q
Sbjct  36   TFTEFSFDQLRAATSGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVKRFNRSAWPDTRQ  95

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EAK VG+ R++RLANLIG+CC+GDERLLVAEFMP +TL+KHLFHW
Sbjct  96   FLEEAKAVGQLRNERLANLIGFCCEGDERLLVAEFMPYETLSKHLFHW  143



>gb|KDO76141.1| hypothetical protein CISIN_1g0113532mg [Citrus sinensis]
Length=264

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  VFAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQ  386
            VF E+S+  L+ AT+ F+ E IVSE GEKAPNVVYKG+L+N+  IAVK+F ++AWPD +Q
Sbjct  40   VFCEYSIETLRTATSGFAMENIVSEHGEKAPNVVYKGKLENQFRIAVKRFNRSAWPDARQ  99

Query  387  FADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            F +EA+ VG+ R++RLANL+G CC+GDERLLVAE+MPNDTLAKHLFHW
Sbjct  100  FLEEARAVGQLRNRRLANLLGCCCEGDERLLVAEYMPNDTLAKHLFHW  147



>ref|XP_006445511.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
 gb|ESR58751.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
Length=418

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L++L+AATN FSSE IVSESG+KAPNVVY+GRL+N R +A+K+F++ +WPD  QF
Sbjct  46   FKEFVLADLRAATNGFSSELIVSESGDKAPNVVYRGRLKNNRLVAIKRFSRQSWPDPHQF  105

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA G+G  RHKRL NLIG C +GDERLLVA++MPNDTL+KHLFHW
Sbjct  106  VTEAAGLGNVRHKRLVNLIGCCAEGDERLLVAQYMPNDTLSKHLFHW  152



>ref|XP_010427322.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Camelina sativa]
Length=490

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E++L +LK+AT+ F+ E+IVSE GEKAPNVVYKG+L+N++ IAVK+FT+ AWPD +QF
Sbjct  41   FREYTLEQLKSATSGFAVEYIVSEHGEKAPNVVYKGKLENQKKIAVKRFTRMAWPDARQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R +R+ANL+G CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  LEEARSVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHW  147



>ref|XP_006396266.1| hypothetical protein EUTSA_v10028608mg [Eutrema salsugineum]
 gb|ESQ37719.1| hypothetical protein EUTSA_v10028608mg [Eutrema salsugineum]
Length=490

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E++L +LK+AT+ F+ E+IVSE GEKAPNVVYKG+L+N++ IAVK+FT+ AWPD +QF
Sbjct  41   FREYTLEQLKSATSGFAVEYIVSEHGEKAPNVVYKGKLENQKKIAVKRFTRMAWPDARQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R +R+ANL+G CC+GDERLLVAEFMPN+TLAKHLFHW
Sbjct  101  LEEARSVGQLRSERMANLLGCCCEGDERLLVAEFMPNETLAKHLFHW  147



>ref|XP_010256740.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nelumbo nucifera]
 ref|XP_010256741.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 
[Nelumbo nucifera]
Length=491

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F+E+SL +L+AAT  FS + IVSE GEKAPNVVYKGRL+N RWIAVK+F K+AWPD +QF
Sbjct  41   FSEYSLEQLRAATAGFSVDNIVSEHGEKAPNVVYKGRLENDRWIAVKRFNKSAWPDARQF  100

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EA+ VG+ R+ RLANLIG C +GDERLLVAEFMPN+TL+KHLFHW
Sbjct  101  IEEARAVGQLRNDRLANLIGCCYEGDERLLVAEFMPNETLSKHLFHW  147



>ref|XP_006280371.1| hypothetical protein CARUB_v10026298mg [Capsella rubella]
 gb|EOA13269.1| hypothetical protein CARUB_v10026298mg [Capsella rubella]
Length=438

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EFS  +L+AAT+ FS++ IVSE G KAPNVVYKGRL++ RWIAVK+F ++AWPD +QF
Sbjct  37   FTEFSFDQLRAATSGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVKRFNRSAWPDTRQF  96

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
             +EAK VG+ R +RLANLIG+CC+GDERLLVAEFMP +TL+KHLFHW
Sbjct  97   LEEAKAVGQLRSERLANLIGFCCEGDERLLVAEFMPFETLSKHLFHW  143



>ref|XP_006445513.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
 gb|ESR58753.1| hypothetical protein CICLE_v10019840mg [Citrus clementina]
Length=497

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F EF L++L+AATN FSSE IVSESG+KAPNVVY+GRL+N R +A+K+F++ +WPD  QF
Sbjct  46   FKEFVLADLRAATNGFSSELIVSESGDKAPNVVYRGRLKNNRLVAIKRFSRQSWPDPHQF  105

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
              EA G+G  RHKRL NLIG C +GDERLLVA++MPNDTL+KHLFHW
Sbjct  106  VTEAAGLGNVRHKRLVNLIGCCAEGDERLLVAQYMPNDTLSKHLFHW  152



>ref|XP_001769037.1| predicted protein [Physcomitrella patens]
 gb|EDQ66115.1| predicted protein, partial [Physcomitrella patens]
Length=363

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +3

Query  210  FAEFSLSELKAATNNFSSEFIVSESGEKAPNVVYKGRLQNRRWIAVKKFTKTAWPDXKQF  389
            F E+SL  LKAAT  FS+E IVSESGEKAPN VY+G+L   R IA+K+F KTAWPD K F
Sbjct  4    FKEYSLETLKAATRGFSAELIVSESGEKAPNFVYRGKLDQNRIIAIKRFPKTAWPDAKGF  63

Query  390  ADEAKGVGKFRHKRLANLIGYCCDGDERLLVAEFMPNDTLAKHLFHW  530
            +DEA  VG+ RH+RL NLIGYC +GDERLLVAEFMP+DTLAKHLFHW
Sbjct  64   SDEAWKVGQVRHERLVNLIGYCAEGDERLLVAEFMPHDTLAKHLFHW  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200