BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003I20

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230885.1|  PREDICTED: triosephosphate isomerase, chloro...    267   1e-85   Solanum lycopersicum
ref|XP_006359648.1|  PREDICTED: triosephosphate isomerase, chloro...    263   3e-84   Solanum tuberosum [potatoes]
ref|XP_009590743.1|  PREDICTED: triosephosphate isomerase, chloro...    261   2e-83   Nicotiana tomentosiformis
ref|XP_009788094.1|  PREDICTED: triosephosphate isomerase, chloro...    261   4e-83   Nicotiana sylvestris
ref|XP_006367334.1|  PREDICTED: triosephosphate isomerase, chloro...    260   5e-83   Solanum tuberosum [potatoes]
ref|XP_009768928.1|  PREDICTED: triosephosphate isomerase, chloro...    260   5e-83   Nicotiana sylvestris
emb|CDO96949.1|  unnamed protein product                                256   6e-83   Coffea canephora [robusta coffee]
ref|XP_009610674.1|  PREDICTED: triosephosphate isomerase, chloro...    258   3e-82   Nicotiana tomentosiformis
ref|XP_010268160.1|  PREDICTED: triosephosphate isomerase, chloro...    255   4e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010268151.1|  PREDICTED: triosephosphate isomerase, chloro...    255   7e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010690445.1|  PREDICTED: triosephosphate isomerase, chloro...    250   3e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011088504.1|  PREDICTED: triosephosphate isomerase, chloro...    248   2e-78   Sesamum indicum [beniseed]
ref|XP_010268686.1|  PREDICTED: triosephosphate isomerase, chloro...    248   2e-78   Nelumbo nucifera [Indian lotus]
gb|KDP27586.1|  hypothetical protein JCGZ_19591                         248   2e-78   Jatropha curcas
ref|XP_004248665.1|  PREDICTED: triosephosphate isomerase, chloro...    245   3e-77   Solanum lycopersicum
gb|KJB15724.1|  hypothetical protein B456_002G192900                    242   3e-77   Gossypium raimondii
gb|EYU37874.1|  hypothetical protein MIMGU_mgv1a008655mg                246   8e-77   Erythranthe guttata [common monkey flower]
ref|XP_010090286.1|  Triosephosphate isomerase                          243   2e-76   Morus notabilis
ref|XP_007041930.1|  Triosephosphate isomerase isoform 2                242   3e-76   Theobroma cacao [chocolate]
gb|KJB15722.1|  hypothetical protein B456_002G192900                    242   5e-76   Gossypium raimondii
ref|XP_011092863.1|  PREDICTED: triosephosphate isomerase, chloro...    241   9e-76   Sesamum indicum [beniseed]
ref|XP_009369018.1|  PREDICTED: triosephosphate isomerase, chloro...    241   2e-75   Pyrus x bretschneideri [bai li]
gb|ADG27841.1|  triosephosphate isomerase                               240   3e-75   Gossypium hirsutum [American cotton]
gb|KJB77731.1|  hypothetical protein B456_012G153600                    239   3e-75   Gossypium raimondii
sp|P48496.1|TPIC_SPIOL  RecName: Full=Triosephosphate isomerase, ...    239   6e-75   Spinacia oleracea
ref|XP_008457647.1|  PREDICTED: triosephosphate isomerase, chloro...    237   2e-74   Cucumis melo [Oriental melon]
gb|KHN48239.1|  Triosephosphate isomerase, chloroplastic                236   1e-73   Glycine soja [wild soybean]
ref|XP_003542557.1|  PREDICTED: triosephosphate isomerase, chloro...    236   1e-73   Glycine max [soybeans]
ref|XP_002529248.1|  triosephosphate isomerase, putative                235   2e-73   Ricinus communis
ref|XP_011037267.1|  PREDICTED: triosephosphate isomerase, chloro...    235   2e-73   Populus euphratica
ref|XP_004147017.1|  PREDICTED: triosephosphate isomerase, chloro...    234   3e-73   Cucumis sativus [cucumbers]
ref|XP_009418696.1|  PREDICTED: triosephosphate isomerase, chloro...    234   4e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002274871.1|  PREDICTED: triosephosphate isomerase, chloro...    235   4e-73   Vitis vinifera
ref|NP_001241611.1|  uncharacterized protein LOC100798459               234   5e-73   Glycine max [soybeans]
gb|KEH24057.1|  triosephosphate isomerase                               233   1e-72   Medicago truncatula
gb|AFK41708.1|  unknown                                                 233   1e-72   Medicago truncatula
emb|CDY13836.1|  BnaA09g43380D                                          233   2e-72   Brassica napus [oilseed rape]
ref|XP_008799414.1|  PREDICTED: triosephosphate isomerase, chloro...    232   2e-72   Phoenix dactylifera
gb|AFK45656.1|  unknown                                                 232   3e-72   Lotus japonicus
ref|XP_002306169.2|  hypothetical protein POPTR_0004s17530g             232   3e-72   Populus trichocarpa [western balsam poplar]
ref|XP_009392888.1|  PREDICTED: triosephosphate isomerase, chloro...    232   3e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009140258.1|  PREDICTED: triosephosphate isomerase, chloro...    231   5e-72   Brassica rapa
emb|CDY15911.1|  BnaA04g12000D                                          231   7e-72   Brassica napus [oilseed rape]
gb|KJB15723.1|  hypothetical protein B456_002G192900                    231   1e-71   Gossypium raimondii
ref|XP_010028689.1|  PREDICTED: triosephosphate isomerase, chloro...    229   4e-71   Eucalyptus grandis [rose gum]
ref|XP_009117434.1|  PREDICTED: triosephosphate isomerase, chloro...    229   5e-71   Brassica rapa
emb|CDX82002.1|  BnaC08g35990D                                          229   5e-71   
ref|XP_004289838.1|  PREDICTED: triosephosphate isomerase, chloro...    229   5e-71   Fragaria vesca subsp. vesca
ref|XP_010555242.1|  PREDICTED: triosephosphate isomerase, chloro...    230   6e-71   Tarenaya hassleriana [spider flower]
gb|KFK41726.1|  hypothetical protein AALP_AA2G164900                    229   9e-71   Arabis alpina [alpine rockcress]
ref|XP_004494086.1|  PREDICTED: triosephosphate isomerase, chloro...    228   1e-70   Cicer arietinum [garbanzo]
ref|XP_009346630.1|  PREDICTED: triosephosphate isomerase, chloro...    228   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_007162792.1|  hypothetical protein PHAVU_001G181000g             227   3e-70   Phaseolus vulgaris [French bean]
gb|KHN39016.1|  Triosephosphate isomerase, chloroplastic                227   3e-70   Glycine soja [wild soybean]
emb|CDX99612.1|  BnaC04g33690D                                          227   4e-70   
ref|XP_008788636.1|  PREDICTED: triosephosphate isomerase, chloro...    226   7e-70   Phoenix dactylifera
ref|XP_010416860.1|  PREDICTED: triosephosphate isomerase, chloro...    226   9e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006423593.1|  hypothetical protein CICLE_v10028924mg             224   4e-69   Citrus clementina [clementine]
ref|XP_002312980.1|  triosephosphate isomerase family protein           224   7e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010935053.1|  PREDICTED: triosephosphate isomerase, chloro...    223   7e-69   Elaeis guineensis
gb|ACU23262.1|  unknown                                                 223   1e-68   Glycine max [soybeans]
gb|EPS59362.1|  triosephosphate isomerase                               223   2e-68   Genlisea aurea
gb|ABR16682.1|  unknown                                                 223   3e-68   Picea sitchensis
ref|XP_008236196.1|  PREDICTED: triosephosphate isomerase, chloro...    222   3e-68   Prunus mume [ume]
ref|XP_010429012.1|  PREDICTED: triosephosphate isomerase, chloro...    222   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_011046787.1|  PREDICTED: triosephosphate isomerase, chloro...    221   6e-68   Populus euphratica
ref|XP_007201375.1|  hypothetical protein PRUPE_ppa007813mg             222   8e-68   
gb|ABK24413.1|  unknown                                                 221   8e-68   Picea sitchensis
ref|NP_179713.1|  triosephosphate isomerase                             221   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294633.1|  hypothetical protein CARUB_v10023671mg             221   1e-67   Capsella rubella
ref|XP_010941282.1|  PREDICTED: triosephosphate isomerase, chloro...    220   1e-67   Elaeis guineensis
ref|XP_006404556.1|  hypothetical protein EUTSA_v10000249mg             220   2e-67   Eutrema salsugineum [saltwater cress]
ref|NP_001240895.1|  uncharacterized protein LOC100799358               220   2e-67   Glycine max [soybeans]
ref|XP_003554399.1|  PREDICTED: triosephosphate isomerase, chloro...    219   3e-67   Glycine max [soybeans]
ref|XP_002880361.1|  hypothetical protein ARALYDRAFT_900526             219   4e-67   Arabidopsis lyrata subsp. lyrata
gb|KHN18687.1|  Triosephosphate isomerase, chloroplastic                219   4e-67   Glycine soja [wild soybean]
sp|Q9M4S8.1|TPIC_FRAAN  RecName: Full=Triosephosphate isomerase, ...    219   5e-67   Fragaria x ananassa
ref|XP_009337933.1|  PREDICTED: triosephosphate isomerase, chloro...    218   9e-67   Pyrus x bretschneideri [bai li]
dbj|BAJ98333.1|  predicted protein                                      218   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010526563.1|  PREDICTED: triosephosphate isomerase, chloro...    214   5e-65   Tarenaya hassleriana [spider flower]
ref|XP_003578514.1|  PREDICTED: triosephosphate isomerase, chloro...    213   5e-65   Brachypodium distachyon [annual false brome]
gb|KHG23864.1|  Triosephosphate isomerase, chloroplastic                212   2e-64   Gossypium arboreum [tree cotton]
ref|XP_006661479.1|  PREDICTED: triosephosphate isomerase, chloro...    209   1e-63   
ref|XP_004957468.1|  PREDICTED: triosephosphate isomerase, chloro...    208   4e-63   Setaria italica
ref|XP_007041929.1|  Triosephosphate isomerase isoform 1                211   5e-63   
ref|NP_001063777.1|  Os09g0535000                                       208   6e-63   
gb|ACF79785.1|  unknown                                                 207   6e-63   Zea mays [maize]
gb|EAZ09878.1|  hypothetical protein OsI_32171                          208   6e-63   Oryza sativa Indica Group [Indian rice]
ref|NP_001152578.1|  triosephosphate isomerase                          208   7e-63   
gb|ACF85433.1|  unknown                                                 208   7e-63   Zea mays [maize]
sp|P46225.1|TPIC_SECCE  RecName: Full=Triosephosphate isomerase, ...    207   9e-63   Secale cereale
ref|NP_001130128.1|  uncharacterized protein LOC100191222               207   9e-63   
gb|KDO44199.1|  hypothetical protein CISIN_1g024925mg                   205   3e-62   Citrus sinensis [apfelsine]
tpg|DAA40632.1|  TPA: triosephosphate isomerase                         206   3e-62   
emb|CBI37923.3|  unnamed protein product                                204   4e-62   Vitis vinifera
ref|XP_006487404.1|  PREDICTED: triosephosphate isomerase, chloro...    206   5e-62   Citrus sinensis [apfelsine]
ref|XP_002462733.1|  hypothetical protein SORBIDRAFT_02g031030          204   1e-61   Sorghum bicolor [broomcorn]
gb|EMT18057.1|  Triosephosphate isomerase, chloroplastic                202   2e-61   
pdb|4OHQ|A  Chain A, Crystal Structure Of Chloroplast Triose Phos...    201   6e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131642.1|  uncharacterized protein LOC100193000               202   6e-61   
ref|XP_010472095.1|  PREDICTED: triosephosphate isomerase, chloro...    193   4e-57   Camelina sativa [gold-of-pleasure]
gb|EMS46255.1|  Triosephosphate isomerase, chloroplastic                189   4e-56   Triticum urartu
ref|NP_001077931.1|  triosephosphate isomerase                          190   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001763435.1|  predicted protein                                  188   9e-56   
ref|XP_002986327.1|  hypothetical protein SELMODRAFT_157971             188   1e-55   
ref|XP_001759539.1|  predicted protein                                  179   4e-52   
ref|XP_001782032.1|  predicted protein                                  179   6e-52   
ref|XP_001768780.1|  predicted protein                                  178   9e-52   
ref|XP_006423592.1|  hypothetical protein CICLE_v10028924mg             174   3e-50   
ref|XP_001751243.1|  predicted protein                                  171   6e-49   
ref|XP_002988724.1|  hypothetical protein SELMODRAFT_447410             169   3e-48   
ref|XP_003056637.1|  triosephosphate isomerase                          161   1e-44   Micromonas pusilla CCMP1545
gb|KDO44198.1|  hypothetical protein CISIN_1g024925mg                   158   2e-44   Citrus sinensis [apfelsine]
dbj|BAE48229.1|  triosephosphate isomerase chloroplast type             156   6e-43   Auxenochlorella pyrenoidosa
ref|XP_006404555.1|  hypothetical protein EUTSA_v10000249mg             156   7e-43   
gb|AAV65344.1|  triosephosphate isomerase plastid isozyme               153   9e-43   Prototheca wickerhamii
gb|AAU93945.1|  triose phosphate isomerase                              153   2e-42   Helicosporidium sp. ex Simulium jonesi
ref|XP_002506262.1|  triosephosphate isomerase                          152   3e-41   Micromonas commoda
ref|XP_007510733.1|  triosephosphate isomerase                          151   5e-41   Bathycoccus prasinos
emb|CEF98905.1|  Triosephosphate isomerase                              150   9e-41   Ostreococcus tauri
ref|XP_001422959.1|  predicted protein                                  149   2e-40   Ostreococcus lucimarinus CCE9901
ref|XP_001419463.1|  predicted protein                                  149   3e-40   Ostreococcus lucimarinus CCE9901
ref|XP_003080998.1|  triose-phosphate isomerase (ISS)                   149   4e-40   
gb|KIZ03638.1|  triosephosphate isomerase (TIM)                         146   1e-39   Monoraphidium neglectum
gb|KIZ02768.1|  triosephosphate isomerase (TIM)                         145   3e-39   Monoraphidium neglectum
ref|XP_005650184.1|  Triosephosphate isomerase                          144   7e-39   Coccomyxa subellipsoidea C-169
ref|XP_005846199.1|  triosephosphate isomerase chloroplast type         143   6e-38   Chlorella variabilis
ref|XP_002955427.1|  hypothetical protein VOLCADRAFT_109969             140   7e-37   Volvox carteri f. nagariensis
pdb|4MKN|A  Chain A, Crystal Structure Of Chloroplastic Triosepho...    139   7e-37   Chlamydomonas reinhardtii
gb|KDD74205.1|  triosephosphate isomerase                               139   9e-37   Helicosporidium sp. ATCC 50920
ref|XP_001690035.1|  triose phosphate isomerase                         139   1e-36   Chlamydomonas reinhardtii
ref|XP_008442057.1|  PREDICTED: triosephosphate isomerase, cytosolic    138   1e-36   Cucumis melo [Oriental melon]
ref|XP_004144643.1|  PREDICTED: triosephosphate isomerase, cytoso...    138   2e-36   Cucumis sativus [cucumbers]
gb|EYU38446.1|  hypothetical protein MIMGU_mgv1a012264mg                138   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_007537109.1|  PREDICTED: triosephosphate isomerase isoform X1    139   2e-36   Erinaceus europaeus [common hedgehog]
ref|XP_004170197.1|  PREDICTED: triosephosphate isomerase, cytoso...    138   2e-36   
ref|XP_004144642.1|  PREDICTED: triosephosphate isomerase, cytoso...    137   3e-36   
ref|XP_008810613.1|  PREDICTED: triosephosphate isomerase, cytosolic    137   3e-36   Phoenix dactylifera
gb|ABE11555.1|  cytosolic triosephosphate isomerase                     137   4e-36   Euglena deses var. intermedia
ref|XP_003796519.1|  PREDICTED: triosephosphate isomerase               137   5e-36   
gb|EMS61639.1|  Triosephosphate isomerase, cytosolic                    134   5e-36   Triticum urartu
ref|XP_002531441.1|  triosephosphate isomerase, putative                133   6e-36   
emb|CDM81250.1|  unnamed protein product                                137   6e-36   Triticum aestivum [Canadian hard winter wheat]
gb|AIN39806.1|  hypothetical protein                                    136   1e-35   Zoysia matrella [Japanese carpet grass]
ref|XP_005907547.1|  PREDICTED: triosephosphate isomerase               137   1e-35   Bos mutus
ref|XP_005957952.1|  PREDICTED: triosephosphate isomerase               137   1e-35   Pantholops hodgsonii [Tibetan antelope]
ref|XP_009587903.1|  PREDICTED: triosephosphate isomerase, cytoso...    136   1e-35   Nicotiana tomentosiformis
ref|XP_006065910.1|  PREDICTED: triosephosphate isomerase               137   1e-35   Bubalus bubalis [domestic water buffalo]
ref|XP_008565897.1|  PREDICTED: triosephosphate isomerase               136   1e-35   Galeopterus variegatus [Malayan flying lemur]
ref|XP_009793253.1|  PREDICTED: triosephosphate isomerase, cytoso...    135   1e-35   Nicotiana sylvestris
ref|XP_007633208.1|  PREDICTED: triosephosphate isomerase isoform X2    137   2e-35   
ref|XP_007644948.1|  PREDICTED: triosephosphate isomerase isoform X1    136   2e-35   
ref|XP_007170196.1|  PREDICTED: triosephosphate isomerase               136   2e-35   Balaenoptera acutorostrata scammoni
gb|ACU17423.1|  unknown                                                 133   2e-35   Glycine max [soybeans]
emb|CDP09059.1|  unnamed protein product                                135   2e-35   Coffea canephora [robusta coffee]
emb|CAC14917.1|  triosephosphat-isomerase                               135   2e-35   Triticum aestivum [Canadian hard winter wheat]
gb|EDM01926.1|  rCG29914, isoform CRA_d                                 133   3e-35   Rattus norvegicus [brown rat]
ref|XP_003791751.1|  PREDICTED: triosephosphate isomerase-like          135   3e-35   
ref|XP_008784587.1|  PREDICTED: triosephosphate isomerase, cytoso...    135   3e-35   Phoenix dactylifera
gb|AHA84226.1|  triose-phosphate isomerase                              135   3e-35   Phaseolus vulgaris [French bean]
ref|XP_007150325.1|  hypothetical protein PHAVU_005G144100g             135   3e-35   Phaseolus vulgaris [French bean]
emb|CAI43251.1|  triose-phosphate isomerase                             135   3e-35   Phaseolus vulgaris var. nanus
ref|XP_003463291.1|  PREDICTED: triosephosphate isomerase               135   3e-35   Cavia porcellus [guinea pig]
ref|XP_002712957.1|  PREDICTED: triosephosphate isomerase               135   4e-35   Oryctolagus cuniculus [domestic rabbit]
gb|EDM01925.1|  rCG29914, isoform CRA_c                                 133   4e-35   Rattus norvegicus [brown rat]
ref|XP_010920579.1|  PREDICTED: triosephosphate isomerase, cytoso...    134   5e-35   Elaeis guineensis
ref|XP_010651015.1|  PREDICTED: triosephosphate isomerase, cytoso...    133   5e-35   Vitis vinifera
gb|EFB13962.1|  hypothetical protein PANDA_011247                       134   5e-35   Ailuropoda melanoleuca
ref|XP_004869515.1|  PREDICTED: triosephosphate isomerase               134   5e-35   Heterocephalus glaber [naked mole rat]
ref|XP_004438751.1|  PREDICTED: triosephosphate isomerase               135   5e-35   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_003568647.1|  PREDICTED: triosephosphate isomerase, cytosolic    134   5e-35   Brachypodium distachyon [annual false brome]
ref|XP_010685754.1|  PREDICTED: triosephosphate isomerase, cytoso...    134   5e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW50197.1|  hypothetical protein EUGRSUZ_J00008                     134   6e-35   Eucalyptus grandis [rose gum]
ref|XP_006862693.1|  PREDICTED: triosephosphate isomerase isoform X1    135   7e-35   Chrysochloris asiatica
ref|XP_006644990.1|  PREDICTED: triosephosphate isomerase, cytoso...    134   7e-35   Oryza brachyantha
sp|P48497.1|TPIS_STELP  RecName: Full=Triosephosphate isomerase, ...    134   7e-35   Stellaria longipes
ref|XP_003273803.1|  PREDICTED: triosephosphate isomerase isoform 1     135   7e-35   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_006914710.1|  PREDICTED: triosephosphate isomerase               134   8e-35   Pteropus alecto
ref|XP_007108358.1|  PREDICTED: triosephosphate isomerase               134   8e-35   Physeter catodon
gb|ABH10995.1|  plastid triose phosphate isomerase                      133   8e-35   Polytomella parva
ref|XP_006933527.1|  PREDICTED: triosephosphate isomerase               134   8e-35   Felis catus [cat]
ref|XP_010030961.1|  PREDICTED: triosephosphate isomerase, cytosolic    134   9e-35   Eucalyptus grandis [rose gum]
ref|XP_006643754.1|  PREDICTED: triosephosphate isomerase, cytoso...    134   9e-35   Oryza brachyantha
ref|NP_001152759.1|  triosephosphate isomerase isoform 2                134   9e-35   Homo sapiens [man]
ref|XP_006846201.1|  hypothetical protein AMTR_s00012p00219470          134   9e-35   Amborella trichopoda
emb|CAN67342.1|  hypothetical protein VITISV_033715                     133   9e-35   Vitis vinifera
gb|KCW50198.1|  hypothetical protein EUGRSUZ_J00008                     133   1e-34   Eucalyptus grandis [rose gum]
ref|XP_004643583.1|  PREDICTED: triosephosphate isomerase               134   1e-34   Octodon degus
ref|XP_004708189.1|  PREDICTED: triosephosphate isomerase isoform X1    134   1e-34   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010554607.1|  PREDICTED: triosephosphate isomerase, cytoso...    134   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_003905933.1|  PREDICTED: triosephosphate isomerase               134   1e-34   Papio anubis [baboon]
ref|XP_010384203.1|  PREDICTED: triosephosphate isomerase               134   1e-34   Rhinopithecus roxellana
ref|XP_005652645.1|  PREDICTED: triosephosphate isomerase isoform X1    136   1e-34   
ref|XP_004307511.1|  PREDICTED: triosephosphate isomerase, cytosolic    133   1e-34   Fragaria vesca subsp. vesca
ref|XP_002117956.1|  hypothetical protein TRIADDRAFT_38509              133   1e-34   Trichoplax adhaerens
ref|XP_008823594.1|  PREDICTED: triosephosphate isomerase               134   1e-34   Nannospalax galili
ref|NP_001126005.1|  triosephosphate isomerase                          133   1e-34   Pongo abelii [orang utan]
gb|ABD92704.1|  triosephosphate isomerase 1                             133   1e-34   Sus scrofa [pigs]
gb|ELK10405.1|  Triosephosphate isomerase                               133   1e-34   Pteropus alecto
dbj|BAI48105.1|  triosephosphate isomerase 1                            133   1e-34   Sus scrofa [pigs]
ref|XP_002283671.1|  PREDICTED: triosephosphate isomerase, cytoso...    133   1e-34   Vitis vinifera
ref|XP_005378895.1|  PREDICTED: triosephosphate isomerase               133   1e-34   Chinchilla lanigera
ref|XP_009587902.1|  PREDICTED: triosephosphate isomerase, cytoso...    133   1e-34   Nicotiana tomentosiformis
gb|AAH17917.1|  Triosephosphate isomerase 1                             133   2e-34   Homo sapiens [man]
gb|AAH70129.1|  TPI1 protein                                            133   2e-34   Homo sapiens [man]
dbj|BAF62362.1|  triosephosphate isomerase 1                            133   2e-34   Pan troglodytes verus
ref|XP_006737921.1|  PREDICTED: triosephosphate isomerase               134   2e-34   Leptonychotes weddellii
ref|XP_003547334.1|  PREDICTED: triosephosphate isomerase, cytosolic    133   2e-34   
ref|NP_000356.1|  triosephosphate isomerase isoform 1                   133   2e-34   Homo sapiens [man]
ref|NP_001013607.1|  triosephosphate isomerase                          132   2e-34   Bos taurus [bovine]
ref|XP_004692958.1|  PREDICTED: triosephosphate isomerase isoform X1    132   2e-34   
ref|XP_004413981.1|  PREDICTED: triosephosphate isomerase               134   2e-34   Odobenus rosmarus divergens
ref|XP_005106755.1|  PREDICTED: triosephosphate isomerase-like          132   2e-34   Aplysia californica
pdb|4POD|A  Chain A, Structure Of Triosephosphate Isomerase I170v...    132   2e-34   Homo sapiens [man]
pdb|4POC|A  Chain A, Structure Of Triosephosphate Isomerase Wild ...    132   2e-34   Homo sapiens [man]
ref|XP_006170851.1|  PREDICTED: triosephosphate isomerase               133   2e-34   Tupaia chinensis
ref|XP_007469457.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...    133   2e-34   Lipotes vexillifer [baiji]
ref|XP_002283693.1|  PREDICTED: triosephosphate isomerase, cytosolic    132   2e-34   Vitis vinifera
gb|ABA86966.1|  triosephosphate isomerase                               132   2e-34   Glycine max [soybeans]
emb|CAN70587.1|  hypothetical protein VITISV_041523                     132   3e-34   Vitis vinifera
gb|ABB02628.1|  triose phosphate isomerase cytosolic isoform-like       132   3e-34   Solanum tuberosum [potatoes]
ref|XP_010609974.1|  PREDICTED: triosephosphate isomerase               132   3e-34   Fukomys damarensis [Damara mole rat]
ref|XP_006776159.1|  PREDICTED: triosephosphate isomerase-like          129   3e-34   Myotis davidii
ref|XP_002752312.2|  PREDICTED: triosephosphate isomerase               135   3e-34   Callithrix jacchus [common marmoset]
gb|AEK69741.1|  (S)-tetrahydroprotoberberine oxidase                    132   3e-34   Corydalis saxicola
ref|XP_011077218.1|  PREDICTED: triosephosphate isomerase, cytosolic    132   3e-34   Sesamum indicum [beniseed]
ref|XP_004766701.1|  PREDICTED: triosephosphate isomerase               133   3e-34   Mustela putorius furo [black ferret]
ref|XP_003750702.2|  PREDICTED: triosephosphate isomerase               133   3e-34   Rattus norvegicus [brown rat]
ref|XP_008143086.1|  PREDICTED: triosephosphate isomerase               133   3e-34   Eptesicus fuscus
ref|NP_001132639.1|  uncharacterized protein LOC100194114               132   3e-34   Zea mays [maize]
ref|XP_006593480.1|  PREDICTED: triosephosphate isomerase isoform X1    132   3e-34   
ref|XP_006992124.1|  PREDICTED: triosephosphate isomerase               133   4e-34   Peromyscus maniculatus bairdii
ref|XP_004026051.1|  PREDICTED: triosephosphate isomerase-like is...    132   4e-34   
ref|XP_005066069.1|  PREDICTED: triosephosphate isomerase               132   4e-34   Mesocricetus auratus [Syrian golden hamster]
gb|AAR04016.1|  cytosolic triosephosphate isomerase                     132   4e-34   Euglena gracilis
ref|NP_001183983.1|  triosephosphate isomerase                          132   5e-34   Canis lupus familiaris [dogs]
ref|XP_007935321.1|  PREDICTED: triosephosphate isomerase isoform X1    132   5e-34   Orycteropus afer afer
ref|NP_001032228.1|  triosephosphate isomerase                          132   5e-34   Sus scrofa [pigs]
ref|NP_001028244.1|  triosephosphate isomerase                          132   5e-34   Rattus norvegicus [brown rat]
gb|KJB73932.1|  hypothetical protein B456_011G261700                    132   5e-34   Gossypium raimondii
ref|NP_075211.2|  triosephosphate isomerase                             132   5e-34   Rattus norvegicus [brown rat]
gb|AAA42278.1|  triosephosphate isomerase                               131   5e-34   Rattus norvegicus [brown rat]
ref|NP_001237472.1|  triosephosphate isomerase                          132   5e-34   Glycine max [soybeans]
sp|P15426.2|TPIS_MACMU  RecName: Full=Triosephosphate isomerase; ...    131   5e-34   Macaca mulatta [rhesus macaque]
ref|XP_010256927.1|  PREDICTED: triosephosphate isomerase, cytosolic    131   5e-34   Nelumbo nucifera [Indian lotus]
gb|ABY76196.1|  triosephosphate isomerase                               131   5e-34   Oryza coarctata
ref|XP_010371267.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...    131   6e-34   Rhinopithecus roxellana
gb|ADM86861.1|  triosephosphate isomerase                               131   6e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001422591.1|  predicted protein                                  133   6e-34   Ostreococcus lucimarinus CCE9901
ref|XP_001497522.2|  PREDICTED: triosephosphate isomerase               132   6e-34   Equus caballus [domestic horse]
ref|NP_001042016.1|  Os01g0147900                                       131   6e-34   
emb|CDY02937.1|  BnaC04g25490D                                          131   6e-34   
gb|AAR11379.1|  triose phosphate isomerase cytosolic isoform            131   6e-34   Solanum chacoense
ref|XP_008512210.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...    132   6e-34   Equus przewalskii [Przewalski horse]
gb|ACJ11723.1|  triosephosphate isomerase                               131   6e-34   Gossypium hirsutum [American cotton]
ref|NP_705954.2|  triosephosphate isomerase B                           131   7e-34   Danio rerio [leopard danio]
ref|NP_001140424.1|  triosephosphate isomerase, cytosolic               131   7e-34   Zea mays [maize]
ref|XP_006365701.1|  PREDICTED: triosephosphate isomerase, cytoso...    131   7e-34   
gb|KHG17172.1|  Triosephosphate isomerase, cytosolic                    131   7e-34   Gossypium arboreum [tree cotton]
emb|CDP00096.1|  unnamed protein product                                131   7e-34   Coffea canephora [robusta coffee]
ref|XP_004448557.1|  PREDICTED: triosephosphate isomerase isoform 2     132   7e-34   Dasypus novemcinctus
gb|KHG21991.1|  Triosephosphate isomerase, cytosolic                    131   8e-34   Gossypium arboreum [tree cotton]
gb|ACG24648.1|  triosephosphate isomerase, cytosolic                    131   8e-34   Zea mays [maize]
ref|XP_009793252.1|  PREDICTED: triosephosphate isomerase, cytoso...    131   8e-34   Nicotiana sylvestris
gb|AFL48185.1|  triose phosphate isomerase cytosolic isoform-like...    131   8e-34   Capsicum annuum
gb|AAB63603.1|  triosephosphate isomerase                               131   8e-34   Oryza sativa [red rice]
ref|XP_010937618.1|  PREDICTED: triosephosphate isomerase, cytoso...    131   8e-34   Elaeis guineensis
tpg|DAA53469.1|  TPA: triosephosphate isomerase, cytosolic              132   9e-34   
gb|ABC40671.1|  rcTPI1                                                  131   9e-34   Pan troglodytes
ref|XP_010531561.1|  PREDICTED: triosephosphate isomerase, cytosolic    131   9e-34   Tarenaya hassleriana [spider flower]
ref|XP_005338375.1|  PREDICTED: triosephosphate isomerase               132   1e-33   Ictidomys tridecemlineatus
ref|XP_004279116.1|  PREDICTED: triosephosphate isomerase isoform 2     130   1e-33   Orcinus orca [Orca]
gb|ACU23435.1|  unknown                                                 131   1e-33   Glycine max [soybeans]
sp|Q90XG0.1|TPISB_DANRE  RecName: Full=Triosephosphate isomerase ...    130   1e-33   Danio rerio [leopard danio]
ref|XP_010956137.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...    132   1e-33   Camelus bactrianus [camel]
gb|KJB20069.1|  hypothetical protein B456_003G131500                    130   1e-33   Gossypium raimondii
ref|XP_008223629.1|  PREDICTED: triosephosphate isomerase, cytosolic    130   1e-33   Prunus mume [ume]
ref|XP_007205760.1|  hypothetical protein PRUPE_ppa010312mg             130   1e-33   Prunus persica
emb|CDX76095.1|  BnaA04g03590D                                          130   1e-33   
gb|KDP44954.1|  hypothetical protein JCGZ_01454                         130   1e-33   
dbj|BAD96358.1|  triosephosphate isomerase 1 variant                    130   1e-33   
ref|XP_010516113.1|  PREDICTED: triosephosphate isomerase, cytoso...    130   1e-33   
pdb|1HTI|A  Chain A, Crystal Structure Of Recombinant Human Trios...    130   1e-33   
ref|XP_010989200.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...    132   2e-33   
pdb|1WYI|A  Chain A, Human Triosephosphate Isomerase Of New Cryst...    130   2e-33   
ref|XP_008958180.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...    130   2e-33   
ref|XP_006891319.1|  PREDICTED: triosephosphate isomerase isoform X2    131   2e-33   
gb|AGJ83762.1|  triose phosphate isomerase                              130   2e-33   
gb|AAZ57433.1|  triose-phosphate isomerase                              130   2e-33   
ref|XP_010535492.1|  PREDICTED: triosephosphate isomerase, cytoso...    130   2e-33   
ref|XP_009139163.1|  PREDICTED: triosephosphate isomerase, cytosolic    130   2e-33   
ref|XP_007250949.1|  PREDICTED: triosephosphate isomerase B-like        130   2e-33   
ref|XP_002299871.1|  hypothetical protein POPTR_0001s24710g             130   2e-33   
gb|KFK34792.1|  hypothetical protein AALP_AA5G193800                    130   2e-33   
ref|XP_004596449.1|  PREDICTED: triosephosphate isomerase               130   2e-33   
pdb|4UNL|A  Chain A, Crystal Structure Of A Single Mutant (n71d) ...    130   2e-33   
gb|ELT97198.1|  hypothetical protein CAPTEDRAFT_172464                  130   2e-33   
ref|XP_009622343.1|  PREDICTED: triosephosphate isomerase, cytosolic    130   2e-33   
sp|P48495.1|TPIS_PETHY  RecName: Full=Triosephosphate isomerase, ...    130   2e-33   
ref|XP_008343539.1|  PREDICTED: triosephosphate isomerase, cytosolic    130   2e-33   
ref|XP_008370609.1|  PREDICTED: triosephosphate isomerase, cytosolic    130   2e-33   
gb|ADO27908.1|  triosephosphate isomerase b                             130   2e-33   
ref|XP_005873734.1|  PREDICTED: triosephosphate isomerase               130   2e-33   
ref|XP_008337176.1|  PREDICTED: triosephosphate isomerase, cytoso...    127   3e-33   
gb|EGW04354.1|  Triosephosphate isomerase                               127   3e-33   
pdb|4BR1|A  Chain A, Protease-induced Heterodimer Of Human Triose...    129   3e-33   
ref|XP_010427315.1|  PREDICTED: triosephosphate isomerase, cytosolic    130   3e-33   
ref|XP_004387287.1|  PREDICTED: triosephosphate isomerase isoform 2     130   3e-33   
ref|XP_006403458.1|  hypothetical protein EUTSA_v10010654mg             130   3e-33   
ref|NP_001232159.1|  putative triosephosphate isomerase                 129   3e-33   
ref|XP_009353661.1|  PREDICTED: triosephosphate isomerase, cytosolic    130   3e-33   
ref|XP_002455200.1|  hypothetical protein SORBIDRAFT_03g006130          129   3e-33   
ref|XP_009343505.1|  PREDICTED: triosephosphate isomerase, cytosolic    129   3e-33   
ref|XP_010111131.1|  Triosephosphate isomerase                          129   3e-33   
emb|CDX76094.1|  BnaA04g03580D                                          129   3e-33   
sp|P46226.3|TPIS_SECCE  RecName: Full=Triosephosphate isomerase, ...    129   4e-33   
ref|XP_002876302.1|  predicted protein                                  129   4e-33   
sp|P00939.1|TPIS_RABIT  RecName: Full=Triosephosphate isomerase; ...    129   4e-33   
gb|EYU19908.1|  hypothetical protein MIMGU_mgv1a012309mg                129   4e-33   
gb|AAH61781.1|  Tpi1 protein                                            129   4e-33   
ref|XP_002960386.1|  hypothetical protein SELMODRAFT_73442              129   5e-33   
ref|XP_003371670.1|  triosephosphate isomerase                          130   5e-33   
gb|ACN33440.1|  unknown                                                 129   5e-33   
ref|NP_191104.1|  triosephosphate isomerase                             129   6e-33   
gb|AAA03449.1|  cytosolic triose phosphate isomerase                    129   6e-33   
ref|NP_001275435.1|  triosphosphate isomerase-like protein              129   6e-33   
gb|ABC40670.1|  rcTPI1                                                  129   6e-33   
pdb|2VOM|A  Chain A, Structural Basis Of Human Triosephosphate Is...    129   6e-33   
gb|AFK44027.1|  unknown                                                 129   6e-33   
ref|XP_002533147.1|  triosephosphate isomerase, putative                129   6e-33   
ref|XP_004240361.1|  PREDICTED: triosephosphate isomerase, cytosolic    129   6e-33   
emb|CCD74748.1|  putative triosephosphate isomerase                     129   6e-33   
gb|KDD74978.1|  triosephosphate isomerase                               129   6e-33   
emb|CDW58011.1|  triosephosphate isomerase                              129   6e-33   
sp|Q589R5.1|TPIS_ORYLA  RecName: Full=Triosephosphate isomerase; ...    129   7e-33   
ref|XP_004668721.1|  PREDICTED: triosephosphate isomerase               129   7e-33   
dbj|GAA50993.1|  triosephosphate isomerase (TIM)                        128   7e-33   
ref|XP_010504398.1|  PREDICTED: triosephosphate isomerase, cytoso...    129   7e-33   
ref|XP_006291722.1|  hypothetical protein CARUB_v10017891mg             129   7e-33   
ref|XP_004074104.1|  PREDICTED: triosephosphate isomerase               129   7e-33   
gb|ACH45463.1|  putative triosephosphate isomerase                      129   7e-33   
gb|ACH45461.1|  putative triosephosphate isomerase                      129   7e-33   
ref|XP_009174523.1|  hypothetical protein T265_10014                    128   7e-33   
ref|XP_007218840.1|  hypothetical protein PRUPE_ppa010323mg             129   7e-33   
ref|XP_004487007.1|  PREDICTED: triosephosphate isomerase, cytoso...    129   8e-33   
ref|XP_004236746.1|  PREDICTED: triosephosphate isomerase, cytosolic    129   8e-33   
pdb|4UNK|A  Chain A, Crystal Structure Of Human Triosephosphate I...    128   8e-33   
ref|XP_009774716.1|  PREDICTED: triosephosphate isomerase, cytoso...    128   8e-33   
ref|XP_007006730.1|  hypothetical protein TREMEDRAFT_40506              128   8e-33   
emb|CDY02939.1|  BnaC04g25470D                                          128   9e-33   
ref|XP_003003266.1|  triosephosphate isomerase                          128   9e-33   
gb|AAK85201.1|AF387818_1  triosephosphate isomerase                     128   9e-33   
ref|XP_009139165.1|  PREDICTED: triosephosphate isomerase, cytoso...    128   9e-33   
ref|NP_001187307.1|  triosephosphate isomerase b                        128   1e-32   
ref|XP_002508897.1|  triosephosphate isomerase                          130   1e-32   
gb|AHY18975.1|  triosephosphate isomerase                               128   1e-32   
gb|ACO09788.1|  Triosephosphate isomerase                               128   1e-32   
ref|XP_007009326.1|  Triosephosphate isomerase isoform 2                128   1e-32   
gb|ERE84791.1|  triosephosphate isomerase                               125   1e-32   
gb|EUC57292.1|  triosephosphate isomerase                               128   1e-32   
emb|CDQ58416.1|  unnamed protein product                                128   1e-32   
gb|ABZ90134.1|  triosephosphate isomerase                               128   1e-32   
sp|P48501.1|TPIS_SCHMA  RecName: Full=Triosephosphate isomerase; ...    128   1e-32   
ref|XP_009174526.1|  hypothetical protein T265_10017                    128   1e-32   
ref|XP_003966343.1|  PREDICTED: triosephosphate isomerase B-like        127   2e-32   
ref|XP_003713934.1|  triosephosphate isomerase                          127   2e-32   
ref|XP_009357729.1|  PREDICTED: triosephosphate isomerase, cytoso...    127   2e-32   
ref|XP_006124207.1|  PREDICTED: triosephosphate isomerase               127   2e-32   
ref|XP_003410703.2|  PREDICTED: triosephosphate isomerase               127   2e-32   
ref|XP_009897916.1|  PREDICTED: triosephosphate isomerase               127   2e-32   
ref|XP_002314179.1|  hypothetical protein POPTR_0009s03650g             127   2e-32   
ref|XP_008497346.1|  PREDICTED: triosephosphate isomerase               127   2e-32   
gb|KFH70366.1|  triosephosphate isomerase, chloroplastic                127   2e-32   
emb|CAF90849.1|  unnamed protein product                                127   2e-32   
ref|XP_008371752.1|  PREDICTED: triosephosphate isomerase, cytoso...    127   2e-32   
pdb|4P61|A  Chain A, Chicken Triosephosphate Isomerase With Loop6...    127   3e-32   
ref|XP_005523884.1|  PREDICTED: triosephosphate isomerase               127   3e-32   
ref|NP_001171739.1|  triosephosphate isomerase 1                        127   3e-32   
ref|XP_011326337.1|  triosephosphate isomerase                          127   3e-32   
ref|XP_003771273.1|  PREDICTED: triosephosphate isomerase               127   3e-32   
ref|NP_990782.1|  triosephosphate isomerase                             127   3e-32   
ref|XP_009564988.1|  PREDICTED: triosephosphate isomerase               127   3e-32   
ref|XP_008233628.1|  PREDICTED: triosephosphate isomerase, cytosolic    127   3e-32   
ref|XP_008018470.1|  PREDICTED: triosephosphate isomerase-like          127   3e-32   
ref|XP_009252937.1|  hypothetical protein FPSE_01542                    127   3e-32   
pdb|1SW7|A  Chain A, Triosephosphate Isomerase From Gallus Gallus...    127   3e-32   
ref|XP_007009325.1|  Triosephosphate isomerase isoform 1                128   3e-32   
pdb|1SW3|A  Chain A, Triosephosphate Isomerase From Gallus Gallus...    127   3e-32   
pdb|1SPQ|A  Chain A, Understanding Protein Lids: Structural Analy...    127   4e-32   
pdb|1TPH|1  Chain 1, 1.8 Angstroms Crystal Structure Of Wild Type...    127   4e-32   
ref|XP_011035316.1|  PREDICTED: triosephosphate isomerase, cytoso...    128   4e-32   
dbj|GAA50994.1|  triosephosphate isomerase (TIM)                        127   4e-32   
pdb|1TPB|1  Chain 1, Offset Of A Catalytic Lesion By A Bound Wate...    126   4e-32   
pdb|1SSD|A  Chain A, Understanding Protein Lids: Structural Analy...    126   4e-32   
ref|XP_009653583.1|  triosephosphate isomerase                          126   4e-32   
ref|XP_011400938.1|  Triosephosphate isomerase, chloroplastic           134   4e-32   
ref|NP_001133174.1|  triosephosphate isomerase B                        126   4e-32   
pdb|1SU5|A  Chain A, Understanding Protein Lids: Structural Analy...    126   4e-32   
ref|NP_001107706.1|  triosephosphate isomerase                          126   4e-32   
gb|ESA13669.1|  hypothetical protein GLOINDRAFT_176549                  126   5e-32   
pdb|1SW0|A  Chain A, Triosephosphate Isomerase From Gallus Gallus...    126   5e-32   
gb|KGB42150.1|  Triosephosphate isomerase                               124   5e-32   
ref|XP_004569774.1|  PREDICTED: triosephosphate isomerase-like          126   5e-32   
ref|XP_003663248.1|  hypothetical protein MYCTH_2304931                 126   5e-32   
pdb|1SQ7|A  Chain A, Understanding Protein Lids: Structural Analy...    126   6e-32   
ref|XP_006693025.1|  triosephosphate isomerase-like protein             126   6e-32   
ref|XP_010690624.1|  PREDICTED: triosephosphate isomerase, cytosolic    126   6e-32   
gb|EWG44294.1|  triosephosphate isomerase                               126   7e-32   
ref|XP_005706061.1|  triosephosphate isomerase (TIM)                    127   7e-32   
sp|Q1MTI4.1|TPISA_DANRE  RecName: Full=Triosephosphate isomerase ...    125   9e-32   
ref|NP_001273224.1|  triosephosphate isomerase-like                     125   9e-32   
gb|AAH49500.1|  Tpi1a protein                                           125   9e-32   
gb|AFK34912.1|  unknown                                                 125   9e-32   
sp|Q27775.1|TPIS_SCHJA  RecName: Full=Triosephosphate isomerase; ...    125   9e-32   
ref|XP_006037108.1|  PREDICTED: triosephosphate isomerase               125   1e-31   
gb|ADP21052.1|  cytosolic triosephosphate isomerase                     125   1e-31   
dbj|BAE26832.1|  unnamed protein product                                125   1e-31   
gb|AAC36016.1|  TPI                                                     125   1e-31   
emb|CAX75985.1|  triosephosphate isomerase 1a                           125   1e-31   
emb|CAX70868.1|  triosephosphate isomerase 1a                           125   1e-31   
gb|KHJ77640.1|  triose-phosphate isomerase                              123   1e-31   
gb|ADP21072.1|  cytosolic triosephosphate isomerase                     125   1e-31   
emb|CCT66267.1|  probable TPI1-triose-phosphate isomerase               125   1e-31   
gb|EGU85868.1|  hypothetical protein FOXB_03716                         125   1e-31   
dbj|BAB27194.1|  unnamed protein product                                125   1e-31   
ref|XP_003227154.1|  PREDICTED: triosephosphate isomerase               125   1e-31   
ref|XP_008337175.1|  PREDICTED: triosephosphate isomerase, cytoso...    123   1e-31   
gb|KFD57747.1|  hypothetical protein M513_01417                         125   1e-31   
gb|AAK27513.1|AF344331_1  triosephosphate isomerase                     123   1e-31   
ref|XP_009048158.1|  hypothetical protein LOTGIDRAFT_238326             125   1e-31   
gb|ADP21058.1|  cytosolic triosephosphate isomerase                     125   1e-31   
gb|ADP21065.1|  cytosolic triosephosphate isomerase                     125   1e-31   
gb|ADP21064.1|  cytosolic triosephosphate isomerase                     125   1e-31   
gb|ABC59698.1|  triosephosphate isomerase                               125   1e-31   
gb|ADP21061.1|  cytosolic triosephosphate isomerase                     125   2e-31   
gb|ELU38879.1|  triose phosphate isomerase                              125   2e-31   
gb|AAK27514.1|AF344332_1  triosephosphate isomerase                     123   2e-31   
ref|NP_705953.1|  triosephosphate isomerase A                           125   2e-31   
ref|XP_005146698.1|  PREDICTED: LOW QUALITY PROTEIN: triosephosph...    125   2e-31   
gb|ADP21048.1|  cytosolic triosephosphate isomerase                     125   2e-31   
ref|XP_003452735.1|  PREDICTED: triosephosphate isomerase-like          125   2e-31   
gb|ADP21077.1|  cytosolic triosephosphate isomerase                     125   2e-31   
gb|AAP06170.1|  similar to GenBank Accession Number L07286 triose...    125   2e-31   
ref|XP_006642422.1|  PREDICTED: triosephosphate isomerase B-like        125   2e-31   
pdb|1TPW|A  Chain A, Triosephosphate Isomerase Drinks Water To Ke...    125   2e-31   
gb|KIL88976.1|  hypothetical protein FAVG1_07370                        125   2e-31   
ref|NP_001080476.1|  triosephosphate isomerase                          125   2e-31   
gb|ADP21053.1|  cytosolic triosephosphate isomerase                     125   2e-31   
pdb|1TPC|1  Chain 1, Offset Of A Catalytic Lesion By A Bound Wate...    125   2e-31   
ref|XP_008279357.1|  PREDICTED: triosephosphate isomerase               124   2e-31   
emb|CDQ80447.1|  unnamed protein product                                124   2e-31   
gb|ADR66027.1|  triosephosphate isomerase                               124   2e-31   
ref|XP_003348983.1|  hypothetical protein SMAC_02004                    124   2e-31   
gb|AAV65491.1|  cytosolic triosephosphate isomerase                     125   2e-31   
gb|ADP21078.1|  cytosolic triosephosphate isomerase                     124   2e-31   
gb|KEZ41570.1|  hypothetical protein SAPIO_CDS7740                      124   2e-31   
emb|CAX75987.1|  triosephosphate isomerase 1a                           124   3e-31   
ref|XP_001370168.1|  PREDICTED: triosephosphate isomerase               124   3e-31   
ref|NP_001273230.1|  triosephosphate isomerase B-like                   124   3e-31   
ref|XP_010749092.1|  PREDICTED: triosephosphate isomerase               124   3e-31   
ref|NP_001119730.1|  triosephosphate isomerase                          124   3e-31   
ref|XP_007420484.1|  PREDICTED: triosephosphate isomerase               124   3e-31   
ref|NP_033441.2|  triosephosphate isomerase                             125   3e-31   
ref|XP_959063.1|  triosephosphate isomerase                             124   3e-31   
ref|XP_002167611.1|  PREDICTED: triosephosphate isomerase-like          124   3e-31   
pdb|1TIM|A  Chain A, Structure Of Triose Phosphate Isomerase From...    124   3e-31   
pdb|1TPU|A  Chain A, S96p Change Is A Second-Site Suppressor For ...    124   4e-31   
ref|XP_007564449.1|  PREDICTED: triosephosphate isomerase               124   4e-31   
gb|ADP21051.1|  cytosolic triosephosphate isomerase                     124   4e-31   
ref|XP_008429626.1|  PREDICTED: triosephosphate isomerase               125   4e-31   
gb|ABN80450.1|  triose phosphate isomerase B                            124   5e-31   
emb|CAA37420.1|  triosephosphate isomerase                              124   5e-31   
gb|KHJ85713.1|  triose-phosphate isomerase                              124   5e-31   
ref|XP_006884434.1|  PREDICTED: triosephosphate isomerase-like is...    124   5e-31   
gb|ETP37913.1|  triose-phosphate isomerase                              124   6e-31   
gb|KFH49076.1|  Triosephosphate isomerase-like protein                  123   6e-31   
ref|XP_005951088.1|  PREDICTED: triosephosphate isomerase-like          123   7e-31   
ref|XP_005312065.1|  PREDICTED: triosephosphate isomerase               123   7e-31   
dbj|BAF62292.1|  triose phosphate isomerase                             123   7e-31   
gb|ETE72092.1|  Triosephosphate isomerase                               123   7e-31   
ref|XP_004550861.1|  PREDICTED: triosephosphate isomerase B-like        123   7e-31   
ref|XP_005365395.1|  PREDICTED: triosephosphate isomerase               123   8e-31   
ref|XP_009185264.1|  PREDICTED: triosephosphate isomerase-like          123   8e-31   
gb|ETO68762.1|  triose-phosphate isomerase                              123   9e-31   
gb|AAC47855.1|  triosephosphate isomerase                               123   9e-31   
ref|XP_008910152.1|  triose-phosphate isomerase                         123   9e-31   
ref|XP_004078032.1|  PREDICTED: triosephosphate isomerase               123   9e-31   
ref|XP_003450633.1|  PREDICTED: triosephosphate isomerase B             123   9e-31   
dbj|BAO40149.1|  triosephosphate isomerase                              123   1e-30   
sp|Q70JN8.1|TPIS_KLUMA  RecName: Full=Triosephosphate isomerase; ...    123   1e-30   
ref|XP_008420895.1|  PREDICTED: triosephosphate isomerase               123   1e-30   
ref|XP_007699138.1|  hypothetical protein COCSADRAFT_36280              122   1e-30   
ref|XP_007688722.1|  hypothetical protein COCMIDRAFT_26987              122   1e-30   
ref|XP_001936088.1|  triosephosphate isomerase                          122   1e-30   
ref|XP_001752170.1|  predicted protein                                  123   1e-30   
gb|ETN69743.1|  triose-phosphate isomerase                              123   1e-30   
dbj|BAE39523.1|  unnamed protein product                                122   1e-30   
ref|XP_010774570.1|  PREDICTED: triosephosphate isomerase               122   1e-30   
ref|XP_005745225.1|  PREDICTED: triosephosphate isomerase-like          122   1e-30   
ref|XP_002631798.1|  C. briggsae CBR-TPI-1 protein                      122   2e-30   



>ref|XP_004230885.1| PREDICTED: triosephosphate isomerase, chloroplastic [Solanum 
lycopersicum]
Length=326

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = +3

Query  96   QFSGLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            QFSGLR  +SKLD+S S ST+ +FF N+ SHLR+ + RK CRAVVAMAGSGKFFVGGNWK
Sbjct  25   QFSGLRKSLSKLDNSVSFSTSQAFFQNVDSHLRISSDRKGCRAVVAMAGSGKFFVGGNWK  84

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SI+KLVSDLNSA+LESDVDVVVAPPFLYIDQVK SLTD+IE+SAQNCW  KGGA
Sbjct  85   CNGTKDSISKLVSDLNSAQLESDVDVVVAPPFLYIDQVKNSLTDRIEVSAQNCWTGKGGA  144

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQ+KD+GCKWVILGHSERRHVIGE DE
Sbjct  145  FTGEISVEQVKDLGCKWVILGHSERRHVIGENDE  178



>ref|XP_006359648.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Solanum 
tuberosum]
Length=326

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = +3

Query  96   QFSGLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            QFSGLR   SKLD+S S ST+ +FF  + SHLRL   RK CRAVVAMAGSGKFFVGGNWK
Sbjct  25   QFSGLRKSFSKLDNSVSFSTSQAFFQTVDSHLRLSADRKGCRAVVAMAGSGKFFVGGNWK  84

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SI+KLVSDLN+A+LESDVDVVVAPPFLYIDQVK SLTD+IE+SAQNCW  KGGA
Sbjct  85   CNGTKDSISKLVSDLNNAQLESDVDVVVAPPFLYIDQVKNSLTDRIEVSAQNCWTGKGGA  144

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQ+KD+GCKWVILGHSERRHVIGE DE
Sbjct  145  FTGEISVEQVKDLGCKWVILGHSERRHVIGENDE  178



>ref|XP_009590743.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=322

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +3

Query  99   FSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCN  278
            FSGLRP S   +S S STT SFF N+ S LRL +S+K CRAVV MAGSGKFFVGGNWKCN
Sbjct  25   FSGLRPSSL--NSVSFSTTQSFFQNVDSQLRLSSSQKGCRAVVTMAGSGKFFVGGNWKCN  82

Query  279  GTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFT  458
            GTK+SI+KL+SDLNSAKLESDVDVVVAPPFLYIDQVK+SLTD+IEISAQNCW  KGGAFT
Sbjct  83   GTKDSISKLISDLNSAKLESDVDVVVAPPFLYIDQVKSSLTDRIEISAQNCWTGKGGAFT  142

Query  459  GEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GEISVEQLKD+GCKWVILGHSERRH+IGE DE
Sbjct  143  GEISVEQLKDLGCKWVILGHSERRHIIGENDE  174



>ref|XP_009788094.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Nicotiana 
sylvestris]
Length=327

 Score =   261 bits (666),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = +3

Query  96   QFSGLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            QFSGLR   SK ++S S ST+ +FFHN+ S LRL ++++ CRAVV MAGSGKFFVGGNWK
Sbjct  26   QFSGLRKSFSKFENSVSFSTSLAFFHNVDSQLRLSSAQRGCRAVVTMAGSGKFFVGGNWK  85

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SI+KLVSDLNSA+LESDVDVVVAPPFLYIDQVK SLTD+IE+SAQNCW  KGGA
Sbjct  86   CNGTKDSISKLVSDLNSAQLESDVDVVVAPPFLYIDQVKNSLTDRIEVSAQNCWTGKGGA  145

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  146  FTGEISVEQLKDLGCKWVILGHSERRHVIGENDE  179



>ref|XP_006367334.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Solanum 
tuberosum]
Length=319

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 132/153 (86%), Gaps = 4/153 (3%)
 Frame = +3

Query  96   QFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKC  275
             FSGLRP S       L  THSFF N+ SHLRL  S KACR VV+MAGSGKFFVGGNWKC
Sbjct  23   HFSGLRPSSNF----KLDNTHSFFQNVDSHLRLSPSHKACRPVVSMAGSGKFFVGGNWKC  78

Query  276  NGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAF  455
            NGTK+SI+KLVSDLNSAKLESDVDVVVAPPFLYIDQVK+SLTD+IEIS QNCW  KGGAF
Sbjct  79   NGTKDSISKLVSDLNSAKLESDVDVVVAPPFLYIDQVKSSLTDRIEISGQNCWTGKGGAF  138

Query  456  TGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  139  TGEISVEQLKDVGCKWVILGHSERRHVIGENDE  171



>ref|XP_009768928.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Nicotiana 
sylvestris]
Length=322

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +3

Query  99   FSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCN  278
            FSGLRP S   +S S STT SF  N+ SHLRL +S+K CRAVV MAGSGKFFVGGNWKCN
Sbjct  25   FSGLRPSSL--NSISFSTTQSFSQNVDSHLRLSSSQKGCRAVVTMAGSGKFFVGGNWKCN  82

Query  279  GTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFT  458
            GTK+SI+KL+SDLNSAKLESDVDVVVAPPFLYIDQVK+SLTD+IEISAQNCW  KGGAFT
Sbjct  83   GTKDSISKLISDLNSAKLESDVDVVVAPPFLYIDQVKSSLTDRIEISAQNCWTGKGGAFT  142

Query  459  GEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GEISVEQLKD+GCKWVILGHSERRH+IGE DE
Sbjct  143  GEISVEQLKDLGCKWVILGHSERRHIIGENDE  174



>emb|CDO96949.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   256 bits (655),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 142/170 (84%), Gaps = 12/170 (7%)
 Frame = +3

Query  81   MAVAA------QFSGLRPVS--KLDSSP-SLSTTHSFFHNLHSHLRLPTS---RKACRAV  224
            MAVA+      QFSGLR  S   LDS P S+ST  SFF NL SHLRL +S    KACR V
Sbjct  1    MAVASTSLACPQFSGLRRSSCPMLDSPPLSISTAQSFFQNLDSHLRLSSSSPRNKACRPV  60

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD  404
            VAMAGSGKFFVGGNWKCNGTKESI KL+SDLNSA LESDVDVVVAPPF+YIDQVK+SLTD
Sbjct  61   VAMAGSGKFFVGGNWKCNGTKESIGKLISDLNSAMLESDVDVVVAPPFIYIDQVKSSLTD  120

Query  405  QIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IE+SAQNCWI KGGAFTGEIS EQLKDIGCKWVILGHSERRH+IGE DE
Sbjct  121  RIEVSAQNCWIGKGGAFTGEISGEQLKDIGCKWVILGHSERRHIIGEDDE  170



>ref|XP_009610674.1| PREDICTED: triosephosphate isomerase, chloroplastic [Nicotiana 
tomentosiformis]
Length=327

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = +3

Query  96   QFSGLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            QFSGLR   SK ++S S ST+ +FFHN+ S LRL +++K CRAVV MAGSGKFFVGGNWK
Sbjct  26   QFSGLRKSFSKFENSVSFSTSQAFFHNVDSQLRLSSAQKGCRAVVTMAGSGKFFVGGNWK  85

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SI+KLVSDLNSA+LESDVDVVVAPPFLYIDQ+K S+TD+IE+SAQNCW  KGGA
Sbjct  86   CNGTKDSISKLVSDLNSAQLESDVDVVVAPPFLYIDQIKNSITDRIEVSAQNCWTGKGGA  145

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQL D+GCKWVILGHSERRHVIGE DE
Sbjct  146  FTGEISVEQLIDLGCKWVILGHSERRHVIGENDE  179



>ref|XP_010268160.1| PREDICTED: triosephosphate isomerase, chloroplastic isoform X2 
[Nelumbo nucifera]
Length=316

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +3

Query  54   LSTDLTLSEMAVAA--QFSGLRPVS---KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACR  218
            L++ L+ S+ A+++  QFSGLR      KLD S + STT SFF +++SHLRL   R+ CR
Sbjct  8    LASQLSGSKCAISSCPQFSGLRRSGLSLKLDQSHTFSTTQSFFDHVNSHLRLSDGRRGCR  67

Query  219  AVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASL  398
             V+ MAGSGKFFVGGNWKCNGTKESI+KLVSDLN A+LE+DVDVVVAPPF+YIDQVK SL
Sbjct  68   GVITMAGSGKFFVGGNWKCNGTKESISKLVSDLNGAELEADVDVVVAPPFIYIDQVKNSL  127

Query  399  TDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TD+IEISAQN W+ KGGAFTGEISVEQLKDIGC WVILGHSERRH+IGE D+
Sbjct  128  TDRIEISAQNSWVGKGGAFTGEISVEQLKDIGCNWVILGHSERRHIIGEDDQ  179



>ref|XP_010268151.1| PREDICTED: triosephosphate isomerase, chloroplastic isoform X1 
[Nelumbo nucifera]
Length=327

 Score =   255 bits (651),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = +3

Query  54   LSTDLTLSEMAVAA--QFSGLRPVS---KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACR  218
            L++ L+ S+ A+++  QFSGLR      KLD S + STT SFF +++SHLRL   R+ CR
Sbjct  8    LASQLSGSKCAISSCPQFSGLRRSGLSLKLDQSHTFSTTQSFFDHVNSHLRLSDGRRGCR  67

Query  219  AVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASL  398
             V+ MAGSGKFFVGGNWKCNGTKESI+KLVSDLN A+LE+DVDVVVAPPF+YIDQVK SL
Sbjct  68   GVITMAGSGKFFVGGNWKCNGTKESISKLVSDLNGAELEADVDVVVAPPFIYIDQVKNSL  127

Query  399  TDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TD+IEISAQN W+ KGGAFTGEISVEQLKDIGC WVILGHSERRH+IGE D+
Sbjct  128  TDRIEISAQNSWVGKGGAFTGEISVEQLKDIGCNWVILGHSERRHIIGEDDQ  179



>ref|XP_010690445.1| PREDICTED: triosephosphate isomerase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=320

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = +3

Query  54   LSTDLTLSEMAVAAQFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVA  230
            L++ +T     V+ QFSGLR    KL++S S   T S F N+ SHLRL ++R+  R VVA
Sbjct  8    LASQMTNPNSVVSTQFSGLRRSFFKLETSVS---TQSLFQNVESHLRLSSTRRGSRGVVA  64

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA SGKFFVGGNWKCNGTKESITKLVSDLNSA LE+DVD+VVAPPF+YIDQVK+SLT+++
Sbjct  65   MAASGKFFVGGNWKCNGTKESITKLVSDLNSATLEADVDIVVAPPFVYIDQVKSSLTNRV  124

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            EISAQNCWI KGGAFTGEIS EQ+KD+GC+WVILGHSERRHVIGE DE
Sbjct  125  EISAQNCWIGKGGAFTGEISAEQVKDLGCQWVILGHSERRHVIGEKDE  172



>ref|XP_011088504.1| PREDICTED: triosephosphate isomerase, chloroplastic [Sesamum 
indicum]
Length=319

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 136/154 (88%), Gaps = 2/154 (1%)
 Frame = +3

Query  96   QFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            QFSGLR    KLD+S S ++T +FF N++SHL L +S + CR VV MAGSGKFFVGGNWK
Sbjct  19   QFSGLRRSFLKLDTSNS-NSTQAFFRNVNSHLHLASSSRGCRGVVTMAGSGKFFVGGNWK  77

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SI+KLVS+LNSA LESDVDVVVAPPF+YIDQVK SL+D+IEISAQNCWI KGGA
Sbjct  78   CNGTKDSISKLVSELNSATLESDVDVVVAPPFVYIDQVKNSLSDRIEISAQNCWIGKGGA  137

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKD+GCKWVILGHSERRH+IGE D+
Sbjct  138  FTGEISVEQLKDLGCKWVILGHSERRHIIGEDDQ  171



>ref|XP_010268686.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Nelumbo 
nucifera]
Length=315

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 136/164 (83%), Gaps = 3/164 (2%)
 Frame = +3

Query  72   LSEMAVAAQFSGLRPVS---KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGS  242
            +S ++   QF GLR      KLD S +LSTT  FF ++ SHL L  +R+ CR V+ MAGS
Sbjct  4    MSTISSCPQFCGLRLSGLSLKLDQSQTLSTTQFFFQHVDSHLHLSAARRGCRGVITMAGS  63

Query  243  GKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISA  422
            GKFFVGGNWKCNGTK+SI+KLVSDLN+AKLE+DVDVVVAPPF+YIDQVK SLTD+IEISA
Sbjct  64   GKFFVGGNWKCNGTKDSISKLVSDLNNAKLEADVDVVVAPPFVYIDQVKNSLTDRIEISA  123

Query  423  QNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            QN W+ KGGAFTGEISVEQL DIGCKWVILGHSERRH+IGE D+
Sbjct  124  QNSWVGKGGAFTGEISVEQLNDIGCKWVILGHSERRHIIGEDDQ  167



>gb|KDP27586.1| hypothetical protein JCGZ_19591 [Jatropha curcas]
Length=321

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  54   LSTDLT--LSEMAVAAQFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAV  224
            LST L    S    A QFSGLR    KL+S+ S S + SF  + +S LR+P+SRK    V
Sbjct  4    LSTSLAGPKSSYCAAPQFSGLRRSCPKLESTNSHSLSQSFLRHFNSQLRVPSSRKPSGHV  63

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD  404
            VAMAG+G FFVGGNWKCNGTKESITKLVSDLN AKLE+DVDVVVAPPF+YIDQVK+SLTD
Sbjct  64   VAMAGTGTFFVGGNWKCNGTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKSSLTD  123

Query  405  QIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IEIS QN W+SKGGAFTGEISVEQLKDIGCKWVILGHSERRH+IGE DE
Sbjct  124  RIEISGQNSWVSKGGAFTGEISVEQLKDIGCKWVILGHSERRHIIGEKDE  173



>ref|XP_004248665.1| PREDICTED: triosephosphate isomerase, chloroplastic [Solanum 
lycopersicum]
Length=312

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 135/171 (79%), Gaps = 15/171 (9%)
 Frame = +3

Query  54   LSTDLTLSEMAVA----AQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRA  221
            L++ L+  + A+A      FSGLRP S       L  T SFF N+ SH       K CR 
Sbjct  5    LASQLSGPKSAIAFSTPPHFSGLRPSSNF----KLDNTRSFFQNVDSH-------KGCRP  53

Query  222  VVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLT  401
            VV+MAGSGKFFVGGNWKCNGTK+SI+KLVSDLNSAKLESDVDVVVAPPF+YIDQVK+SLT
Sbjct  54   VVSMAGSGKFFVGGNWKCNGTKDSISKLVSDLNSAKLESDVDVVVAPPFMYIDQVKSSLT  113

Query  402  DQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            D+IEIS QNCW  KGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGE DE
Sbjct  114  DRIEISGQNCWTGKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGENDE  164



>gb|KJB15724.1| hypothetical protein B456_002G192900 [Gossypium raimondii]
Length=216

 Score =   242 bits (617),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%), Gaps = 7/154 (5%)
 Frame = +3

Query  99   FSGLRPVSKLDSSPSL--STTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            FSGLR      SSP+L  + + SF  +  S LRLP+S K CRAV+AM+GSGKFFVGGNWK
Sbjct  11   FSGLR-----RSSPNLHNAPSQSFLQHFGSQLRLPSSPKPCRAVIAMSGSGKFFVGGNWK  65

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SITKLVSDLNSAKLESDVDVVVAPPF+Y+DQV +SLTD+IE+SAQN WI KGGA
Sbjct  66   CNGTKDSITKLVSDLNSAKLESDVDVVVAPPFVYLDQVTSSLTDRIEVSAQNSWIGKGGA  125

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKDIGCKWVILGHSERRHVIGE D+
Sbjct  126  FTGEISVEQLKDIGCKWVILGHSERRHVIGEDDQ  159



>gb|EYU37874.1| hypothetical protein MIMGU_mgv1a008655mg [Erythranthe guttata]
Length=366

 Score =   246 bits (627),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 144/174 (83%), Gaps = 4/174 (2%)
 Frame = +3

Query  42   PYLHLSTDLTLSEMAVA--AQFSGLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKA  212
            P   +ST L+ +        QFSGLR    KLD+S + ++T S F N+ SHLRL +S K 
Sbjct  46   PMAVVSTSLSGATAVTGQLTQFSGLRKSFLKLDNS-NHNSTQSLFQNVDSHLRLASSNKG  104

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            CR VVAMAGSGKFFVGGNWKCNGTK+SI+KLV++LNSA LESDVDVVVAPPF+YIDQVK+
Sbjct  105  CRGVVAMAGSGKFFVGGNWKCNGTKDSISKLVTELNSAALESDVDVVVAPPFVYIDQVKS  164

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            SL+D+IEI+AQNCW+ KGGAFTGEISVEQ++D+GCKWV+LGHSERRHVIGE D+
Sbjct  165  SLSDRIEIAAQNCWVGKGGAFTGEISVEQIQDLGCKWVVLGHSERRHVIGEDDQ  218



>ref|XP_010090286.1| Triosephosphate isomerase [Morus notabilis]
 gb|EXB39256.1| Triosephosphate isomerase [Morus notabilis]
Length=324

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  75   SEMAVAAQFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKF  251
            + ++    FSGLR   SKL++  S+S T S F +LHSHLRL +S K  RAVVAM G+GKF
Sbjct  16   TSLSYCPNFSGLRRSCSKLETPHSISATQSLFQHLHSHLRLSSSAKPSRAVVAMVGTGKF  75

Query  252  FVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNC  431
            FVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPF+Y+D VK SLT +I+IS+QN 
Sbjct  76   FVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFVYLDLVKNSLTHRIDISSQNS  135

Query  432  WISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            W+ KGGAFTGEISVEQLKDIG KWVILGHSERRHVIGE D+
Sbjct  136  WVGKGGAFTGEISVEQLKDIGAKWVILGHSERRHVIGEDDQ  176



>ref|XP_007041930.1| Triosephosphate isomerase isoform 2 [Theobroma cacao]
 gb|EOX97761.1| Triosephosphate isomerase isoform 2 [Theobroma cacao]
Length=307

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 133/154 (86%), Gaps = 5/154 (3%)
 Frame = +3

Query  96   QFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            QFSGLR    KLD+S S     SF  +++S LRL +S K CRAV+AMAGSGKFFVGGNWK
Sbjct  10   QFSGLRRSCPKLDNSQS----QSFVQHINSQLRLSSSPKPCRAVLAMAGSGKFFVGGNWK  65

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGT ESITKLVSDLNS+ LESDVDVVVAPPF+Y+DQVKASLTD+IE+SAQN WI KGGA
Sbjct  66   CNGTNESITKLVSDLNSSTLESDVDVVVAPPFVYLDQVKASLTDRIEVSAQNSWIGKGGA  125

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKDIGCKWVILGHSERRH+IGE D+
Sbjct  126  FTGEISVEQLKDIGCKWVILGHSERRHIIGEDDQ  159



>gb|KJB15722.1| hypothetical protein B456_002G192900 [Gossypium raimondii]
Length=307

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%), Gaps = 7/154 (5%)
 Frame = +3

Query  99   FSGLRPVSKLDSSPSL--STTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            FSGLR      SSP+L  + + SF  +  S LRLP+S K CRAV+AM+GSGKFFVGGNWK
Sbjct  11   FSGLR-----RSSPNLHNAPSQSFLQHFGSQLRLPSSPKPCRAVIAMSGSGKFFVGGNWK  65

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SITKLVSDLNSAKLESDVDVVVAPPF+Y+DQV +SLTD+IE+SAQN WI KGGA
Sbjct  66   CNGTKDSITKLVSDLNSAKLESDVDVVVAPPFVYLDQVTSSLTDRIEVSAQNSWIGKGGA  125

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKDIGCKWVILGHSERRHVIGE D+
Sbjct  126  FTGEISVEQLKDIGCKWVILGHSERRHVIGEDDQ  159



>ref|XP_011092863.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Sesamum 
indicum]
Length=319

 Score =   241 bits (616),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = +3

Query  96   QFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
             FSGLR    KLDSS S  +THS F +++SHLRL +S K CR VV M+GSGKFFVGGNWK
Sbjct  19   HFSGLRRSFLKLDSSNS-DSTHSLFRDVNSHLRLVSSNKGCRGVVTMSGSGKFFVGGNWK  77

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGT +SI+KLVSDLNSA LESDVDVVVAPPF+YIDQVK SL+D+IEI+AQNCW  KGGA
Sbjct  78   CNGTGDSISKLVSDLNSAILESDVDVVVAPPFVYIDQVKNSLSDRIEIAAQNCWTGKGGA  137

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKD+GCKWV+LGHSERRH+IGE D+
Sbjct  138  FTGEISVEQLKDLGCKWVVLGHSERRHIIGEDDQ  171



>ref|XP_009369018.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=322

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = +3

Query  105  GLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLP-TSRKACRAVVAMAGSGKFFVGGNWKCN  278
            GLRP   KL+ S SLS T S F +LHSHLRL  +SRKA R VVAMAG+GKFFVGGNWKCN
Sbjct  23   GLRPSCCKLEFSHSLSATQSLFQHLHSHLRLSFSSRKASRGVVAMAGTGKFFVGGNWKCN  82

Query  279  GTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFT  458
            GTK+SI KLV+DLNSAKLE+DVDVVVAPPFLY+DQVK+SLTD+IE+S QN W+ KGGAFT
Sbjct  83   GTKDSIRKLVADLNSAKLEADVDVVVAPPFLYLDQVKSSLTDRIELSGQNSWVGKGGAFT  142

Query  459  GEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GEISVEQLKDIG  WVILGHSERRHVIGE ++
Sbjct  143  GEISVEQLKDIGATWVILGHSERRHVIGEDNQ  174



>gb|ADG27841.1| triosephosphate isomerase [Gossypium hirsutum]
Length=307

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 132/153 (86%), Gaps = 5/153 (3%)
 Frame = +3

Query  99   FSGL-RPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKC  275
            F+GL R   KLDSS S     SF  +++S LRL +SRK CRAV AMAGSGKFFVGGNWKC
Sbjct  11   FNGLHRSSPKLDSSQS----QSFLQHINSQLRLASSRKPCRAVTAMAGSGKFFVGGNWKC  66

Query  276  NGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAF  455
            NGTK+SITKLVSDLNSAKLE+DVDVVV+PPF+Y+DQV ASLT +IE+SAQN WI KGGAF
Sbjct  67   NGTKDSITKLVSDLNSAKLETDVDVVVSPPFVYLDQVTASLTSRIEVSAQNSWIGKGGAF  126

Query  456  TGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TGEISVEQLKDIGCKWVILGHSERRH+IGE D+
Sbjct  127  TGEISVEQLKDIGCKWVILGHSERRHIIGEDDQ  159



>gb|KJB77731.1| hypothetical protein B456_012G153600 [Gossypium raimondii]
Length=307

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 132/153 (86%), Gaps = 5/153 (3%)
 Frame = +3

Query  99   FSGLRPVS-KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKC  275
            F+GLR  S KLDSS S     SF  +++S LRL +SRK CRAV AMAGSGKFFVGGNWKC
Sbjct  11   FNGLRRSSPKLDSSQS----QSFLQHINSQLRLASSRKPCRAVTAMAGSGKFFVGGNWKC  66

Query  276  NGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAF  455
            NGTK+SITKLVSDLNS KLE+DVDVVV+PPF+Y+DQV ASLT +IE+SAQN WI KGGAF
Sbjct  67   NGTKDSITKLVSDLNSTKLETDVDVVVSPPFVYLDQVTASLTGRIEVSAQNSWIGKGGAF  126

Query  456  TGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TGEISVEQLKDIGCKWVILGHSERRH+IGE D+
Sbjct  127  TGEISVEQLKDIGCKWVILGHSERRHIIGEDDQ  159



>sp|P48496.1|TPIC_SPIOL RecName: Full=Triosephosphate isomerase, chloroplastic; Short=TIM; 
Short=Triose-phosphate isomerase; Flags: Precursor [Spinacia 
oleracea]
 gb|AAA66289.1| triosephosphate isomerase, chloroplast isozyme [Spinacia oleracea]
Length=322

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = +3

Query  54   LSTDLTLSEMAVAAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKAC-RAVVA  230
            L++ +T    AV+ QFSGLR  S L    S+ST  SFF N+ SHLRL +S + C R VVA
Sbjct  8    LASQITNPNSAVSTQFSGLRR-SFLKLENSVSTQSSFFQNVDSHLRLSSSSRRCPRGVVA  66

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAGSGKFFVGGNWKCNGTKESITKLVSDLNSA LE+DVDVVVAPPF+YIDQVK+SLT ++
Sbjct  67   MAGSGKFFVGGNWKCNGTKESITKLVSDLNSATLEADVDVVVAPPFVYIDQVKSSLTGRV  126

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            EISAQNCWI KGGAFTGEISVEQLKD+GC+WVILGHSERRHVIGE +E
Sbjct  127  EISAQNCWIGKGGAFTGEISVEQLKDLGCQWVILGHSERRHVIGEQNE  174



>ref|XP_008457647.1| PREDICTED: triosephosphate isomerase, chloroplastic [Cucumis 
melo]
Length=306

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  162  FFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESD  341
             FHN+HS +RL +SRK  R VVAMAGSGKFFVGGNWKCNGTKESI KLVSDLN+AKLE D
Sbjct  28   LFHNVHSQIRLASSRKVSRGVVAMAGSGKFFVGGNWKCNGTKESIAKLVSDLNNAKLEDD  87

Query  342  VDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHS  521
            VDVVVAPPF+YI+QVK+SLT +IEISAQN W+SKGGAFTGEISVEQLKDIGCKWVILGHS
Sbjct  88   VDVVVAPPFVYIEQVKSSLTSRIEISAQNSWVSKGGAFTGEISVEQLKDIGCKWVILGHS  147

Query  522  ERRHVIGETDE  554
            ERRHVIGE D+
Sbjct  148  ERRHVIGEDDQ  158



>gb|KHN48239.1| Triosephosphate isomerase, chloroplastic [Glycine soja]
Length=305

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +3

Query  126  LDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKL  305
            L+S P  S++ SFF N+HS L  P+S K  R VVAMAGSGKFFVGGNWKCNGTK+SI+KL
Sbjct  16   LNSQP-FSSSLSFFRNVHSALSFPSSSKPSRGVVAMAGSGKFFVGGNWKCNGTKDSISKL  74

Query  306  VSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLK  485
            VSDLN A LE DVDVVVAPPF+YIDQVK S+TD+IEISAQN W+ KGGAFTGEISVEQLK
Sbjct  75   VSDLNRATLEPDVDVVVAPPFVYIDQVKNSITDRIEISAQNSWVGKGGAFTGEISVEQLK  134

Query  486  DIGCKWVILGHSERRHVIGETDE  554
            D+GCKWVILGHSERRHVIGE DE
Sbjct  135  DLGCKWVILGHSERRHVIGENDE  157



>ref|XP_003542557.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Glycine 
max]
Length=305

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +3

Query  126  LDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKL  305
            L+  P  S++ SFF N+HS L  P+S K  R VVAMAGSGKFFVGGNWKCNGTK+SI+KL
Sbjct  16   LNPQP-FSSSLSFFRNVHSTLSFPSSSKPSRGVVAMAGSGKFFVGGNWKCNGTKDSISKL  74

Query  306  VSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLK  485
            VSDLNSA LE DVDVVVAPPF+YIDQVK S+TD+IEISAQN W+ KGGAFTGEISVEQLK
Sbjct  75   VSDLNSATLEPDVDVVVAPPFVYIDQVKNSITDRIEISAQNSWVGKGGAFTGEISVEQLK  134

Query  486  DIGCKWVILGHSERRHVIGETDE  554
            D+GCKWVILGHSERRHVIGE DE
Sbjct  135  DLGCKWVILGHSERRHVIGENDE  157



>ref|XP_002529248.1| triosephosphate isomerase, putative [Ricinus communis]
 gb|EEF33126.1| triosephosphate isomerase, putative [Ricinus communis]
Length=313

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 131/159 (82%), Gaps = 10/159 (6%)
 Frame = +3

Query  93   AQFSGLRPVSKLDSSPSLSTTHS----FFHNLHSHLR-LPTSRKACRAVVAMAGSGKFFV  257
            +QFSGLR      S P L  THS    F  + +S LR + +SRK  R VVAMAG+G FFV
Sbjct  12   SQFSGLR-----QSCPKLLETHSLSQSFLRHFNSQLRSISSSRKPSRHVVAMAGTGTFFV  66

Query  258  GGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWI  437
            GGNWKCNGTKESI+KLVSDLN AKLE+DVDVVVAPPF+YIDQVK+SLTD+IEISAQN W+
Sbjct  67   GGNWKCNGTKESISKLVSDLNDAKLEADVDVVVAPPFIYIDQVKSSLTDRIEISAQNSWV  126

Query  438  SKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            SKGGAFTGEISVEQL DIGCKWVILGHSERRHVIGE DE
Sbjct  127  SKGGAFTGEISVEQLNDIGCKWVILGHSERRHVIGENDE  165



>ref|XP_011037267.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Populus 
euphratica]
Length=313

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 138/170 (81%), Gaps = 11/170 (6%)
 Frame = +3

Query  54   LSTDLTLSEMAV---AAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAV  224
            LST L+  + A    A +FSGLR   +L  + + + +HS      S LR  + RK  R V
Sbjct  4    LSTSLSGPKSATSYCAPEFSGLR---RLCPNNNTNNSHS-----QSFLRFSSPRKPLRGV  55

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD  404
            +AMAG+G+FFVGGNWKCNGTKESITKL+SDLNSAKLESDVDVVVAPPF+YIDQVK+SLTD
Sbjct  56   LAMAGTGQFFVGGNWKCNGTKESITKLISDLNSAKLESDVDVVVAPPFIYIDQVKSSLTD  115

Query  405  QIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IEISAQN W+SKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGE D+
Sbjct  116  RIEISAQNSWVSKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEDDQ  165



>ref|XP_004147017.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004158393.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN61895.1| hypothetical protein Csa_2G263900 [Cucumis sativus]
Length=306

 Score =   234 bits (598),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  162  FFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESD  341
             FHN+HS +RL +SRK  R VV MAGSGKFFVGGNWKCNGTKESI KLV+DLN+AKLE D
Sbjct  28   LFHNVHSQIRLASSRKGSRGVVTMAGSGKFFVGGNWKCNGTKESIAKLVADLNNAKLEDD  87

Query  342  VDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHS  521
            VDVVVAPPF+YI+QVK+SLT +IEISAQN W+SKGGAFTGEISVEQLKDIGCKWVILGHS
Sbjct  88   VDVVVAPPFVYIEQVKSSLTSRIEISAQNSWVSKGGAFTGEISVEQLKDIGCKWVILGHS  147

Query  522  ERRHVIGETDE  554
            ERRHVIGE D+
Sbjct  148  ERRHVIGEDDQ  158



>ref|XP_009418696.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=309

 Score =   234 bits (598),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = +3

Query  84   AVAAQFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVG  260
            ++A+QFSGLR  V   +++PS   T  F  ++HS +RLP S +  R VVAMAG+GKFFVG
Sbjct  7    SLASQFSGLRREVLSREAAPS---TALFLRSVHSRIRLPASCRPPRGVVAMAGTGKFFVG  63

Query  261  GNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWIS  440
            GNWKCNGT++SITKLV+DLN AKLE+DVD+VVAPP++YIDQVK SLTD+IEISAQN WI 
Sbjct  64   GNWKCNGTRDSITKLVADLNDAKLETDVDIVVAPPYIYIDQVKQSLTDRIEISAQNSWIG  123

Query  441  KGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            KGGAFTGEIS EQL DIGCKWVILGHSERRHVIGE D+
Sbjct  124  KGGAFTGEISAEQLVDIGCKWVILGHSERRHVIGEDDQ  161



>ref|XP_002274871.1| PREDICTED: triosephosphate isomerase, chloroplastic [Vitis vinifera]
Length=324

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 131/157 (83%), Gaps = 10/157 (6%)
 Frame = +3

Query  90   AAQFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTS-RKACRAVVAMAGSGKFFVGG  263
            A QFSGLR   S LD SP       FF    S+LR+ +S RK CR +VAMAGSGKFFVGG
Sbjct  28   ATQFSGLRRSFSNLDHSP-----QPFFS---SNLRISSSPRKPCRGIVAMAGSGKFFVGG  79

Query  264  NWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISK  443
            NWKCNGTK+SI+KLVSDLNSAKLE+DVDVVVAPPF+Y+DQVK SLTD+IEISAQN W+ K
Sbjct  80   NWKCNGTKDSISKLVSDLNSAKLEADVDVVVAPPFVYLDQVKNSLTDRIEISAQNSWVGK  139

Query  444  GGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GGAFTGEISVEQLKDIGC WVILGHSERRHVIGE D+
Sbjct  140  GGAFTGEISVEQLKDIGCNWVILGHSERRHVIGEDDQ  176



>ref|NP_001241611.1| uncharacterized protein LOC100798459 [Glycine max]
 gb|ACU23273.1| unknown [Glycine max]
Length=304

 Score =   234 bits (597),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +3

Query  126  LDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKL  305
            L+S P  S++ SFF N+HS L  P+S K  R VVAMAGSGKFFVGGNWKCNGTK+SI KL
Sbjct  16   LNSQP-FSSSLSFFRNVHSTLSFPSS-KPSRGVVAMAGSGKFFVGGNWKCNGTKDSIRKL  73

Query  306  VSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLK  485
            VSDLNSA LESDVDVVVAPPF+YIDQVK S+TD+IEISAQN W+ KGGAFTGEISVEQLK
Sbjct  74   VSDLNSATLESDVDVVVAPPFVYIDQVKNSITDRIEISAQNSWVGKGGAFTGEISVEQLK  133

Query  486  DIGCKWVILGHSERRHVIGETDE  554
            D+GCKWVILGHSERRHVIGE DE
Sbjct  134  DLGCKWVILGHSERRHVIGENDE  156



>gb|KEH24057.1| triosephosphate isomerase [Medicago truncatula]
Length=312

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 137/167 (82%), Gaps = 7/167 (4%)
 Frame = +3

Query  66   LTLSEMAVAAQFS-GLR--PVSKLDSSPSLSTTHSFFHNLHSHLRLP-TSRKACRAVVAM  233
            + ++  ++ +Q S GLR  P  KLDS    ++T+ FF  +H +LRL  +S K  R V+AM
Sbjct  1    MAVTSTSLVSQLSIGLRRHPSPKLDS---FTSTNPFFDAIHPNLRLSISSPKPSRTVIAM  57

Query  234  AGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIE  413
            AGSGKFFVGGNWKCNGTK+SI+KL+SDLN+AKLE DVDVVVAPPF+YIDQVK S+TD+IE
Sbjct  58   AGSGKFFVGGNWKCNGTKDSISKLISDLNNAKLEPDVDVVVAPPFVYIDQVKTSITDRIE  117

Query  414  ISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            IS QN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  118  ISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  164



>gb|AFK41708.1| unknown [Medicago truncatula]
Length=312

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 137/167 (82%), Gaps = 7/167 (4%)
 Frame = +3

Query  66   LTLSEMAVAAQFS-GLR--PVSKLDSSPSLSTTHSFFHNLHSHLRLP-TSRKACRAVVAM  233
            + ++  ++ +Q S GLR  P  KLDS    ++T+ FF  +H +LRL  +S K  R V+AM
Sbjct  1    MAVTSTSLVSQLSIGLRRHPSPKLDS---FTSTNPFFDAIHPNLRLSISSPKPSRTVIAM  57

Query  234  AGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIE  413
            AGSGKFFVGGNWKCNGTK+SI+KL+SDLN+AKLE DVDVVVAPPF+YIDQVK S+TD+IE
Sbjct  58   AGSGKFFVGGNWKCNGTKDSISKLISDLNNAKLEPDVDVVVAPPFVYIDQVKTSITDRIE  117

Query  414  ISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            IS QN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  118  ISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  164



>emb|CDY13836.1| BnaA09g43380D [Brassica napus]
Length=320

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 137/169 (81%), Gaps = 3/169 (2%)
 Frame = +3

Query  54   LSTDLTLSEMAVAAQFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRL-PTSRKACRAVV  227
            L+  ++      A  FSGLR    KLD++ S S  HSF + ++S +RL  +S ++ R VV
Sbjct  5    LTAQISCGTQPSAPSFSGLRRTCPKLDAAVSFSH-HSFCNRVNSSIRLLSSSNRSPRGVV  63

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMAGSGKFFVGGNWKCNGTK+SI KLVSDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD+
Sbjct  64   AMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSASLEADVDVVVSPPFVYIDQVKSSLTDR  123

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            IEIS QN W+ KGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGE DE
Sbjct  124  IEISGQNSWVGKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEKDE  172



>ref|XP_008799414.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Phoenix 
dactylifera]
Length=309

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = +3

Query  81   MAVAAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVG  260
            +++A QF GLR   + + +PSLS+   F H   S  RL ++R++ R VVAMAG+GKFFVG
Sbjct  5    LSLAPQFPGLRVERERERAPSLSSAF-FSHRACSQRRLFSTRRSPRGVVAMAGTGKFFVG  63

Query  261  GNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWIS  440
            GNWKCNGTK+SI+KLV+DLN AK+E+DVDVVVAPPF+YIDQVK SLTD IEISAQNCW+ 
Sbjct  64   GNWKCNGTKDSISKLVADLNGAKMENDVDVVVAPPFIYIDQVKNSLTDCIEISAQNCWVG  123

Query  441  KGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            KGGAFTGEIS EQL D+GC+WVILGHSERRH+IGE DE
Sbjct  124  KGGAFTGEISAEQLIDMGCQWVILGHSERRHIIGEDDE  161



>gb|AFK45656.1| unknown [Lotus japonicus]
Length=307

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 137/160 (86%), Gaps = 7/160 (4%)
 Frame = +3

Query  84   AVAAQFS-GLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLP-TSRKACRAVVAMAGSGKFF  254
            ++A+Q S GLR P  KLDS  S ST HS FH   S+LRLP +S K  R+V+AMAGSGKFF
Sbjct  4    SLASQLSVGLRRPSPKLDSLNSQST-HSLFH---SNLRLPISSSKPSRSVIAMAGSGKFF  59

Query  255  VGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCW  434
            VGGNWKCNGTK+SI+KLV+DLNSAKLE DVDVVVAPPF+YIDQVK S+TD+IE+SAQN W
Sbjct  60   VGGNWKCNGTKDSISKLVADLNSAKLEPDVDVVVAPPFVYIDQVKNSITDRIEVSAQNSW  119

Query  435  ISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +SKGGAFTGEISVEQLKD G KWVILGHSERRH+IGE DE
Sbjct  120  VSKGGAFTGEISVEQLKDHGVKWVILGHSERRHIIGEKDE  159



>ref|XP_002306169.2| hypothetical protein POPTR_0004s17530g [Populus trichocarpa]
 gb|ABK95670.1| unknown [Populus trichocarpa]
 gb|EEE86680.2| hypothetical protein POPTR_0004s17530g [Populus trichocarpa]
Length=313

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 136/170 (80%), Gaps = 11/170 (6%)
 Frame = +3

Query  54   LSTDLTLSEMAV---AAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAV  224
            LST L+  + A    A +FSGLR   +L  + + + +HS      S LR  + RK  R V
Sbjct  4    LSTSLSGPKSATSYCAPEFSGLR---RLCPNNNTNNSHS-----QSFLRFSSPRKPLRGV  55

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD  404
             AMAG+G+FFVGGNWKCNGTKESIT L+SDLNSAKLESDVDVVVAPPF+YIDQVK+SLTD
Sbjct  56   FAMAGTGQFFVGGNWKCNGTKESITTLISDLNSAKLESDVDVVVAPPFIYIDQVKSSLTD  115

Query  405  QIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IEISAQN W+SKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGE D+
Sbjct  116  RIEISAQNSWVSKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEDDQ  165



>ref|XP_009392888.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=311

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 127/153 (83%), Gaps = 2/153 (1%)
 Frame = +3

Query  96   QFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKC  275
            Q SGLR   ++ S  S   T  F  ++HS LRLP+ R+  R VVAMAG+GKFFVGGNWKC
Sbjct  13   QVSGLR--REVLSRESAPPTALFLRSVHSRLRLPSIRRPHRGVVAMAGTGKFFVGGNWKC  70

Query  276  NGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAF  455
            NGTK+SITKLV+DLN AKLE+DVD+VVAPP++Y DQVK SLTD+IEISAQNCW+ KGGAF
Sbjct  71   NGTKDSITKLVADLNDAKLENDVDIVVAPPYIYADQVKQSLTDRIEISAQNCWVGKGGAF  130

Query  456  TGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TGEIS EQL DIGCKWVILGHSERRH+IGE D+
Sbjct  131  TGEISAEQLIDIGCKWVILGHSERRHIIGEDDQ  163



>ref|XP_009140258.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Brassica 
rapa]
Length=312

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 130/156 (83%), Gaps = 6/156 (4%)
 Frame = +3

Query  90   AAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRL-PTSRKACRAVVAMAGSGKFFVGGN  266
            A  FSGLR      + P L    SF H ++S +RL  +S+++ R VVAMAGSGKFFVGGN
Sbjct  14   APSFSGLR-----RTCPKLDAAVSFSHRVNSSIRLVSSSQRSPRGVVAMAGSGKFFVGGN  68

Query  267  WKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKG  446
            WKCNGTK++ITKLVSDLN+A LESDVDVVV+PPF+YIDQVK+SLTD+IEIS QN W+ KG
Sbjct  69   WKCNGTKDTITKLVSDLNTATLESDVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKG  128

Query  447  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GAFTGEISVEQLKDIGCKWVILGHSERRHVIGE DE
Sbjct  129  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGEKDE  164



>emb|CDY15911.1| BnaA04g12000D [Brassica napus]
Length=312

 Score =   231 bits (589),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 130/156 (83%), Gaps = 6/156 (4%)
 Frame = +3

Query  90   AAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRL-PTSRKACRAVVAMAGSGKFFVGGN  266
            A  FSGLR      + P L    SF H ++S +RL  +S+++ R VVAMAGSGKFFVGGN
Sbjct  14   APSFSGLR-----RTCPKLDAAVSFSHRVNSSVRLVSSSQRSPRGVVAMAGSGKFFVGGN  68

Query  267  WKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKG  446
            WKCNGTK++ITKLVSDLN+A LESDVDVVV+PPF+YIDQVK+SLTD+IEIS QN W+ KG
Sbjct  69   WKCNGTKDTITKLVSDLNTATLESDVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKG  128

Query  447  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GAFTGEISVEQLKDIGCKWVILGHSERRHVIGE DE
Sbjct  129  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGEKDE  164



>gb|KJB15723.1| hypothetical protein B456_002G192900 [Gossypium raimondii]
Length=317

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 132/164 (80%), Gaps = 17/164 (10%)
 Frame = +3

Query  99   FSGLRPVSKLDSSPSL--STTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            FSGLR      SSP+L  + + SF  +  S LRLP+S K CRAV+AM+GSGKFFVGGNWK
Sbjct  11   FSGLR-----RSSPNLHNAPSQSFLQHFGSQLRLPSSPKPCRAVIAMSGSGKFFVGGNWK  65

Query  273  CNGTKESITKLVSDLNSAKLESDVD----------VVVAPPFLYIDQVKASLTDQIEISA  422
            CNGTK+SITKLVSDLNSAKLESDV           VVVAPPF+Y+DQV +SLTD+IE+SA
Sbjct  66   CNGTKDSITKLVSDLNSAKLESDVGILQPLFFNPYVVVAPPFVYLDQVTSSLTDRIEVSA  125

Query  423  QNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            QN WI KGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGE D+
Sbjct  126  QNSWIGKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEDDQ  169



>ref|XP_010028689.1| PREDICTED: triosephosphate isomerase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW55475.1| hypothetical protein EUGRSUZ_I01374 [Eucalyptus grandis]
Length=314

 Score =   229 bits (585),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 133/166 (80%), Gaps = 3/166 (2%)
 Frame = +3

Query  66   LTLSEMAVAAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTS---RKACRAVVAMA  236
            + +   ++ + FSGLR  S LD S SLS   SF  +++S +   ++   +K CR VVAMA
Sbjct  1    MAVVSTSLTSHFSGLRRSSNLDRSLSLSPAQSFSEHVNSRICFSSASSNQKPCRGVVAMA  60

Query  237  GSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEI  416
            G+GKFFVGGNWKCNGTK+SI+KLVSDLNSA LE DVDVVVAPPF+YIDQVK SLT +IEI
Sbjct  61   GTGKFFVGGNWKCNGTKDSISKLVSDLNSATLEPDVDVVVAPPFVYIDQVKNSLTPRIEI  120

Query  417  SAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            ++QN W  KGGAFTGEISVEQLKDIGCKWV+LGHSERRHVIGE D+
Sbjct  121  ASQNSWTGKGGAFTGEISVEQLKDIGCKWVVLGHSERRHVIGEDDQ  166



>ref|XP_009117434.1| PREDICTED: triosephosphate isomerase, chloroplastic [Brassica 
rapa]
Length=320

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 135/169 (80%), Gaps = 3/169 (2%)
 Frame = +3

Query  54   LSTDLTLSEMAVAAQFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRL-PTSRKACRAVV  227
            L+  ++      A  FSGLR    KLD++ S S    F + ++S +RL  +S ++ R VV
Sbjct  5    LTAQISCGTQPSAPSFSGLRRTCPKLDAAVSFSH-QPFCNRVNSSIRLVSSSNRSPRGVV  63

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMAGSGKFFVGGNWKCNGTK+SI KLVSDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD+
Sbjct  64   AMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSASLEADVDVVVSPPFVYIDQVKSSLTDR  123

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            IEIS QN W+ KGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGE DE
Sbjct  124  IEISGQNSWVGKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEKDE  172



>emb|CDX82002.1| BnaC08g35990D [Brassica napus]
Length=320

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 135/169 (80%), Gaps = 3/169 (2%)
 Frame = +3

Query  54   LSTDLTLSEMAVAAQFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRL-PTSRKACRAVV  227
            L+  ++      A  FSGLR    KLD++ S S   SF + ++S +RL  +S ++ R VV
Sbjct  5    LTAQISCGTQPSAPSFSGLRRTCPKLDAAISFSH-QSFCNRVNSSIRLVSSSNRSPRGVV  63

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMAGSGKFFVGGNWKCNGTK+SI KLVSDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD 
Sbjct  64   AMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSASLEADVDVVVSPPFVYIDQVKSSLTDL  123

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            IEIS QN W+ KGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGE DE
Sbjct  124  IEISGQNSWVGKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEKDE  172



>ref|XP_004289838.1| PREDICTED: triosephosphate isomerase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=318

 Score =   229 bits (584),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 129/153 (84%), Gaps = 5/153 (3%)
 Frame = +3

Query  99   FSGLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKC  275
            +SGLRP   KLD S  LS THS      S     +SRKA RAVVAMAG+GKFFVGGNWKC
Sbjct  22   YSGLRPSCPKLDQS--LSQTHSSLFQHLSLSS--SSRKASRAVVAMAGTGKFFVGGNWKC  77

Query  276  NGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAF  455
            NGTK+SI+KLVSDLNSAKLE DVDVVVAPPFLY+DQVK+SLTD+IEIS QN W+ KGGAF
Sbjct  78   NGTKDSISKLVSDLNSAKLEPDVDVVVAPPFLYLDQVKSSLTDRIEISGQNSWVGKGGAF  137

Query  456  TGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TGEISVEQLKDIGCKWVILGHSERRHVIGE D+
Sbjct  138  TGEISVEQLKDIGCKWVILGHSERRHVIGEDDQ  170



>ref|XP_010555242.1| PREDICTED: triosephosphate isomerase, chloroplastic [Tarenaya 
hassleriana]
Length=343

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 140/176 (80%), Gaps = 11/176 (6%)
 Frame = +3

Query  33   PLKPYLHLSTDLTLSEMAVAAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTS--R  206
            PL P + + +    ++++    FSGLR   + D+        SF H+ +S LRL +S  R
Sbjct  29   PLSPAMAVVSPSFSAQISGGTTFSGLR---RSDA------VVSFVHHSNSSLRLVSSPCR  79

Query  207  KACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQV  386
            +  R VVAMAG+GKFFVGGNWKCNGTK+SITKLVSDLN+AKLE++VDVVVAPPF+YIDQV
Sbjct  80   QPPRGVVAMAGTGKFFVGGNWKCNGTKDSITKLVSDLNNAKLETNVDVVVAPPFVYIDQV  139

Query  387  KASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            K+SLTD+IEISAQN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  140  KSSLTDRIEISAQNSWVGKGGAFTGEISVEQLKDMGCKWVILGHSERRHVIGENDE  195



>gb|KFK41726.1| hypothetical protein AALP_AA2G164900 [Arabis alpina]
Length=315

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 129/156 (83%), Gaps = 6/156 (4%)
 Frame = +3

Query  90   AAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRL-PTSRKACRAVVAMAGSGKFFVGGN  266
            A  FSGLR +      P+L    SF H ++S  RL  +SR++ R VVAMAGSGKFFVGGN
Sbjct  17   APSFSGLRRIC-----PNLDAAVSFSHRVYSSTRLVSSSRRSPRGVVAMAGSGKFFVGGN  71

Query  267  WKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKG  446
            WKCNGTK+SI KL+SDLN+A LE+DVDVVV+PPF+YIDQVK+SLTD+IEIS QN W+ KG
Sbjct  72   WKCNGTKDSIAKLISDLNAATLEADVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKG  131

Query  447  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GAFTGEISVEQLKD+GCKWVILGHSERRHVIGE +E
Sbjct  132  GAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKNE  167



>ref|XP_004494086.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Cicer 
arietinum]
Length=314

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 138/167 (83%), Gaps = 5/167 (3%)
 Frame = +3

Query  66   LTLSEMAVAAQFS-GLRPVS-KLDS--SPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAM  233
            + ++  ++A+Q S GLR  S K DS  S SL  T++ F + +  L L +S K  R V+AM
Sbjct  1    MAVTSTSLASQLSIGLRRSSPKFDSFTSQSLPLTNNTFFDPNLRLSL-SSTKPSRTVIAM  59

Query  234  AGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIE  413
            AGSGKFFVGGNWKCNGTK+SI+KL+SDLNSAKLE DVDVVVAPPF+YIDQVK+S+TD+IE
Sbjct  60   AGSGKFFVGGNWKCNGTKDSISKLLSDLNSAKLEPDVDVVVAPPFVYIDQVKSSITDRIE  119

Query  414  ISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            ISAQN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  120  ISAQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  166



>ref|XP_009346630.1| PREDICTED: triosephosphate isomerase, chloroplastic [Pyrus x 
bretschneideri]
Length=322

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +3

Query  99   FSGLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLPTSR-KACRAVVAMAGSGKFFVGGNWK  272
            +SGLRP  SKL+SS SLS T S F +LHSHLRL +S  KA R VVAMAG+GKFFVGGNWK
Sbjct  21   YSGLRPSCSKLESSHSLSATQSLFQHLHSHLRLSSSSRKASRGVVAMAGTGKFFVGGNWK  80

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SI+KLV+DLNSAKLE DVDVVVAPPFLY+DQVK+SLTD+IE+S QN W+ KGGA
Sbjct  81   CNGTKDSISKLVADLNSAKLEPDVDVVVAPPFLYLDQVKSSLTDRIELSGQNSWVGKGGA  140

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKDIG  WVILGHSERRHVIGE D+
Sbjct  141  FTGEISVEQLKDIGATWVILGHSERRHVIGEDDQ  174



>ref|XP_007162792.1| hypothetical protein PHAVU_001G181000g [Phaseolus vulgaris]
 gb|ESW34786.1| hypothetical protein PHAVU_001G181000g [Phaseolus vulgaris]
Length=309

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 136/167 (81%), Gaps = 10/167 (6%)
 Frame = +3

Query  66   LTLSEMAVAAQ-FSGLR-PVSKLDS--SPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAM  233
            +  +  ++A+Q + GLR P  KLDS  SPS S   +F  N+   L  P   K  R+VVAM
Sbjct  1    MAATSTSLASQLYIGLRRPCPKLDSFNSPSFS---AFGPNIRLSLSPP---KPSRSVVAM  54

Query  234  AGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIE  413
            AGSGKFFVGGNWKCNGTK+SI+KLV+DLNSAKLE DVDVVVAPPFLYIDQVK+SLTD+IE
Sbjct  55   AGSGKFFVGGNWKCNGTKDSISKLVADLNSAKLEPDVDVVVAPPFLYIDQVKSSLTDRIE  114

Query  414  ISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            ISAQN W+ KGGAFTGEISVEQLKD+GCKWV+LGHSERRH+IGE DE
Sbjct  115  ISAQNSWVGKGGAFTGEISVEQLKDLGCKWVVLGHSERRHIIGEKDE  161



>gb|KHN39016.1| Triosephosphate isomerase, chloroplastic [Glycine soja]
Length=303

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +3

Query  126  LDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKL  305
            L+S P  S+    F N+HS L  P+S K  R VVAMAGSGKFFVGGNWKCNGTK+SI KL
Sbjct  16   LNSQPFSSSLS--FRNVHSTLSFPSS-KPSRGVVAMAGSGKFFVGGNWKCNGTKDSIRKL  72

Query  306  VSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLK  485
            VSDLNSA LESDVDVVVAPPF+YIDQVK S+TD+IEISAQN W+ KGGAFTGEISVEQLK
Sbjct  73   VSDLNSATLESDVDVVVAPPFVYIDQVKNSITDRIEISAQNSWVGKGGAFTGEISVEQLK  132

Query  486  DIGCKWVILGHSERRHVIGETDE  554
            D+GCKWVILGHSERRHVIGE DE
Sbjct  133  DLGCKWVILGHSERRHVIGENDE  155



>emb|CDX99612.1| BnaC04g33690D [Brassica napus]
Length=312

 Score =   227 bits (578),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 128/156 (82%), Gaps = 6/156 (4%)
 Frame = +3

Query  90   AAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRL-PTSRKACRAVVAMAGSGKFFVGGN  266
            A  FSGLR      +   L    SF H ++S +RL  +S+++ R VVAMAGSGKFFVGGN
Sbjct  14   APSFSGLR-----RTCLKLEAAVSFSHRVNSSIRLVSSSQRSPRGVVAMAGSGKFFVGGN  68

Query  267  WKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKG  446
            WKCNGTK+SITKLVSDLN+A LE DVDVVV+PPF+YIDQVK+SLTD+IEIS QN W+ KG
Sbjct  69   WKCNGTKDSITKLVSDLNTATLEPDVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKG  128

Query  447  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GAFTGEISVEQLKDIGCKWVILGHSERRHVIGE DE
Sbjct  129  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGEKDE  164



>ref|XP_008788636.1| PREDICTED: triosephosphate isomerase, chloroplastic [Phoenix 
dactylifera]
Length=307

 Score =   226 bits (576),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 128/153 (84%), Gaps = 3/153 (2%)
 Frame = +3

Query  96   QFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKC  275
            QF GL   S  + +PSLS+T  FFH + S  R  ++R+A R VVAMAG+GKFFVGGNWKC
Sbjct  10   QFLGLGVAS--ERAPSLSSTL-FFHRVGSQRRFFSTRRAPRGVVAMAGTGKFFVGGNWKC  66

Query  276  NGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAF  455
            NGTK+S++KLV+DLN AK+E++VDVVVAPPF+YIDQV  SLTD I+ISAQNCW+ KGGAF
Sbjct  67   NGTKDSVSKLVADLNDAKMENNVDVVVAPPFIYIDQVNNSLTDHIDISAQNCWVGKGGAF  126

Query  456  TGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TGEIS EQL D+GCKWVILGHSERRH+IGE D+
Sbjct  127  TGEISAEQLIDMGCKWVILGHSERRHIIGEDDQ  159



>ref|XP_010416860.1| PREDICTED: triosephosphate isomerase, chloroplastic [Camelina 
sativa]
Length=312

 Score =   226 bits (576),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 131/155 (85%), Gaps = 4/155 (3%)
 Frame = +3

Query  99   FSGLRPVS-KLDSSPSLSTTHSFFH--NLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNW  269
            FSGLR +S KLDS+ ++S+  SF H  N    L   +S ++ R VVAMAGSGKFFVGGNW
Sbjct  11   FSGLRRISPKLDSA-AVSSNQSFVHRVNSSIRLVSSSSHRSPRGVVAMAGSGKFFVGGNW  69

Query  270  KCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGG  449
            KCNGTK+SI KLVSDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD+IEIS QN W+ KGG
Sbjct  70   KCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWVGKGG  129

Query  450  AFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  130  AFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  164



>ref|XP_006423593.1| hypothetical protein CICLE_v10028924mg [Citrus clementina]
 gb|ESR36833.1| hypothetical protein CICLE_v10028924mg [Citrus clementina]
Length=304

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 127/156 (81%), Gaps = 11/156 (7%)
 Frame = +3

Query  93   AQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRL--PTSRKACRAVVAMAGSGKFFVGGN  266
            AQFSGLR      SSP    T SF  +++SHLRL      +   +VVAMA S KFFVGGN
Sbjct  10   AQFSGLRR-----SSP----TQSFSQHVNSHLRLFSSRRPRRGSSVVAMASSNKFFVGGN  60

Query  267  WKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKG  446
            WKCNGTKESITKLVSDLN AKLE+DVDVVVAPPF+YIDQVK SLTD+IEI+AQN W+ KG
Sbjct  61   WKCNGTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKNSLTDRIEIAAQNSWVGKG  120

Query  447  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GAFTGEISVEQLKDIGCKWV+LGHSERRHVIGE D+
Sbjct  121  GAFTGEISVEQLKDIGCKWVVLGHSERRHVIGEDDQ  156



>ref|XP_002312980.1| triosephosphate isomerase family protein [Populus trichocarpa]
 gb|EEE86935.1| triosephosphate isomerase family protein [Populus trichocarpa]
Length=315

 Score =   224 bits (570),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 9/170 (5%)
 Frame = +3

Query  54   LSTDLTLSEMAV---AAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAV  224
            LST L+  + A    A +FSGLR +    ++ + ++    F      LR  + RK  ++V
Sbjct  4    LSTSLSGPKSATSYCAPEFSGLRRLCPNSNNNNSNSHSQSF------LRFCSPRKPLKSV  57

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD  404
            VAMAG+G FFVGGNWKCNGTKESITKLVSDLNS KLESDVDVVVAPPF+YIDQVK+SLTD
Sbjct  58   VAMAGTGTFFVGGNWKCNGTKESITKLVSDLNSTKLESDVDVVVAPPFVYIDQVKSSLTD  117

Query  405  QIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IEI+AQN W+SKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGE ++
Sbjct  118  RIEIAAQNSWVSKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGEDNQ  167



>ref|XP_010935053.1| PREDICTED: triosephosphate isomerase, chloroplastic [Elaeis guineensis]
Length=307

 Score =   223 bits (569),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = +3

Query  96   QFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKC  275
            QFSGL  V++ + +PSLS+   FFH+  S  R  ++R+A R VVAMAG+GKFFVGGNWKC
Sbjct  10   QFSGL-AVAR-ERAPSLSSIL-FFHDASSQRRPFSTRRAPRGVVAMAGTGKFFVGGNWKC  66

Query  276  NGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAF  455
            NG K+SI+KLV+DLN AK+E+DVDV VAPPF+YIDQV  SLTD+I+ISAQNCW+ KGGAF
Sbjct  67   NGMKDSISKLVADLNDAKMENDVDVAVAPPFIYIDQVNNSLTDRIDISAQNCWVGKGGAF  126

Query  456  TGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TGEIS EQL D+GCKWVILGHSERRH+IGE D+
Sbjct  127  TGEISAEQLIDMGCKWVILGHSERRHIIGEDDQ  159



>gb|ACU23262.1| unknown [Glycine max]
Length=309

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 133/166 (80%), Gaps = 8/166 (5%)
 Frame = +3

Query  66   LTLSEMAVAAQ-FSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSR-KACRAVVAMA  236
            +  +  ++A+Q + GLR P  KLDS  S S     F     +LRLP S  +  RA+VAMA
Sbjct  1    MAATSTSLASQLYIGLRRPCLKLDSFNSRS-----FSVFDPNLRLPLSPPRPSRAIVAMA  55

Query  237  GSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEI  416
            G+GKFFVGGNWKCNGTK+SI+KLV+DLNSAKLE DVDVVVAPPFLYIDQVK SLT++IEI
Sbjct  56   GTGKFFVGGNWKCNGTKDSISKLVADLNSAKLEPDVDVVVAPPFLYIDQVKNSLTERIEI  115

Query  417  SAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            SAQN W+ KGGAFTGEIS EQLKD+GCKWV+LGHSERRH+IGE DE
Sbjct  116  SAQNSWVGKGGAFTGEISAEQLKDLGCKWVVLGHSERRHIIGENDE  161



>gb|EPS59362.1| triosephosphate isomerase [Genlisea aurea]
Length=314

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 127/158 (80%), Gaps = 6/158 (4%)
 Frame = +3

Query  87   VAAQFSGLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGG  263
            VA QFSGLR    KLD+S S     S F  + SH+RL ++ K CRAV  M GSGKFFVGG
Sbjct  13   VAVQFSGLRKSFPKLDNSSS----RSLFLKVESHVRLASTSKGCRAVATMLGSGKFFVGG  68

Query  264  NWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD-QIEISAQNCWIS  440
            NWKCNG+KESI KLVS+LN+A LE+DVDVVVAPPF+YIDQVK SL + +I+I+AQNCW  
Sbjct  69   NWKCNGSKESIGKLVSELNNATLEADVDVVVAPPFVYIDQVKNSLVNSRIQIAAQNCWTG  128

Query  441  KGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            KGGAFTGEISVEQ+KDIG  WV+LGHSERRH+IGE D+
Sbjct  129  KGGAFTGEISVEQIKDIGAGWVVLGHSERRHIIGEDDQ  166



>gb|ABR16682.1| unknown [Picea sitchensis]
 gb|ACN40828.1| unknown [Picea sitchensis]
Length=328

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 132/163 (81%), Gaps = 5/163 (3%)
 Frame = +3

Query  66   LTLSEMAVAAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSG  245
            +T +  +V ++F+GLR   ++DS   + ++H  F  +  +++   +   CR VV MAG+G
Sbjct  23   VTNASSSVRSEFAGLR---RMDSMFDMGSSHCLFAQMQRNVQAVGN--GCRGVVTMAGTG  77

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQ  425
            KFFVGGNWKCNGTK+SI+KLV++LNSAKLE DVD+VVAPPF+YIDQVK+SLTD+IEISAQ
Sbjct  78   KFFVGGNWKCNGTKDSISKLVTELNSAKLEDDVDIVVAPPFVYIDQVKSSLTDRIEISAQ  137

Query  426  NCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            N W+ KGGAFTGEISVEQLKDIGCKWVI GHSERRHVIGE  +
Sbjct  138  NAWVGKGGAFTGEISVEQLKDIGCKWVIHGHSERRHVIGEDSQ  180



>ref|XP_008236196.1| PREDICTED: triosephosphate isomerase, chloroplastic [Prunus mume]
Length=318

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 130/154 (84%), Gaps = 6/154 (4%)
 Frame = +3

Query  99   FSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSR-KACRAVVAMAGSGKFFVGGNWK  272
            +SGLR   SKLD + SLS     F +LHS LRL +S  KA R +VAMAG+GKFFVGGNWK
Sbjct  21   YSGLRRSCSKLDHTQSLS----LFQHLHSQLRLSSSSRKASRGIVAMAGTGKFFVGGNWK  76

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SI+KLVSDLNSAKLE+DVDVVVAPPFLYIDQVK SLTD+IEIS QN W+ KGGA
Sbjct  77   CNGTKDSISKLVSDLNSAKLEADVDVVVAPPFLYIDQVKNSLTDRIEISGQNSWVGKGGA  136

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKDIG  WVILGHSERRHVIGE D+
Sbjct  137  FTGEISVEQLKDIGATWVILGHSERRHVIGEDDQ  170



>ref|XP_010429012.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Camelina 
sativa]
Length=316

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 8/159 (5%)
 Frame = +3

Query  99   FSGLRPVS-KLDSSPSLSTTHSFFHNLHSHLRL------PTSRKACRAVVAMAGSGKFFV  257
            FSGL  +S KLDS+ ++S+  SF H ++S +RL       +S ++ R VVAMAGSGKFFV
Sbjct  11   FSGLCRISPKLDSA-AVSSHQSFVHRVNSSIRLVSSPSSSSSHRSPRGVVAMAGSGKFFV  69

Query  258  GGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWI  437
            GGNWKCNGTK+SI KLVSDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD+IE+S QN W+
Sbjct  70   GGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRIEVSGQNSWV  129

Query  438  SKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  130  GKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  168



>ref|XP_011046787.1| PREDICTED: triosephosphate isomerase, chloroplastic [Populus 
euphratica]
Length=317

 Score =   221 bits (564),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 137/173 (79%), Gaps = 13/173 (8%)
 Frame = +3

Query  54   LSTDLTLSEMAV---AAQFSGLR---PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKAC  215
            LST L+  + A    A +FSGLR   P S   ++ S S + SF       LR  + RK  
Sbjct  4    LSTSLSGPKSATSYCAPEFSGLRRLCPNSSSSNNSSNSHSQSF-------LRFCSPRKPL  56

Query  216  RAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKAS  395
            ++VVAMAG+G FFVGGNWKCNGTKESITKLVSDLNS KLESDVDVVVAPPF+YIDQVK+S
Sbjct  57   KSVVAMAGTGTFFVGGNWKCNGTKESITKLVSDLNSTKLESDVDVVVAPPFVYIDQVKSS  116

Query  396  LTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            LTD+IEI+AQN W+SKGGAFTGEISVEQLKDIGCKWVILGHSERRH+IGE ++
Sbjct  117  LTDRIEIAAQNSWVSKGGAFTGEISVEQLKDIGCKWVILGHSERRHIIGEDNQ  169



>ref|XP_007201375.1| hypothetical protein PRUPE_ppa007813mg [Prunus persica]
 gb|EMJ02574.1| hypothetical protein PRUPE_ppa007813mg [Prunus persica]
Length=354

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 130/154 (84%), Gaps = 6/154 (4%)
 Frame = +3

Query  99   FSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSR-KACRAVVAMAGSGKFFVGGNWK  272
            +SGLR   SKLD + SLS     F +LHS LRL +S  KA R +VAMAG+GKFFVGGNWK
Sbjct  57   YSGLRRSCSKLDHTQSLS----LFQHLHSQLRLSSSSRKASRGIVAMAGTGKFFVGGNWK  112

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
            CNGTK+SI+KLVSDLNSAKLE+DVDV+VAPPFLYIDQVK SLTD+IEIS QN W+ KGGA
Sbjct  113  CNGTKDSISKLVSDLNSAKLEADVDVIVAPPFLYIDQVKNSLTDRIEISGQNSWVGKGGA  172

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKDIG  WVILGHSERRHVIGE D+
Sbjct  173  FTGEISVEQLKDIGATWVILGHSERRHVIGEDDQ  206



>gb|ABK24413.1| unknown [Picea sitchensis]
 gb|ACN40974.1| unknown [Picea sitchensis]
Length=328

 Score =   221 bits (564),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 129/157 (82%), Gaps = 5/157 (3%)
 Frame = +3

Query  84   AVAAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGG  263
            +V ++F+GLR   ++DS   + ++H  F  +  +++   +   CR VV MAG+GKFFVGG
Sbjct  29   SVRSEFAGLR---RMDSMFDMGSSHCLFAQMQRNVQAVGN--GCRGVVTMAGTGKFFVGG  83

Query  264  NWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISK  443
            NWKCNGTK+SI+KLV++LNSAKLE DVD+VVAPPF+YIDQVK+SLTD+IEISAQN W+ K
Sbjct  84   NWKCNGTKDSISKLVTELNSAKLEDDVDIVVAPPFVYIDQVKSSLTDRIEISAQNAWVGK  143

Query  444  GGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GGAFTGEISVEQLKDIGCKWVI GHSERRHVIGE  +
Sbjct  144  GGAFTGEISVEQLKDIGCKWVIHGHSERRHVIGEDSQ  180



>ref|NP_179713.1| triosephosphate isomerase [Arabidopsis thaliana]
 sp|Q9SKP6.1|TPIC_ARATH RecName: Full=Triosephosphate isomerase, chloroplastic; Short=TIM; 
Short=Triose-phosphate isomerase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF70259.1|AF247559_1 triosephosphate isomerase [Arabidopsis thaliana]
 gb|AAK55701.1|AF378898_1 At2g21170/F26H11.7 [Arabidopsis thaliana]
 gb|AAD29799.1| putative triosephosphate isomerase [Arabidopsis thaliana]
 gb|AAK96462.1| At2g21170/F26H11.7 [Arabidopsis thaliana]
 gb|AAM65444.1| putative triosephosphate isomerase [Arabidopsis thaliana]
 gb|AEC07131.1| triosephosphate isomerase [Arabidopsis thaliana]
Length=315

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 136/168 (81%), Gaps = 6/168 (4%)
 Frame = +3

Query  66   LTLSEMAVAAQFSGLRPVS-KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACR----AVVA  230
            +  + +     FSGLR +S KLD++ ++S+  SFFH ++S  RL +S  +       VVA
Sbjct  1    MAATSLTAPPSFSGLRRISPKLDAA-AVSSHQSFFHRVNSSTRLVSSSSSSHRSPRGVVA  59

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAGSGKFFVGGNWKCNGTK+SI KL+SDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD+I
Sbjct  60   MAGSGKFFVGGNWKCNGTKDSIAKLISDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRI  119

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IS QN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  120  DISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  167



>ref|XP_006294633.1| hypothetical protein CARUB_v10023671mg [Capsella rubella]
 gb|EOA27531.1| hypothetical protein CARUB_v10023671mg [Capsella rubella]
Length=315

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 137/171 (80%), Gaps = 13/171 (8%)
 Frame = +3

Query  57   STDLTLSEMAVAAQFSGLRPVS-KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACR----A  221
            ST LT      A  FSGLR +S KLD++  +S+  SF H ++S +RL +S  +       
Sbjct  5    STSLT------APSFSGLRRISPKLDAA--VSSHQSFVHRVNSSIRLVSSSSSSHRSPRG  56

Query  222  VVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLT  401
            VVAMAGSGKFFVGGNWKCNGTK+SI KL+SDLNSA LE+DVDVVVAPPF+YIDQVK+SLT
Sbjct  57   VVAMAGSGKFFVGGNWKCNGTKDSIAKLISDLNSATLEADVDVVVAPPFVYIDQVKSSLT  116

Query  402  DQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            D+IEIS QN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  117  DRIEISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  167



>ref|XP_010941282.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Elaeis 
guineensis]
Length=307

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 129/158 (82%), Gaps = 3/158 (2%)
 Frame = +3

Query  81   MAVAAQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVG  260
            +++A +FSGLR     + +PSLS+   F H      RL ++ +A   VVAMAG+GKFFVG
Sbjct  5    ISLAPRFSGLRLA--CERAPSLSSVL-FLHRACFQRRLFSTPRAPGRVVAMAGTGKFFVG  61

Query  261  GNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWIS  440
            GNWKCNGTK+SI+KLV+DLN  K+ESDVDVVVAPPF+YIDQVK SLTD+IEISAQNCW+ 
Sbjct  62   GNWKCNGTKDSISKLVADLNGGKMESDVDVVVAPPFVYIDQVKNSLTDRIEISAQNCWVG  121

Query  441  KGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            KGGAFTGEIS EQL D+GC+WVILGHSERRH+IGE D+
Sbjct  122  KGGAFTGEISAEQLIDMGCQWVILGHSERRHIIGEADK  159



>ref|XP_006404556.1| hypothetical protein EUTSA_v10000249mg [Eutrema salsugineum]
 gb|ESQ46009.1| hypothetical protein EUTSA_v10000249mg [Eutrema salsugineum]
Length=321

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 133/170 (78%), Gaps = 4/170 (2%)
 Frame = +3

Query  54   LSTDLTLSEMAVAAQFSGLRPV-SKLDSSPSLSTTHSFFH--NLHSHLRLPTSRKACRAV  224
            L+  ++      A  FSGLR +  KLD++ S S   SF +  N    L   +S ++ R V
Sbjct  5    LTAQISGGTQPSAPSFSGLRRICPKLDAAVSFSH-QSFLNRVNSSIRLVSSSSHRSPRGV  63

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD  404
            VAMAGSGKFFVGGNWKCNGTK+SI KLVSDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD
Sbjct  64   VAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLTD  123

Query  405  QIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IEIS QN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  124  RIEISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  173



>ref|NP_001240895.1| uncharacterized protein LOC100799358 [Glycine max]
 gb|ACU17908.1| unknown [Glycine max]
Length=309

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 132/166 (80%), Gaps = 8/166 (5%)
 Frame = +3

Query  66   LTLSEMAVAAQ-FSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSR-KACRAVVAMA  236
            +  +  ++A+Q + GLR P  KLDS  S S     F     +LRL  S  K  RAV+AMA
Sbjct  1    MAATSTSLASQLYIGLRRPCLKLDSFNSQS-----FSLFDPNLRLSLSPPKPSRAVIAMA  55

Query  237  GSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEI  416
            G+GKFFVGGNWKCNGTK+SI+KLV+DLN+AKLE DVDVVVAPPFLYIDQVK SLT++IEI
Sbjct  56   GTGKFFVGGNWKCNGTKDSISKLVADLNNAKLEPDVDVVVAPPFLYIDQVKNSLTERIEI  115

Query  417  SAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            SAQN W+ KGGAFTGEIS EQLKD+GCKWV+LGHSERRHVIGE DE
Sbjct  116  SAQNSWVGKGGAFTGEISAEQLKDLGCKWVVLGHSERRHVIGENDE  161



>ref|XP_003554399.1| PREDICTED: triosephosphate isomerase, chloroplastic [Glycine 
max]
 gb|KHN02301.1| Triosephosphate isomerase, chloroplastic [Glycine soja]
Length=309

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 132/166 (80%), Gaps = 8/166 (5%)
 Frame = +3

Query  66   LTLSEMAVAAQ-FSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSR-KACRAVVAMA  236
            +  +  ++A+Q + GLR P  KLDS  S S     F     +LRL  S  +  RA+VAMA
Sbjct  1    MAATSTSLASQLYIGLRRPCLKLDSFNSQS-----FSVFDPNLRLSLSPPRPSRAIVAMA  55

Query  237  GSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEI  416
            G+GKFFVGGNWKCNGTK+SI+KLV+DLNSAKLE DVDVVVAPPFLYIDQVK SLT++IEI
Sbjct  56   GTGKFFVGGNWKCNGTKDSISKLVADLNSAKLEPDVDVVVAPPFLYIDQVKNSLTERIEI  115

Query  417  SAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            SAQN W+ KGGAFTGEIS EQLKD+GCKWV+LGHSERRH+IGE DE
Sbjct  116  SAQNSWVGKGGAFTGEISAEQLKDLGCKWVVLGHSERRHIIGENDE  161



>ref|XP_002880361.1| hypothetical protein ARALYDRAFT_900526 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56620.1| hypothetical protein ARALYDRAFT_900526 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   219 bits (558),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 134/168 (80%), Gaps = 7/168 (4%)
 Frame = +3

Query  66   LTLSEMAVAAQFSGLRPVS-KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACR----AVVA  230
            +  + +     FSGLR +S KLD++  +S+  SFFH + S  RL +S  +       VVA
Sbjct  1    MAATSLTAPPSFSGLRRISPKLDAA--VSSHQSFFHRVSSSTRLVSSSSSSHRSPRGVVA  58

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAGSGKFFVGGNWKCNGTK+SI KLVSDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD+I
Sbjct  59   MAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRI  118

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IS QN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  119  DISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  166



>gb|KHN18687.1| Triosephosphate isomerase, chloroplastic [Glycine soja]
Length=309

 Score =   219 bits (558),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 132/166 (80%), Gaps = 8/166 (5%)
 Frame = +3

Query  66   LTLSEMAVAAQ-FSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSR-KACRAVVAMA  236
            +  +  ++A+Q + GLR P  KLDS  S S     F     +LRL  S  +  RA+VAMA
Sbjct  1    MAATSTSLASQLYIGLRRPCLKLDSFNSQS-----FSVFDPNLRLSLSPPRPSRAIVAMA  55

Query  237  GSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEI  416
            G+GKFFVGGNWKCNGTK+SI+KLV+DLN+AKLE DVDVVVAPPFLYIDQVK SLT++IEI
Sbjct  56   GTGKFFVGGNWKCNGTKDSISKLVADLNNAKLEPDVDVVVAPPFLYIDQVKNSLTERIEI  115

Query  417  SAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            SAQN W+ KGGAFTGEIS EQLKD+GCKWV+LGHSERRHVIGE DE
Sbjct  116  SAQNSWVGKGGAFTGEISAEQLKDLGCKWVVLGHSERRHVIGENDE  161



>sp|Q9M4S8.1|TPIC_FRAAN RecName: Full=Triosephosphate isomerase, chloroplastic; Short=TIM; 
Short=Triose-phosphate isomerase; Flags: Precursor [Fragaria 
x ananassa]
 gb|AAF66071.1|AF257322_1 triosephosphate isomerase [Fragaria x ananassa]
Length=314

 Score =   219 bits (557),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 133/168 (79%), Gaps = 7/168 (4%)
 Frame = +3

Query  66   LTLSEMAVAAQFSGLR----PVSKLDSS-PSLSTTHSFFHNLHSHLRLPTSRKACRAVVA  230
            + ++  ++A+Q SG +    P S L  S P L  +HS      S     +SRKA RAVVA
Sbjct  1    MAVASTSLASQLSGPKSLSQPYSGLRRSCPKLDQSHSSLFQHLSLSS--SSRKASRAVVA  58

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAG+GKFFVGGNWKCNGTK+ I+KLVSDLNSAKLE DVDVVVAPPFLY+DQVK+SLTD+I
Sbjct  59   MAGTGKFFVGGNWKCNGTKDLISKLVSDLNSAKLEPDVDVVVAPPFLYLDQVKSSLTDRI  118

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            EIS QN W++KGGAFTGEISVEQLKDIG KWVILGHSERRHVIGE D+
Sbjct  119  EISGQNSWVAKGGAFTGEISVEQLKDIGRKWVILGHSERRHVIGEDDQ  166



>ref|XP_009337933.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009337934.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=322

 Score =   218 bits (556),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 130/152 (86%), Gaps = 2/152 (1%)
 Frame = +3

Query  105  GLRP-VSKLDSSPSLSTTHSFFHNLHSHLRLPTSR-KACRAVVAMAGSGKFFVGGNWKCN  278
            GLRP   KL+ S S S T S F +LHSHLRL +S  KA R VVAMAG+GKFFVGGNWKCN
Sbjct  23   GLRPSCCKLEFSHSFSATQSLFQHLHSHLRLSSSSRKASRGVVAMAGTGKFFVGGNWKCN  82

Query  279  GTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFT  458
            GTK+SI KLV+DLNSAKLE+DVDVVVAPPFLY+DQVK+SLTD+IE+S QN W+ KGGAFT
Sbjct  83   GTKDSIRKLVADLNSAKLEADVDVVVAPPFLYLDQVKSSLTDRIELSGQNSWVGKGGAFT  142

Query  459  GEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GEISVEQLKDIG  WVILGHSERRHVIGE D+
Sbjct  143  GEISVEQLKDIGATWVILGHSERRHVIGEDDQ  174



>dbj|BAJ98333.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08008.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +3

Query  168  HNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVD  347
            H+ +  LRL  SR+  + +VAMAGSGKFFVGGNWKCNGTKESI+KLVSDLN+A LESDVD
Sbjct  26   HHQNHQLRLGCSRRRAQRLVAMAGSGKFFVGGNWKCNGTKESISKLVSDLNAATLESDVD  85

Query  348  VVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSER  527
            VVVAPPF+YIDQVK+SLTD+IE+SAQN WI KGGAFTGEIS EQL DIGC+WVILGHSER
Sbjct  86   VVVAPPFIYIDQVKSSLTDRIEVSAQNTWIGKGGAFTGEISAEQLVDIGCQWVILGHSER  145

Query  528  RHVIGETDE  554
            RHVIGE D+
Sbjct  146  RHVIGEDDQ  154



>ref|XP_010526563.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Tarenaya 
hassleriana]
Length=310

 Score =   214 bits (544),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 119/134 (89%), Gaps = 2/134 (1%)
 Frame = +3

Query  159  SFFHNLHSHLRLPTSRKAC--RAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKL  332
            SF H L+S +RL +S      R VVAMAGSGKFFVGGNWKCNGTK+SITKLV+DLN+A L
Sbjct  29   SFVHRLNSSVRLASSSSRRPPRGVVAMAGSGKFFVGGNWKCNGTKDSITKLVTDLNNATL  88

Query  333  ESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVIL  512
            E+DVDVVVAPPF+YIDQVK+SLTD+IEISAQN W+ KGGAFTGEISVEQLKDIGC+WVIL
Sbjct  89   ETDVDVVVAPPFVYIDQVKSSLTDRIEISAQNSWVGKGGAFTGEISVEQLKDIGCRWVIL  148

Query  513  GHSERRHVIGETDE  554
            GHSERRHVIGE DE
Sbjct  149  GHSERRHVIGENDE  162



>ref|XP_003578514.1| PREDICTED: triosephosphate isomerase, chloroplastic [Brachypodium 
distachyon]
Length=302

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LRL  SR+  + +VAMAGSGKFFVGGNWKCNGTKESI+KL+SDLN+A LE+DVDVVVAP
Sbjct  31   QLRLGCSRRRAQRLVAMAGSGKFFVGGNWKCNGTKESISKLISDLNAATLENDVDVVVAP  90

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLTD+IE+SAQN WI KGGAFTGEIS EQL DIGC+WVILGHSERRHVIG
Sbjct  91   PFIYIDQVKNSLTDRIEVSAQNTWIGKGGAFTGEISAEQLVDIGCQWVILGHSERRHVIG  150

Query  543  ETDE  554
            E D+
Sbjct  151  EDDQ  154



>gb|KHG23864.1| Triosephosphate isomerase, chloroplastic [Gossypium arboreum]
Length=298

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 124/153 (81%), Gaps = 14/153 (9%)
 Frame = +3

Query  99   FSGLRPVS-KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKC  275
            F+GLR  S KLDSS S     SF  +++S LRL +SRK CRAV AMAGSGK         
Sbjct  11   FNGLRRSSPKLDSSQS----QSFLQHINSQLRLASSRKPCRAVTAMAGSGK---------  57

Query  276  NGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAF  455
            NGTK+SITKLVSDLNSAKLE+DVDVVV+PPF+Y+DQV ASLT +IE+SAQN WI KGGAF
Sbjct  58   NGTKDSITKLVSDLNSAKLETDVDVVVSPPFVYLDQVTASLTSRIEVSAQNSWIGKGGAF  117

Query  456  TGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            TGEISVEQLKDIGCKWVILGHSERRH+IGE D+
Sbjct  118  TGEISVEQLKDIGCKWVILGHSERRHIIGEDDQ  150



>ref|XP_006661479.1| PREDICTED: triosephosphate isomerase, chloroplastic-like, partial 
[Oryza brachyantha]
Length=288

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LR+  SR+  + VVAMAGSGKFFVGGNWKCNGTK+S++KLV++LN+A LE DVDVVVAP
Sbjct  17   QLRIGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVTELNAATLEPDVDVVVAP  76

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK+SLTD+IE+SAQN WI KGGA+TGEIS EQL DIGC+WVILGHSERRH+IG
Sbjct  77   PFIYIDQVKSSLTDRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILGHSERRHIIG  136

Query  543  ETDE  554
            E DE
Sbjct  137  EDDE  140



>ref|XP_004957468.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Setaria 
italica]
Length=304

 Score =   208 bits (530),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LR+ +SR+  + VVAMAGSGKFFVGGNWKCNGTK+SI+KLVS+LN+A LE+DVDVVVAP
Sbjct  33   QLRIGSSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSISKLVSELNAATLEADVDVVVAP  92

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLT +IE+SAQN WI KGGA+TGEIS EQL DIGC+WVILGHSERRH+IG
Sbjct  93   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILGHSERRHIIG  152

Query  543  ETDE  554
            E DE
Sbjct  153  EDDE  156



>ref|XP_007041929.1| Triosephosphate isomerase isoform 1 [Theobroma cacao]
 gb|EOX97760.1| Triosephosphate isomerase isoform 1 [Theobroma cacao]
Length=395

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 124/154 (81%), Gaps = 14/154 (9%)
 Frame = +3

Query  96   QFSGLR-PVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWK  272
            QFSGLR    KLD+S S     SF  +++S LRL +S K CRAV+AMAGSGK        
Sbjct  10   QFSGLRRSCPKLDNSQS----QSFVQHINSQLRLSSSPKPCRAVLAMAGSGK--------  57

Query  273  CNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGA  452
             NGT ESITKLVSDLNS+ LESDVDVVVAPPF+Y+DQVKASLTD+IE+SAQN WI KGGA
Sbjct  58   -NGTNESITKLVSDLNSSTLESDVDVVVAPPFVYLDQVKASLTDRIEVSAQNSWIGKGGA  116

Query  453  FTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            FTGEISVEQLKDIGCKWVILGHSERRH+IGE D+
Sbjct  117  FTGEISVEQLKDIGCKWVILGHSERRHIIGEDDQ  150



>ref|NP_001063777.1| Os09g0535000 [Oryza sativa Japonica Group]
 dbj|BAD33340.1| putative Triosephosphate isomerase, chloroplast precursor [Oryza 
sativa Japonica Group]
 dbj|BAD34212.1| putative Triosephosphate isomerase, chloroplast precursor [Oryza 
sativa Japonica Group]
 dbj|BAF25691.1| Os09g0535000 [Oryza sativa Japonica Group]
Length=304

 Score =   208 bits (529),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LRL  SR+  + VVAMAGSGKFFVGGNWKCNGTK+S++KLV++LN+A LE DVDVVVAP
Sbjct  33   QLRLGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVTELNAATLEPDVDVVVAP  92

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLTD+IE+SAQN WI KGGA+TGEIS EQL DIGC+WVILGHSERRHVIG
Sbjct  93   PFIYIDQVKNSLTDRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILGHSERRHVIG  152

Query  543  ETDE  554
            E D+
Sbjct  153  EDDQ  156



>gb|ACF79785.1| unknown [Zea mays]
 tpg|DAA62484.1| TPA: LOW QUALITY PROTEIN: triosephosphate isomerase [Zea mays]
Length=284

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LR+  SR+  + VVAMAGSGKFFVGGNWKCNGTK+S++KLVS+LN+A LE+DVDVVVAP
Sbjct  33   QLRVGFSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVSELNAATLETDVDVVVAP  92

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLT +IE+SAQN WI KGGA+TGEIS EQL DIGC+WVILGHSERRH+IG
Sbjct  93   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILGHSERRHIIG  152

Query  543  ETDE  554
            E DE
Sbjct  153  ENDE  156



>gb|EAZ09878.1| hypothetical protein OsI_32171 [Oryza sativa Indica Group]
Length=304

 Score =   208 bits (529),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LRL  SR+  + VVAMAGSGKFFVGGNWKCNGTK+S++KLV++LN+A LE DVDVVVAP
Sbjct  33   QLRLGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVTELNAATLEPDVDVVVAP  92

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLTD+IE+SAQN WI KGGA+TGEIS EQL DIGC+WVILGHSERRHVIG
Sbjct  93   PFIYIDQVKNSLTDRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILGHSERRHVIG  152

Query  543  ETDE  554
            E D+
Sbjct  153  EDDQ  156



>ref|NP_001152578.1| triosephosphate isomerase [Zea mays]
 gb|ACG48313.1| triosephosphate isomerase [Zea mays]
Length=304

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LR+  SR+  + VVAMAGSGKFFVGGNWKCNGTK+S++KLVS+LN+A LE+DVDVVVAP
Sbjct  33   QLRVGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVSELNAATLETDVDVVVAP  92

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLT +IE+SAQN WI KGGA+TGEIS EQL DIGC+WVILGHSERRH+IG
Sbjct  93   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILGHSERRHIIG  152

Query  543  ETDE  554
            E DE
Sbjct  153  ENDE  156



>gb|ACF85433.1| unknown [Zea mays]
 gb|ACR37699.1| unknown [Zea mays]
 tpg|DAA62483.1| TPA: triosephosphate isomerase [Zea mays]
Length=304

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LR+  SR+  + VVAMAGSGKFFVGGNWKCNGTK+S++KLVS+LN+A LE+DVDVVVAP
Sbjct  33   QLRVGFSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVSELNAATLETDVDVVVAP  92

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLT +IE+SAQN WI KGGA+TGEIS EQL DIGC+WVILGHSERRH+IG
Sbjct  93   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILGHSERRHIIG  152

Query  543  ETDE  554
            E DE
Sbjct  153  ENDE  156



>sp|P46225.1|TPIC_SECCE RecName: Full=Triosephosphate isomerase, chloroplastic; Short=TIM; 
Short=Triose-phosphate isomerase; Flags: Precursor [Secale 
cereale]
 emb|CAA83533.1| triosephosphate isomerase [Secale cereale]
 prf||2109226B triosephosphate isomerase
Length=298

 Score =   207 bits (528),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +3

Query  222  VVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLT  401
            +VAMAGSGKFFVGGNWKCNGTKESI+KLVSDLN+A LESDVDVVVAPPF+YIDQVK+SLT
Sbjct  40   LVAMAGSGKFFVGGNWKCNGTKESISKLVSDLNAATLESDVDVVVAPPFIYIDQVKSSLT  99

Query  402  DQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            D+IE+SAQN WI KGGAFTGEIS EQL DIGC+WVILGHSERRHVIGE DE
Sbjct  100  DRIEVSAQNTWIGKGGAFTGEISAEQLVDIGCQWVILGHSERRHVIGEDDE  150



>ref|NP_001130128.1| uncharacterized protein LOC100191222 [Zea mays]
 gb|ACF78263.1| unknown [Zea mays]
Length=304

 Score =   207 bits (528),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LR+  SR+  + VVAMAGSGKFFVGGNWKCNGTK+S++KLVS+LN+A LE+DVDVVVAP
Sbjct  33   QLRVGFSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSVSKLVSELNAATLETDVDVVVAP  92

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLT +IE+SAQN WI KGGA+TGEIS EQL DIGC+WVILGHSERRH+IG
Sbjct  93   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILGHSERRHIIG  152

Query  543  ETDE  554
            E DE
Sbjct  153  ENDE  156



>gb|KDO44199.1| hypothetical protein CISIN_1g024925mg [Citrus sinensis]
Length=260

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 128/156 (82%), Gaps = 11/156 (7%)
 Frame = +3

Query  93   AQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGS--GKFFVGGN  266
            AQFSGLR      SSP    T S+  +++SHLRL +SR+  R+   +A +   KFFVGGN
Sbjct  10   AQFSGLR-----RSSP----TQSYSQHVNSHLRLVSSRRPRRSSSVVAMASSNKFFVGGN  60

Query  267  WKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKG  446
            WKCNGTKESITKLVSDLN AKLE+DVDVVVAPPF+YIDQVK SLTD+IEI+AQN W+ KG
Sbjct  61   WKCNGTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKNSLTDRIEIAAQNSWVGKG  120

Query  447  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GAFTGEISVEQLKDIGCKWV+LGHSERRHVIGE D+
Sbjct  121  GAFTGEISVEQLKDIGCKWVVLGHSERRHVIGEDDQ  156



>tpg|DAA40632.1| TPA: triosephosphate isomerase [Zea mays]
Length=298

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LR+  SR+    +VAMAGSGKFFVGGNWKCNGTK+SI+KLVS+LN+A LE+DVDVVVAP
Sbjct  27   QLRIGCSRRRAGRIVAMAGSGKFFVGGNWKCNGTKDSISKLVSELNAATLETDVDVVVAP  86

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLT +IE+SAQN WI KGGA+TGEIS EQL DIGC+WVILGHSERRH+IG
Sbjct  87   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILGHSERRHIIG  146

Query  543  ETDE  554
            E DE
Sbjct  147  ENDE  150



>emb|CBI37923.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAGSGKFFVGGNWKCNGTK+SI+KLVSDLNSAKLE+DVDVVVAPPF+Y+DQVK SLTD+I
Sbjct  1    MAGSGKFFVGGNWKCNGTKDSISKLVSDLNSAKLEADVDVVVAPPFVYLDQVKNSLTDRI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            EISAQN W+ KGGAFTGEISVEQLKDIGC WVILGHSERRHVIGE D+
Sbjct  61   EISAQNSWVGKGGAFTGEISVEQLKDIGCNWVILGHSERRHVIGEDDQ  108



>ref|XP_006487404.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Citrus 
sinensis]
Length=304

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 128/156 (82%), Gaps = 11/156 (7%)
 Frame = +3

Query  93   AQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGS--GKFFVGGN  266
            AQFSGLR      SSP    T S+  +++SHLRL +SR+  R+   +A +   KFFVGGN
Sbjct  10   AQFSGLRR-----SSP----TQSYSQHVNSHLRLVSSRRPRRSSSVVAMASSNKFFVGGN  60

Query  267  WKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKG  446
            WKCNGTKESITKLVSDLN AKLE+DVDVVVAPPF+YIDQVK SLTD+IEI+AQN W+ KG
Sbjct  61   WKCNGTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKNSLTDRIEIAAQNSWVGKG  120

Query  447  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GAFTGEISVEQLKDIGCKWV+LGHSERRHVIGE D+
Sbjct  121  GAFTGEISVEQLKDIGCKWVVLGHSERRHVIGEDDQ  156



>ref|XP_002462733.1| hypothetical protein SORBIDRAFT_02g031030 [Sorghum bicolor]
 gb|EER99254.1| hypothetical protein SORBIDRAFT_02g031030 [Sorghum bicolor]
Length=304

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LR+  SR+  + VVAMAGSGKFFVGGNWKCNGTK+SI+KLVS+LN+A LE+DVDVVVAP
Sbjct  33   QLRIGCSRRRAQRVVAMAGSGKFFVGGNWKCNGTKDSISKLVSELNAATLETDVDVVVAP  92

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLT +IE+SAQN WI KGGA+TGEIS EQL DIG +WVILGHSERRH+IG
Sbjct  93   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGVQWVILGHSERRHIIG  152

Query  543  ETDE  554
            E DE
Sbjct  153  EDDE  156



>gb|EMT18057.1| Triosephosphate isomerase, chloroplastic [Aegilops tauschii]
Length=256

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAGSGKFFVGGNWKCNGTKESI+KLVSDLN+A LESDVDVVVAPPF+YIDQVK+SLTD+I
Sbjct  1    MAGSGKFFVGGNWKCNGTKESISKLVSDLNAATLESDVDVVVAPPFIYIDQVKSSLTDRI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            E+SAQN WI KGGAFTGEIS EQL DIGC+WVILGHSERRHVIGE D+
Sbjct  61   EVSAQNTWIGKGGAFTGEISAEQLVDIGCQWVILGHSERRHVIGEDDQ  108



>pdb|4OHQ|A Chain A, Crystal Structure Of Chloroplast Triose Phosphate Isomerase 
From Arabidopsis Thaliana
 pdb|4OHQ|B Chain B, Crystal Structure Of Chloroplast Triose Phosphate Isomerase 
From Arabidopsis Thaliana
Length=256

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAGSGKFFVGGNWKCNGTK+SI KL+SDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD+I
Sbjct  1    MAGSGKFFVGGNWKCNGTKDSIAKLISDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IS QN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  61   DISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  108



>ref|NP_001131642.1| uncharacterized protein LOC100193000 [Zea mays]
 gb|ACF80147.1| unknown [Zea mays]
Length=298

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  HLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAP  362
             LR+  SR+    +VAMAGSGKFFVGGNWKCNGTK+SI+KLVS+LN+A LE+DVDVVVAP
Sbjct  27   QLRIGCSRRRAGRIVAMAGSGKFFVGGNWKCNGTKDSISKLVSELNAATLETDVDVVVAP  86

Query  363  PFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIG  542
            PF+YIDQVK SLT +IE+SAQN WI KGGA+TGEIS EQL DIGC+WVIL HSERRH+IG
Sbjct  87   PFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGEISAEQLVDIGCQWVILRHSERRHIIG  146

Query  543  ETDE  554
            E DE
Sbjct  147  ENDE  150



>ref|XP_010472095.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Camelina 
sativa]
Length=314

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 123/157 (78%), Gaps = 6/157 (4%)
 Frame = +3

Query  99   FSGLRPVS-KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACR----AVVAMAGSGKFFVGG  263
            FSGLR +S KLDS+ ++S+  SF + ++S +RL +S  +       VVAMAGSGKFFVGG
Sbjct  11   FSGLRCISPKLDSA-AVSSHQSFVYRVNSSIRLVSSSSSSHRSPRGVVAMAGSGKFFVGG  69

Query  264  NWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISK  443
            NWKCNGTK+SI KLVSDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD+IEIS QN W   
Sbjct  70   NWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRIEISGQNSWXXX  129

Query  444  GGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
                    SVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  130  XXXXVSPYSVEQLKDLGCKWVILGHSERRHVIGEKDE  166



>gb|EMS46255.1| Triosephosphate isomerase, chloroplastic [Triticum urartu]
Length=277

 Score =   189 bits (481),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +3

Query  249  FFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQN  428
            FFVGGNWKCNGTKESI+KLVSDLN+A LESDVDVVVAPPF+YIDQVK+SLT +IE+SAQN
Sbjct  28   FFVGGNWKCNGTKESISKLVSDLNAATLESDVDVVVAPPFIYIDQVKSSLTGRIEVSAQN  87

Query  429  CWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             WI KGGAFTGEIS EQL DIGC+WVILGHSERRHVIGE DE
Sbjct  88   TWIGKGGAFTGEISAEQLVDIGCQWVILGHSERRHVIGEDDE  129



>ref|NP_001077931.1| triosephosphate isomerase [Arabidopsis thaliana]
 gb|AEC07132.1| triosephosphate isomerase [Arabidopsis thaliana]
Length=306

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 127/168 (76%), Gaps = 15/168 (9%)
 Frame = +3

Query  66   LTLSEMAVAAQFSGLRPVS-KLDSSPSLSTTHSFFHNLHSHLRLPTSRKACR----AVVA  230
            +  + +     FSGLR +S KLD++ ++S+  SFFH ++S  RL +S  +       VVA
Sbjct  1    MAATSLTAPPSFSGLRRISPKLDAA-AVSSHQSFFHRVNSSTRLVSSSSSSHRSPRGVVA  59

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAGSGK         NGTK+SI KL+SDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD+I
Sbjct  60   MAGSGK---------NGTKDSIAKLISDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRI  110

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +IS QN W+ KGGAFTGEISVEQLKD+GCKWVILGHSERRHVIGE DE
Sbjct  111  DISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDE  158



>ref|XP_001763435.1| predicted protein [Physcomitrella patens]
 gb|EDQ71624.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   188 bits (478),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  192  LPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFL  371
            + +  K  R VV M G+GKFFVGGNWKCNGT ESI KLV DLNSA++E DVDVVVAPPFL
Sbjct  1    MQSEGKGHRGVVTMTGAGKFFVGGNWKCNGTTESIKKLVEDLNSAQIEDDVDVVVAPPFL  60

Query  372  YIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETD  551
            YI QV  SLTD+IE+SAQN W+ KGGAFTGEIS +QL D+G KWVI GHSERRHVIGE++
Sbjct  61   YISQVVGSLTDRIEVSAQNSWVGKGGAFTGEISADQLVDVGVKWVIQGHSERRHVIGESN  120



>ref|XP_002986327.1| hypothetical protein SELMODRAFT_157971 [Selaginella moellendorffii]
 gb|EFJ12536.1| hypothetical protein SELMODRAFT_157971 [Selaginella moellendorffii]
Length=256

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAGSGKFFVGGNWKCNGTKESI KLVS+LNSAKLESDVDVVV+PPF+Y+DQV  S+++ I
Sbjct  1    MAGSGKFFVGGNWKCNGTKESIAKLVSELNSAKLESDVDVVVSPPFVYLDQVIGSISNGI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            E+S QN WI KGGAFTGEIS EQL DIGCKWVI GHSERRH++GE ++
Sbjct  61   EVSGQNSWIGKGGAFTGEISAEQLSDIGCKWVIHGHSERRHILGEAND  108



>ref|XP_001759539.1| predicted protein [Physcomitrella patens]
 gb|EDQ75451.1| predicted protein [Physcomitrella patens]
Length=256

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            M GSG+FFVGGNWKCNG+  SI +LV++LNSA +E+DVDVVVAPPFLYI QV  SLTD+I
Sbjct  1    MTGSGRFFVGGNWKCNGSTASIKQLVNELNSASIENDVDVVVAPPFLYIGQVIGSLTDRI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETD  551
            E+SAQNCW+ KGGAFTGEIS +QL D+G KWVI GHSERRHVIGE++
Sbjct  61   EVSAQNCWVGKGGAFTGEISADQLVDVGVKWVIQGHSERRHVIGESN  107



>ref|XP_001782032.1| predicted protein [Physcomitrella patens]
 gb|EDQ53175.1| predicted protein [Physcomitrella patens]
Length=275

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +3

Query  216  RAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKAS  395
            R VV+MAG+GKFFVGGNWKCNGT ESI KLV +LNS  LE  V+VVV+PP+LYI QV  S
Sbjct  14   RGVVSMAGTGKFFVGGNWKCNGTTESIKKLVDELNSVMLEEGVEVVVSPPYLYISQVLGS  73

Query  396  LTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETD  551
            L+++IE++AQN W+ KGGAFTGEIS EQL D G KWVI GHSERRHVIGETD
Sbjct  74   LSNRIEVAAQNSWVGKGGAFTGEISAEQLADAGVKWVIQGHSERRHVIGETD  125



>ref|XP_001768780.1| predicted protein [Physcomitrella patens]
 gb|EDQ66333.1| predicted protein [Physcomitrella patens]
Length=257

 Score =   178 bits (451),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MAG+G+FFVGGNWKCNGT ES+ KLV +LNSAKLE DVD+VV+PP+LYI QV  SLT +I
Sbjct  1    MAGTGRFFVGGNWKCNGTVESLKKLVDELNSAKLEEDVDIVVSPPYLYISQVLGSLTKRI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETD  551
            E++AQNCW  KGGAFTGEIS +QL D G KWVI GHSERRHVIGETD
Sbjct  61   EVAAQNCWTGKGGAFTGEISADQLVDGGVKWVIQGHSERRHVIGETD  107



>ref|XP_006423592.1| hypothetical protein CICLE_v10028924mg [Citrus clementina]
 gb|ESR36832.1| hypothetical protein CICLE_v10028924mg [Citrus clementina]
Length=246

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  264  NWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISK  443
            +++ NGTKESITKLVSDLN AKLE+DVDVVVAPPF+YIDQVK SLTD+IEI+AQN W+ K
Sbjct  2    HFQTNGTKESITKLVSDLNDAKLEADVDVVVAPPFVYIDQVKNSLTDRIEIAAQNSWVGK  61

Query  444  GGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GGAFTGEISVEQLKDIGCKWV+LGHSERRHVIGE D+
Sbjct  62   GGAFTGEISVEQLKDIGCKWVVLGHSERRHVIGEDDQ  98



>ref|XP_001751243.1| predicted protein [Physcomitrella patens]
 gb|EDQ83560.1| predicted protein [Physcomitrella patens]
Length=256

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            M G+GKFFVGGNWKCNGT ESI KLV +LN  K E  V+VVVAPPFLYI QV  SLTD+I
Sbjct  1    MTGTGKFFVGGNWKCNGTTESIKKLVGELNDGKFEESVEVVVAPPFLYIGQVIGSLTDRI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             +SAQN W+ KGGAFTGEIS +QL D G KWVI GHSERRHVIGE++E
Sbjct  61   AVSAQNSWVGKGGAFTGEISADQLVDAGVKWVIQGHSERRHVIGESNE  108



>ref|XP_002988724.1| hypothetical protein SELMODRAFT_447410 [Selaginella moellendorffii]
 gb|EFJ10235.1| hypothetical protein SELMODRAFT_447410 [Selaginella moellendorffii]
Length=261

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 8/110 (7%)
 Frame = +3

Query  249  FFVGGNWKCNGTKESITKLVSDLNSAKLESDV--------DVVVAPPFLYIDQVKASLTD  404
            FFVGGNWKCNGTKESI KLVS+LNSAKLESDV        DVVV+PPF+Y+DQV  S+++
Sbjct  4    FFVGGNWKCNGTKESIAKLVSELNSAKLESDVGCNSIYFLDVVVSPPFVYLDQVIGSISN  63

Query  405  QIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             IE+S QN WI KGGAFTGEIS EQL DIGCKWVI GHSERRH++GE ++
Sbjct  64   GIEVSGQNSWIGKGGAFTGEISAEQLSDIGCKWVIHGHSERRHILGEAND  113



>ref|XP_003056637.1| triosephosphate isomerase [Micromonas pusilla CCMP1545]
 gb|EEH58282.1| triosephosphate isomerase [Micromonas pusilla CCMP1545]
Length=318

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 96/134 (72%), Gaps = 8/134 (6%)
 Frame = +3

Query  177  HSHLRLPTSRKACRA--------VVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKL  332
            H  + L TS +  RA        V  MAG+GKF VGGNWKCNG   SIT+LV DLN  ++
Sbjct  38   HPSVTLATSVRGARASRGASSRCVATMAGTGKFVVGGNWKCNGNTASITQLVKDLNKGEI  97

Query  333  ESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVIL  512
            ++DVDV+VAPP LY+ +V++++  Q ++SAQNCW+S+GGAFTGE+S E L D    WVIL
Sbjct  98   DADVDVIVAPPMLYLPKVQSTIDRQFKLSAQNCWVSEGGAFTGEVSAEMLADANVPWVIL  157

Query  513  GHSERRHVIGETDE  554
            GHSERR + GE+DE
Sbjct  158  GHSERRALCGESDE  171



>gb|KDO44198.1| hypothetical protein CISIN_1g024925mg [Citrus sinensis]
Length=241

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 110/156 (71%), Gaps = 30/156 (19%)
 Frame = +3

Query  93   AQFSGLRPVSKLDSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGS--GKFFVGGN  266
            AQFSGLR      SSP    T S+  +++SHLRL +SR+  R+   +A +   KFFVGGN
Sbjct  10   AQFSGLRR-----SSP----TQSYSQHVNSHLRLVSSRRPRRSSSVVAMASSNKFFVGGN  60

Query  267  WKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKG  446
            WKCNGTKESITKLVSDLN AKLE+DVD                   +IEI+AQN W+ KG
Sbjct  61   WKCNGTKESITKLVSDLNDAKLEADVD-------------------RIEIAAQNSWVGKG  101

Query  447  GAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            GAFTGEISVEQLKDIGCKWV+LGHSERRHVIGE D+
Sbjct  102  GAFTGEISVEQLKDIGCKWVVLGHSERRHVIGEDDQ  137



>dbj|BAE48229.1| triosephosphate isomerase chloroplast type [Chlorella pyrenoidosa]
Length=286

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 97/132 (73%), Gaps = 5/132 (4%)
 Frame = +3

Query  174  LHSHLRLPTSRK-----ACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLES  338
            +H  ++LPT R+     A R  V M GSG+FF+GGNWKCNGT +S+T+LV +LN+  +  
Sbjct  8    VHQRVQLPTVRRSSCHRASRCAVVMRGSGRFFIGGNWKCNGTLQSVTQLVDELNAGSVPD  67

Query  339  DVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGH  518
             V++VVAP F+++D+V+ SL    +I+AQ+CW+SKGGA+TGE+S E L D+G  WVILGH
Sbjct  68   SVEIVVAPTFVHLDRVQRSLKSPFQIAAQDCWVSKGGAYTGEVSAEMLHDMGIPWVILGH  127

Query  519  SERRHVIGETDE  554
            SERR +  E DE
Sbjct  128  SERRSLCREDDE  139



>ref|XP_006404555.1| hypothetical protein EUTSA_v10000249mg [Eutrema salsugineum]
 gb|ESQ46008.1| hypothetical protein EUTSA_v10000249mg [Eutrema salsugineum]
Length=319

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 102/138 (74%), Gaps = 4/138 (3%)
 Frame = +3

Query  54   LSTDLTLSEMAVAAQFSGLRPV-SKLDSSPSLSTTHSFFH--NLHSHLRLPTSRKACRAV  224
            L+  ++      A  FSGLR +  KLD++ S S   SF +  N    L   +S ++ R V
Sbjct  5    LTAQISGGTQPSAPSFSGLRRICPKLDAAVSFSH-QSFLNRVNSSIRLVSSSSHRSPRGV  63

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD  404
            VAMAGSGKFFVGGNWKCNGTK+SI KLVSDLNSA LE+DVDVVV+PPF+YIDQVK+SLTD
Sbjct  64   VAMAGSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLTD  123

Query  405  QIEISAQNCWISKGGAFT  458
            +IEIS QN W+ KGGAFT
Sbjct  124  RIEISGQNSWVGKGGAFT  141



>gb|AAV65344.1| triosephosphate isomerase plastid isozyme [Prototheca wickerhamii]
Length=209

 Score =   153 bits (386),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = +3

Query  168  HNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVD  347
            H  H+ LR+  S  A R V   AG+G FFVGGNWK NG+   + KLV +LN+  L  DV+
Sbjct  1    HGTHAGLRVRPSPSAGRRVATAAGTGTFFVGGNWKANGSTAVVEKLVQELNAGILPKDVE  60

Query  348  VVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSER  527
            VVVAP FLY+DQV+ SL    +++AQNCW  K GAFTGE++ E L D    WVILGHSER
Sbjct  61   VVVAPSFLYLDQVQGSLKSSYQVAAQNCWKGKSGAFTGEVTAEMLADKQIPWVILGHSER  120

Query  528  RHVIGETDE  554
            R ++G+TDE
Sbjct  121  RALMGDTDE  129



>gb|AAU93945.1| triose phosphate isomerase [Helicosporidium sp. ex Simulium jonesi]
Length=252

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 2/104 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLES--DVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGTKES++ LV  L++AKL S   VDVVVAP FL++ Q  +SL  ++E+S
Sbjct  4    KFFVGGNWKCNGTKESVSALVKALSAAKLPSADKVDVVVAPTFLHLSQALSSLPSRVEVS  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETD  551
            AQNCWI  GGAFTGEIS EQ+ D+G KWVILGHSERRH++GE+D
Sbjct  64   AQNCWIKGGGAFTGEISAEQIVDLGAKWVILGHSERRHIMGESD  107



>ref|XP_002506262.1| triosephosphate isomerase [Micromonas sp. RCC299]
 gb|ACO67520.1| triosephosphate isomerase [Micromonas sp. RCC299]
Length=315

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +3

Query  198  TSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYI  377
             SR + R V  MAG+G+F VGGNWKCNG   SI KLV DLN+ ++ +DV+V+ APP +Y+
Sbjct  50   NSRASRRCVATMAGTGRFVVGGNWKCNGNTASIQKLVQDLNAGEITADVEVICAPPMIYL  109

Query  378  DQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             +V+++L  + ++SAQNCW+ +GGAFTGE++ E L D    WVILGHSERR ++GE+DE
Sbjct  110  PRVQSTLDRKYQLSAQNCWVGEGGAFTGEVAAEMLADNNIPWVILGHSERRALLGESDE  168



>ref|XP_007510733.1| triosephosphate isomerase [Bathycoccus prasinos]
 emb|CCO18266.1| triosephosphate isomerase [Bathycoccus prasinos]
Length=308

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +3

Query  219  AVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASL  398
            ++V   G+GKF VGGNWKCNGT +SI KL + LNS K+ +DV+V+ APP +YID+V++ L
Sbjct  50   SLVVCDGTGKFVVGGNWKCNGTIDSIDKLCASLNSGKITADVEVICAPPMVYIDRVQSKL  109

Query  399  TDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
                +I+AQNCW+SKGGAFTGE+S E LKD    WVILGHSERR + GET+E
Sbjct  110  KAPYQIAAQNCWVSKGGAFTGEVSAEMLKDANIPWVILGHSERRSLCGETNE  161



>emb|CEF98905.1| Triosephosphate isomerase [Ostreococcus tauri]
Length=295

 Score =   150 bits (380),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 3/127 (2%)
 Frame = +3

Query  177  HSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVV  356
             S  + P  R+ C AV   AG+GKF VGGNWKCNGT  S+  LV  LN+ K+++DVDV V
Sbjct  24   RSSAQAPAVRRRCVAV--NAGTGKFIVGGNWKCNGTAASVKDLVKALNAGKIDADVDVYV  81

Query  357  APPFLYIDQVKASL-TDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRH  533
            APPF++I +V+A L +++  I+AQNCW+S+GGAFTGE+S E L D    WVILGHSERR 
Sbjct  82   APPFVFIPRVQAELNSEKYAIAAQNCWVSEGGAFTGEVSAEMLVDANIPWVILGHSERRA  141

Query  534  VIGETDE  554
            + GET E
Sbjct  142  LCGETSE  148



>ref|XP_001422959.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP01318.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=266

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = +3

Query  216  RAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKAS  395
            R+VV  AG+GKF VGGNWKCNGT ES+  LV +LNS K+++DVDV VAPPF++I +V+  
Sbjct  6    RSVVVNAGTGKFIVGGNWKCNGTAESVKSLVKELNSGKIDADVDVYVAPPFVFIPRVQKE  65

Query  396  LTDQ-IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            L ++   ++AQNCW+S GGAFTGE+S + L D    WVILGHSERR + GET+E
Sbjct  66   LNNKNYAVAAQNCWVSAGGAFTGEVSADMLADADIPWVILGHSERRALCGETNE  119



>ref|XP_001419463.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97756.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=279

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = +3

Query  216  RAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKAS  395
            R+VV  AG+GKF VGGNWKCNGT ES+  LV +LNS K+++DVDV VAPPF++I +V+  
Sbjct  19   RSVVVNAGTGKFIVGGNWKCNGTAESVKSLVKELNSGKIDADVDVYVAPPFVFIPRVQKE  78

Query  396  LTDQ-IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            L ++   ++AQNCW+S GGAFTGE+S + L D    WVILGHSERR + GET+E
Sbjct  79   LNNKNYAVAAQNCWVSAGGAFTGEVSADMLADADIPWVILGHSERRALCGETNE  132



>ref|XP_003080998.1| triose-phosphate isomerase (ISS), partial [Ostreococcus tauri]
Length=313

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 98/151 (65%), Gaps = 10/151 (7%)
 Frame = +3

Query  126  LDSSPS-------LSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGT  284
            LD SP        ++          +  + P  R+ C AV   AG+GKF VGGNWKCNGT
Sbjct  18   LDPSPDRALWVVWITRAKERLTRTFTSTQAPAVRRRCVAV--NAGTGKFIVGGNWKCNGT  75

Query  285  KESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASL-TDQIEISAQNCWISKGGAFTG  461
              S+  LV  LN+ K+++DVDV VAPPF++I +V+A L +++  I+AQNCW+S+GGAFTG
Sbjct  76   AASVKDLVKALNAGKIDADVDVYVAPPFVFIPRVQAELNSEKYAIAAQNCWVSEGGAFTG  135

Query  462  EISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            E+S E L D    WVILGHSERR + GET E
Sbjct  136  EVSAEMLVDANIPWVILGHSERRALCGETSE  166



>gb|KIZ03638.1| triosephosphate isomerase (TIM) [Monoraphidium neglectum]
Length=267

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +3

Query  234  AGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIE  413
            A S KFFVGGNWKCNGT  S+ KLV+DLN+ ++ SD+DVVVAPPF+YID V+A++    +
Sbjct  13   ASSAKFFVGGNWKCNGTHASVEKLVADLNAGEVPSDIDVVVAPPFIYIDWVRANIKSAYK  72

Query  414  ISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGET  548
            ++AQNCW    GA+TGEIS E LKD G  WV+ GHSERR ++GE+
Sbjct  73   VAAQNCWSKPDGAYTGEISAEMLKDAGVPWVVTGHSERRLLLGES  117



>gb|KIZ02768.1| triosephosphate isomerase (TIM) [Monoraphidium neglectum]
Length=263

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  234  AGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIE  413
            A S KFFVGGNWKCNGT  S+ KLV+DLN+ ++ SD+D+VVAPPF+YID V+A++    E
Sbjct  8    ASSAKFFVGGNWKCNGTHASVEKLVADLNAGEVPSDIDIVVAPPFIYIDWVRANIKSAYE  67

Query  414  ISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETD  551
            ++AQNCW    GAFTGEIS E +KD    WVI GHSERR ++GE++
Sbjct  68   VAAQNCWTKPDGAFTGEISAEMIKDAMVPWVITGHSERRLLLGESN  113



>ref|XP_005650184.1| Triosephosphate isomerase [Coccomyxa subellipsoidea C-169]
 gb|EIE25640.1| Triosephosphate isomerase [Coccomyxa subellipsoidea C-169]
Length=254

 Score =   144 bits (364),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            M  SG FFVGGNWK NG+K+S++KLV DLNS+K  SDVDV+VAP FL++  V  ++  + 
Sbjct  1    MGSSGNFFVGGNWKSNGSKDSVSKLVKDLNSSKFPSDVDVIVAPTFLHLPYVVDNIDPRY  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            ++SAQNCW+ K GA+TGEI+ EQL D+G +WVILGHSERR ++ E++E
Sbjct  61   QVSAQNCWVGKAGAYTGEIAPEQLLDLGLQWVILGHSERRSLLKESNE  108



>ref|XP_005846199.1| triosephosphate isomerase chloroplast type [Chlorella variabilis]
 gb|EFN54097.1| triosephosphate isomerase chloroplast type [Chlorella variabilis]
Length=289

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 90/135 (67%), Gaps = 8/135 (6%)
 Frame = +3

Query  174  LHSHLRLPTSRK------ACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKL-  332
            +H  L+LP +R+      + R  V     G+FF+GGNWKCNGT ES+T+LV DLN+  + 
Sbjct  8    VHQRLQLPGARRCSPGSRSARLNVISRAHGRFFIGGNWKCNGTVESVTQLVKDLNAGSVP  67

Query  333  -ESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVI  509
                V++VVAP F+++D VK +L    EI AQ+CW+ KGGAFTGE+S E L D G  WVI
Sbjct  68   PADKVEIVVAPTFVHLDMVKKTLNPPFEIGAQDCWVGKGGAFTGEVSAEMLHDFGIPWVI  127

Query  510  LGHSERRHVIGETDE  554
            LGHSERR +  E DE
Sbjct  128  LGHSERRSLCREDDE  142



>ref|XP_002955427.1| hypothetical protein VOLCADRAFT_109969 [Volvox carteri f. nagariensis]
 tpg|DAA06180.1| TPA_inf: chloroplast triosephosphate isomerase [Volvox carteri]
 gb|EFJ43498.1| hypothetical protein VOLCADRAFT_109969 [Volvox carteri f. nagariensis]
Length=287

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 85/123 (69%), Gaps = 3/123 (2%)
 Frame = +3

Query  189  RLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPF  368
            RL   R   R  +  A + KFFVGGNWKCNG+  S+ KLV +LNS  +   VD+V APPF
Sbjct  21   RLALGRG--RLEIVCASNAKFFVGGNWKCNGSVASVRKLVDELNSGSVPRGVDIVCAPPF  78

Query  369  LYIDQVKASL-TDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGE  545
            +YID V   L  D+ +++AQNCWI   GA+TGE+S EQL+D G  WVILGHSERR + GE
Sbjct  79   IYIDYVMQHLDKDKYQLAAQNCWIGGNGAYTGEVSAEQLQDFGLPWVILGHSERRSLCGE  138

Query  546  TDE  554
            T++
Sbjct  139  TNQ  141



>pdb|4MKN|A Chain A, Crystal Structure Of Chloroplastic Triosephosphate Isomerase 
From Chlamydomonas Reinhardtii At 1.1 A Of Resolution
Length=270

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +3

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLT-  401
            V  A S KFFVGGNWKCNG+  ++ KLV +LN+  +   VDVVVAPPF+YID V   L  
Sbjct  13   VVCASSAKFFVGGNWKCNGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDR  72

Query  402  DQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            D+ ++SAQN WI   GAFTGE+S EQL D G  WVILGHSERR + GE++E
Sbjct  73   DKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNE  123



>gb|KDD74205.1| triosephosphate isomerase [Helicosporidium sp. ATCC 50920]
Length=267

 Score =   139 bits (350),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = +3

Query  207  KACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQV  386
            +A R +   AG G FFVGGNWK NGT ES+T LV  LN+  + S V+VVVAPP  Y+D+V
Sbjct  5    RASRGMACKAGKGTFFVGGNWKANGTLESVTDLVKGLNAGSIPSTVEVVVAPPAPYLDRV  64

Query  387  KASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            + S+   I+++AQNCW    GAFTGE+  E L D+   WVILGHSERR ++GE DE
Sbjct  65   RTSIKAPIQVAAQNCWKQGPGAFTGEVPAEMLADMKIGWVILGHSERRSLMGECDE  120



>ref|XP_001690035.1| triose phosphate isomerase [Chlamydomonas reinhardtii]
 gb|AAV65490.1| chloroplast triosephosphate isomerase [Chlamydomonas reinhardtii]
 gb|EDP09773.1| triose phosphate isomerase [Chlamydomonas reinhardtii]
Length=282

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +3

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLT-  401
            V  A S KFFVGGNWKCNG+  ++ KLV +LN+  +   VDVVVAPPF+YID V   L  
Sbjct  25   VVCASSAKFFVGGNWKCNGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDR  84

Query  402  DQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            D+ ++SAQN WI   GAFTGE+S EQL D G  WVILGHSERR + GE++E
Sbjct  85   DKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNE  135



>ref|XP_008442057.1| PREDICTED: triosephosphate isomerase, cytosolic [Cucumis melo]
Length=254

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN A++ S+  V+VVV+PPF+++  VK+ L   I+++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNEAEIPSEDAVEVVVSPPFVFLSLVKSLLRSDIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++ E++E
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLGIPWVILGHSERRLILNESNE  108



>ref|XP_004144643.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 
2 [Cucumis sativus]
 ref|XP_004170198.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 
2 [Cucumis sativus]
 gb|KGN54918.1| hypothetical protein Csa_4G598000 [Cucumis sativus]
Length=254

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN A++ S+  V+VVV+PPF+++  VK+ L   I+++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNEAEIPSEDAVEVVVSPPFVFLSLVKSLLRSDIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++ E++E
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLGIPWVILGHSERRLILKESNE  108



>gb|EYU38446.1| hypothetical protein MIMGU_mgv1a012264mg [Erythranthe guttata]
Length=256

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN A++  E DV+VVV+PPF+++  VK  L     I+
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAEVPSEDDVEVVVSPPFVFLPIVKTLLRSDFSIA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGEISVE L ++G  WVILGHSERR V+ E+++
Sbjct  64   AQNCWVRKGGAFTGEISVEMLLNLGVPWVILGHSERRLVLNESND  108



>ref|XP_007537109.1| PREDICTED: triosephosphate isomerase isoform X1 [Erinaceus europaeus]
Length=286

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = +3

Query  153  THSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKL  332
            T  +       LR P   + C    AMA S KFFVGGNWK NG K ++ +L++ LN+AKL
Sbjct  13   TALYISGPWPRLRAPADLQ-CAGTTAMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKL  71

Query  333  ESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVIL  512
             +D +VV APP  YID  +  L  +I ++AQNC+    GAFTGEIS   +KD G  WV+L
Sbjct  72   PADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVL  131

Query  513  GHSERRHVIGETDE  554
            GHSERRHV GE+DE
Sbjct  132  GHSERRHVFGESDE  145



>ref|XP_004170197.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 
1 [Cucumis sativus]
Length=256

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN A++ S+  V+VVV+PPF+++  VK+ L   I+++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNEAEIPSEDAVEVVVSPPFVFLSLVKSLLRSDIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++ E++E
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLGIPWVILGHSERRLILKESNE  108



>ref|XP_004144642.1| PREDICTED: triosephosphate isomerase, cytosolic-like isoform 
1 [Cucumis sativus]
Length=256

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN A++ S+  V+VVV+PPF+++  VK+ L   I+++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNEAEIPSEDAVEVVVSPPFVFLSLVKSLLRSDIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++ E++E
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLGIPWVILGHSERRLILKESNE  108



>ref|XP_008810613.1| PREDICTED: triosephosphate isomerase, cytosolic [Phoenix dactylifera]
Length=254

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN  ++ S   V+VV++PP++++  VK+SL     ++
Sbjct  4    KFFVGGNWKCNGTNEEVKKIVSTLNDGQVPSSDVVEVVISPPYVFLPLVKSSLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGEIS E LK++G  WV+LGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEISAEMLKNLGIHWVVLGHSERRLLLGESNE  108



>gb|ABE11555.1| cytosolic triosephosphate isomerase [Euglena deses var. intermedia]
Length=255

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDV--VVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT+ESI  L+ D N A  E D+DV  VVAPPF++ D  K  L    E+S
Sbjct  4    KFFVGGNWKCNGTRESIASLLKDFNGAVGEPDLDVQIVVAPPFVHCDFTKEKLPKGWELS  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHV--IGETDE  554
             QNCWI KGGAFTGE+S E +KD G  WVILGHSERRH+  + E+DE
Sbjct  64   VQNCWIGKGGAFTGEVSAEMIKDAGIPWVILGHSERRHLPQLKESDE  110



>ref|XP_003796519.1| PREDICTED: triosephosphate isomerase, partial [Otolemur garnettii]
Length=278

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C A   MA S KFFVGGNWK NG K+ + +LVS LN+AK+ SD +VV APP  YID  + 
Sbjct  32   CVATSTMAPSRKFFVGGNWKMNGRKKCLGELVSTLNAAKVPSDTEVVCAPPTAYIDFTRQ  91

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I +SAQNC+    GAFTGEIS   +KD G  WVILGHSERRHV GE+DE
Sbjct  92   KLDPKIAVSAQNCYKVTNGAFTGEISPGMIKDCGATWVILGHSERRHVFGESDE  145



>gb|EMS61639.1| Triosephosphate isomerase, cytosolic [Triticum urartu]
Length=165

 Score =   134 bits (338),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E +  +V+ LN+ ++ S   V+VVV+PP++++  VK  L  +I+++
Sbjct  4    KFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++GE+ E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSE  108



>ref|XP_002531441.1| triosephosphate isomerase, putative [Ricinus communis]
 gb|EEF30953.1| triosephosphate isomerase, putative [Ricinus communis]
Length=118

 Score =   133 bits (334),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN A++ SD  V+VV++PPF+++  VK+ L    +++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAEVPSDDVVEVVLSPPFVFLPLVKSLLRPDFQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++   WVILGHSERR ++ E++E
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLLNLSIPWVILGHSERRALLNESNE  108



>emb|CDM81250.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E +  +V+ LN+ ++ S   V+VVV+PP++++  VKA L  +I+++
Sbjct  4    KFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKAKLRPEIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++GE+ E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSE  108



>gb|AIN39806.1| hypothetical protein [Zoysia matrella]
Length=253

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT + + K+V  LN A++ S   V+VVV+PP+++I  VK+ L  +I+++
Sbjct  4    KFFVGGNWKCNGTTDQVDKIVKTLNEAQIASPDVVEVVVSPPYVFIPMVKSKLRPEIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++ E++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRGLLAESNE  108



>ref|XP_005907547.1| PREDICTED: triosephosphate isomerase [Bos mutus]
 ref|XP_010843235.1| PREDICTED: triosephosphate isomerase [Bison bison bison]
 gb|ELR47807.1| Triosephosphate isomerase [Bos mutus]
Length=286

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +3

Query  195  PTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLY  374
            P  ++AC +  AMA S KFFVGGNWK NG K ++ +L++ LN+AK+ +D +VV APP  Y
Sbjct  28   PDLQRACSS--AMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAPPTAY  85

Query  375  IDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            ID  +  L  +I ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  86   IDFARQKLDPKIAVAAQNCYKVANGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  145



>ref|XP_005957952.1| PREDICTED: triosephosphate isomerase [Pantholops hodgsonii]
Length=286

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +3

Query  195  PTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLY  374
            P  ++AC +  AMA S KFFVGGNWK NG K ++ +L++ LN+AK+ +D +VV APP  Y
Sbjct  28   PDLQRACSS--AMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAPPTAY  85

Query  375  IDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            ID  +  L  +I ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  86   IDFARQKLDPKIAVAAQNCYKVANGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  145



>ref|XP_009587903.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X2 [Nicotiana 
tomentosiformis]
Length=253

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  FFVGGNWKCNGTKESITKLVSDLNSAKLES-DVDVVVAPPFLYIDQVKASLTDQIEISAQ  425
            FFVGGNWKCNGT E + K+VS LN+ ++ S DV+VVV+PPF+++  VK  L     ++AQ
Sbjct  5    FFVGGNWKCNGTSEEVKKIVSTLNAGQVPSQDVEVVVSPPFVFLPLVKNELRPDFHVAAQ  64

Query  426  NCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            NCW+ KGGAFTGE+S E L ++   WVILGHSERR ++GE+DE
Sbjct  65   NCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRAILGESDE  107



>ref|XP_006065910.1| PREDICTED: triosephosphate isomerase [Bubalus bubalis]
Length=286

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +3

Query  195  PTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLY  374
            P  ++AC +  AMA S KFFVGGNWK NG K ++ +L++ LN+AK+ +D +VV APP  Y
Sbjct  28   PDLQRACSS--AMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAPPTAY  85

Query  375  IDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            ID  +  L  +I ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  86   IDFARQKLDPKIAVAAQNCYKVANGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  145



>ref|XP_008565897.1| PREDICTED: triosephosphate isomerase [Galeopterus variegatus]
Length=285

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 87/134 (65%), Gaps = 4/134 (3%)
 Frame = +3

Query  165  FHNLHSHLRLPTSRKA----CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKL  332
            F  L+   + P  R+     C A   MA S KFFVGGNWK NG K S+ +L+S LN+AK+
Sbjct  11   FSALYIIGQWPRRRREPDLRCPARSTMAPSRKFFVGGNWKMNGRKTSLGELISTLNAAKV  70

Query  333  ESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVIL  512
             +D +VV APP  YID  +  L  +I ++AQNC+    GAFTGEIS   +KD G  WV+L
Sbjct  71   PADTEVVCAPPTAYIDFARQKLDSKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVL  130

Query  513  GHSERRHVIGETDE  554
            GHSERRHV GE+DE
Sbjct  131  GHSERRHVFGESDE  144



>ref|XP_009793253.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X2 [Nicotiana 
sylvestris]
 gb|AIE16184.1| triosephosphate isomerase [Nicotiana tabacum]
Length=253

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  FFVGGNWKCNGTKESITKLVSDLNSAKLES-DVDVVVAPPFLYIDQVKASLTDQIEISAQ  425
            FFVGGNWKCNGT E + K+VS LN+ ++ S DV+VVV+PPF+++  VK  L     ++AQ
Sbjct  5    FFVGGNWKCNGTSEEVKKIVSTLNAGQVPSQDVEVVVSPPFVFLPLVKNELRPDFHVAAQ  64

Query  426  NCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            NCW+ KGGAFTGE+S E L ++   WVILGHSERR ++GE+DE
Sbjct  65   NCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRAILGESDE  107



>ref|XP_007633208.1| PREDICTED: triosephosphate isomerase isoform X2 [Cricetulus griseus]
Length=295

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NGTK+ + +L+  LN+AK+ +D +VV APP  YID V+  L  +
Sbjct  46   AMAPSRKFFVGGNWKMNGTKKCLGELICTLNAAKVPADTEVVCAPPAAYIDFVRQKLDPK  105

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD+G +WV+LGHSERRH+ GE+DE
Sbjct  106  IAVAAQNCYKVNSGAFTGEISPGMIKDLGAEWVVLGHSERRHIFGESDE  154



>ref|XP_007644948.1| PREDICTED: triosephosphate isomerase isoform X1 [Cricetulus griseus]
Length=295

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NGTK+ + +L+  LN+AK+ +D +VV APP  YID V+  L  +
Sbjct  46   AMAPSRKFFVGGNWKMNGTKKCLGELICTLNAAKVPADTEVVCAPPAAYIDFVRQKLDPK  105

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD+G +WV+LGHSERRH+ GE+DE
Sbjct  106  IAVAAQNCYKVNSGAFTGEISPGMIKDLGAEWVVLGHSERRHIFGESDE  154



>ref|XP_007170196.1| PREDICTED: triosephosphate isomerase [Balaenoptera acutorostrata 
scammoni]
Length=286

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C   +AMA S KFFVGGNWK NG K ++ +L++ LN+AK+ +D +VV APP ++ID  + 
Sbjct  32   CAGFIAMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAPPTVFIDFARQ  91

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  92   KLDPKIAVAAQNCYKVANGAFTGEISXXMIKDCGATWVVLGHSERRHVFGESDE  145



>gb|ACU17423.1| unknown [Glycine max]
Length=180

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN AK+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVLGEDVVEVVVSPPFVFLPVVKSLLRPDFHVS  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGA+TGE+S E L ++G  WVI+GHSERR ++ E++E
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLGIPWVIIGHSERRQLLNESNE  108



>emb|CDP09059.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT + + K+VS LN A++  E DVDVVV+PPF+++  VK+ L     I+
Sbjct  4    KFFVGGNWKCNGTTDEVKKIVSMLNEAEVPSEDDVDVVVSPPFVFLPIVKSLLRPDFSIA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++ E+ E
Sbjct  64   AQNCWVRKGGAFTGEVSAEMLVNLGIPWVILGHSERRLLLNESKE  108



>emb|CAC14917.1| triosephosphat-isomerase [Triticum aestivum]
Length=253

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E +  +V+ LN+ ++ S   V+VVV+PP++++  VK  L  +I+++
Sbjct  4    KFFVGGNWKCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPYVFLPTVKGKLRPEIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++GE+ E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLMGESSE  108



>gb|EDM01926.1| rCG29914, isoform CRA_d [Rattus norvegicus]
Length=197

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K+ + +L+  LN+AKL +D +VV APP  YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKLPADTEVVCAPPTAYIDFARQKLDPK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRH+ GE+DE
Sbjct  97   IAVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHIFGESDE  145



>ref|XP_003791751.1| PREDICTED: triosephosphate isomerase-like [Otolemur garnettii]
Length=249

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+ + +LVS LN+AK+ SD +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKKCLGELVSTLNAAKVPSDTEVVCAPPTAYIDFTRQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             +SAQNC+    GAFTGEIS   +KD G  WVILGHSERRHV GE+DE
Sbjct  61   AVSAQNCYKVTNGAFTGEISPGMIKDCGATWVILGHSERRHVFGESDE  108



>ref|XP_008784587.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Phoenix 
dactylifera]
Length=254

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K++S LN  ++ +   V+VV++PPF+++  VK+SL     ++
Sbjct  4    KFFVGGNWKCNGTSEEVKKIISTLNDGQVPASDVVEVVISPPFVFLPLVKSSLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGEIS E LK+I   WVILGHSERR ++GE+ E
Sbjct  64   AQNCWVKKGGAFTGEISAEMLKNIDIHWVILGHSERRLLLGESSE  108



>gb|AHA84226.1| triose-phosphate isomerase [Phaseolus vulgaris]
Length=253

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN AK+  E  V+VVV+PPF++I  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFIPTVKTLLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGA+TGE+S E L ++G  WVI+GHSERR ++ ET+E
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLGVPWVIIGHSERRQILQETNE  108



>ref|XP_007150325.1| hypothetical protein PHAVU_005G144100g [Phaseolus vulgaris]
 gb|ESW22319.1| hypothetical protein PHAVU_005G144100g [Phaseolus vulgaris]
Length=253

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN AK+  E  V+VVV+PPF++I  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFIPTVKTLLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGA+TGE+S E L ++G  WVI+GHSERR ++ ET+E
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLGVPWVIIGHSERRQILQETNE  108



>emb|CAI43251.1| triose-phosphate isomerase [Phaseolus vulgaris var. nanus]
Length=254

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN AK+  E  V+VVV+PPF++I  VK  L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFIPTVKTLLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGA+TGE+S E L ++G  WVI+GHSERR ++ ET+E
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLGVPWVIIGHSERRQILQETNE  108



>ref|XP_003463291.1| PREDICTED: triosephosphate isomerase [Cavia porcellus]
Length=286

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K ++ +L++ LN+AK+ +D +VV APP  YID  + 
Sbjct  32   CAGSSAMAPSRKFFVGGNWKMNGRKNTLGELINTLNAAKVPADTEVVCAPPTAYIDFARQ  91

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  92   KLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  145



>ref|XP_002712957.1| PREDICTED: triosephosphate isomerase [Oryctolagus cuniculus]
Length=288

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K+++ +L++ LN+AK+ +D +VV APP  YID  + 
Sbjct  34   CAGPSAMAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQ  93

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  94   KLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  147



>gb|EDM01925.1| rCG29914, isoform CRA_c [Rattus norvegicus]
Length=214

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K+ + +L+  LN+AKL +D +VV APP  YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKLPADTEVVCAPPTAYIDFARQKLDPK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRH+ GE+DE
Sbjct  97   IAVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHIFGESDE  145



>ref|XP_010920579.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Elaeis 
guineensis]
Length=254

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            +FFVGGNWKCNGT E + K+VS LN  ++ S   V+VV++PP++++  VK+SL     ++
Sbjct  4    RFFVGGNWKCNGTSEEVKKIVSTLNDGQVPSSDVVEVVISPPYVFLPLVKSSLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E LK+I   WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLKNIDIHWVILGHSERRLLLGESNE  108



>ref|XP_010651015.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X2 [Vitis 
vinifera]
Length=212

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFF+GGNWKCNGT E + K+V+ LN A++ S+  V+VVV+PPF+++  VK+ L    +++
Sbjct  4    KFFIGGNWKCNGTVEEVKKIVTVLNEAEVPSEDIVEVVVSPPFVFLPLVKSLLRSDFQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCWI +GGAFTGEIS E L ++G  WVILGHSERR ++ E++E
Sbjct  64   AQNCWIRRGGAFTGEISAEMLVNLGIPWVILGHSERRSLLAESNE  108



>gb|EFB13962.1| hypothetical protein PANDA_011247 [Ailuropoda melanoleuca]
Length=263

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K+++ +L++ LN+AK+ +D +VV APP  YID  + 
Sbjct  9    CVTASAMAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQ  68

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  69   KLDAKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  122



>ref|XP_004869515.1| PREDICTED: triosephosphate isomerase [Heterocephalus glaber]
Length=249

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K ++ +L+S LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKNTLGELISTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  108



>ref|XP_004438751.1| PREDICTED: triosephosphate isomerase [Ceratotherium simum simum]
Length=286

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K+S+ +L+S LN+AKL +D +VV A P  YID  + 
Sbjct  32   CAGPSAMAPSRKFFVGGNWKMNGRKKSLGELISTLNAAKLPADTEVVCAAPTAYIDFARQ  91

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  92   KLDQKIAVAAQNCYKVANGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_003568647.1| PREDICTED: triosephosphate isomerase, cytosolic [Brachypodium 
distachyon]
Length=253

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT + + K+V  LN  ++ S   V+VVV+PP++++  VK+ L  +I+++
Sbjct  4    KFFVGGNWKCNGTTDQVDKIVKVLNEGQIASTDVVEVVVSPPYVFLPIVKSQLRPEIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++GE+ E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLANLGIPWVILGHSERRSLLGESSE  108



>ref|XP_010685754.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Beta vulgaris 
subsp. vulgaris]
Length=254

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +3

Query  240  SGKFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIE  413
            S +FFVGGNWKCNGT E + KL++ LN A++  E DV+VVV+PPF+++  VK  L     
Sbjct  2    SRRFFVGGNWKCNGTTEEVRKLLTTLNEAEVPSEEDVEVVVSPPFVFLTLVKNLLRTDFH  61

Query  414  ISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            ++AQNCW+ KGGAFTGEIS + L ++G  WVILGHSERR ++ ET++
Sbjct  62   VAAQNCWVRKGGAFTGEISADMLVNLGINWVILGHSERRALLNETND  108



>gb|KCW50197.1| hypothetical protein EUGRSUZ_J00008 [Eucalyptus grandis]
Length=247

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN A++     V+VVV+PPF+++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVATLNDAQVPPQDVVEVVVSPPFIFLPLVKSTLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++   WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRQLLGESNE  108



>ref|XP_006862693.1| PREDICTED: triosephosphate isomerase isoform X1 [Chrysochloris 
asiatica]
Length=284

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K+++ +L++ LN+AK+ +D +VV APP  YID  + 
Sbjct  30   CLGTNAMAPSRKFFVGGNWKMNGRKKALGELITTLNAAKVPTDTEVVCAPPSAYIDFARQ  89

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  90   KLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  143



>ref|XP_006644990.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Oryza brachyantha]
Length=255

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN A++ S+  V+VVV+PPF+++ QVK  L     ++
Sbjct  5    KFFVGGNWKCNGTGEDVKKIVTVLNEAEVPSEDIVEVVVSPPFVFLSQVKGLLRPDFSVA  64

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGEIS E L ++   WVILGHSERR ++GE+++
Sbjct  65   AQNCWVRKGGAFTGEISAEMLVNLQVPWVILGHSERRALLGESND  109



>sp|P48497.1|TPIS_STELP RecName: Full=Triosephosphate isomerase, cytosolic; Short=TIM; 
Short=Triose-phosphate isomerase [Stellaria longipes]
 gb|AAB30759.1| triose phosphate isomerase [Stellaria longipes]
Length=257

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT+ES++K+V  LN   + ++  V VVV+PP++++    A L  +I+++
Sbjct  4    KFFVGGNWKCNGTQESVSKIVDTLNEPTIAANDVVTVVVSPPYVFLPDENAELKHEIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S + L ++G  WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEVSAQMLANLGITWVILGHSERRTLLGESNE  108



>ref|XP_003273803.1| PREDICTED: triosephosphate isomerase isoform 1 [Nomascus leucogenys]
Length=286

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D +VV APP  YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  97   IAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_006914710.1| PREDICTED: triosephosphate isomerase [Pteropus alecto]
 ref|XP_011364118.1| PREDICTED: triosephosphate isomerase [Pteropus vampyrus]
Length=286

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K S+ +L+S LN+AK+ +D +VV APP  YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKTSLGELISTLNAAKVPADTEVVCAPPTAYIDFARQKLDPK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  97   IAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_007108358.1| PREDICTED: triosephosphate isomerase [Physeter catodon]
Length=286

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K ++ +L++ LN+AK+ +D +VV APP +YID  + 
Sbjct  32   CVGFSAMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAPPTVYIDFARQ  91

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  92   KLDPKIAVAAQNCYKVANGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>gb|ABH10995.1| plastid triose phosphate isomerase [Polytomella parva]
Length=226

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = +3

Query  216  RAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKAS  395
            R V A A   KFFVGGNWKCNG   ++  LV DLN  K+ SDVDVV APPFL++D V  +
Sbjct  28   RIVSANASKAKFFVGGNWKCNGDSAAVKTLVEDLNKGKVPSDVDVVCAPPFLFLDYVNKN  87

Query  396  L-TDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            L   +  +SAQNCW+ K GA+TGE+S + L +    WVILGHSERR +  E+ E
Sbjct  88   LDKSKYAVSAQNCWVGKNGAYTGEVSADMLVNAQIPWVILGHSERRAIFNESSE  141



>ref|XP_006933527.1| PREDICTED: triosephosphate isomerase [Felis catus]
Length=286

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C +  AMA S KFFVGGNWK NG K+++ +L++ LN+AK+ +D +VV APP  YID  + 
Sbjct  32   CVSFSAMAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQ  91

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  92   KLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_010030961.1| PREDICTED: triosephosphate isomerase, cytosolic [Eucalyptus grandis]
 gb|KCW50199.1| hypothetical protein EUGRSUZ_J00008 [Eucalyptus grandis]
Length=254

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN A++     V+VVV+PPF+++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVATLNDAQVPPQDVVEVVVSPPFIFLPLVKSTLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++   WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRQLLGESNE  108



>ref|XP_006643754.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Oryza brachyantha]
Length=253

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT + + K+V  LN  ++ S   V+VVV+PP++++  VK+ L  + +++
Sbjct  4    KFFVGGNWKCNGTADQVDKIVKTLNEGQVPSPDVVEVVVSPPYVFLPVVKSQLRPEFQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLLGESNE  108



>ref|NP_001152759.1| triosephosphate isomerase isoform 2 [Homo sapiens]
 sp|P60174.3|TPIS_HUMAN RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Homo sapiens]
 gb|EAW88722.1| triosephosphate isomerase 1, isoform CRA_b [Homo sapiens]
 gb|EAW88723.1| triosephosphate isomerase 1, isoform CRA_b [Homo sapiens]
Length=286

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D +VV APP  YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  97   IAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_006846201.1| hypothetical protein AMTR_s00012p00219470 [Amborella trichopoda]
 gb|ERN07876.1| hypothetical protein AMTR_s00012p00219470 [Amborella trichopoda]
Length=254

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN A++ S+  V+VVV+PPF+++  VK+ L     ++
Sbjct  4    KFFVGGNWKCNGTVEEVKKIVSMLNEAEVPSEDIVEVVVSPPFVFLPLVKSLLRPDFLVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGEIS E L ++G  WVI+GHSERR ++ ET+E
Sbjct  64   AQNCWVRKGGAFTGEISAEMLVNLGIPWVIIGHSERRSLLNETNE  108



>emb|CAN67342.1| hypothetical protein VITISV_033715 [Vitis vinifera]
Length=250

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN A++ S+  V+VVV+PPF+++  VK+ L    +++
Sbjct  4    KFFVGGNWKCNGTVEEVKKIVTVLNEAEVPSEDIVEVVVSPPFVFLPLVKSLLRSDFQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCWI +GGAFTGEIS E L ++G  WVILGHSERR ++ E++E
Sbjct  64   AQNCWIRRGGAFTGEISAEMLVNLGIPWVILGHSERRSLLAESNE  108



>gb|KCW50198.1| hypothetical protein EUGRSUZ_J00008 [Eucalyptus grandis]
Length=245

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN A++     V+VVV+PPF+++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVATLNDAQVPPQDVVEVVVSPPFIFLPLVKSTLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++   WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRQLLGESNE  108



>ref|XP_004643583.1| PREDICTED: triosephosphate isomerase [Octodon degus]
Length=286

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 87/134 (65%), Gaps = 4/134 (3%)
 Frame = +3

Query  165  FHNLHSHLRLPTSRK----ACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKL  332
            F +L+   + P  R      C     MA S KFFVGGNWK NG K ++ +L++ LN+AK+
Sbjct  12   FASLYISGQWPQLRADPDLQCVGTSTMAPSRKFFVGGNWKMNGRKNTLGELINTLNAAKV  71

Query  333  ESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVIL  512
             +D +VV APP  YID  +  L  +I ++AQNC+    GAFTGEIS   +KD+G  WV+L
Sbjct  72   PADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVL  131

Query  513  GHSERRHVIGETDE  554
            GHSERRHV GE+DE
Sbjct  132  GHSERRHVFGESDE  145



>ref|XP_004708189.1| PREDICTED: triosephosphate isomerase isoform X1 [Echinops telfairi]
Length=286

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+ + +L+++LN+AKL +D +VV APP  YID  +  L  +I
Sbjct  38   MAPSRKFFVGGNWKMNGRKKGLGELITNLNAAKLPADTEVVCAPPTAYIDFARQKLDAKI  97

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WVILGHSERRHV GE+DE
Sbjct  98   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVILGHSERRHVFGESDE  145



>ref|XP_010554607.1| PREDICTED: triosephosphate isomerase, cytosolic-like [Tarenaya 
hassleriana]
Length=254

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN A++ S   V+VVV+PPF+++  VK+ L    +++
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVNTLNEAQVPSQDVVEVVVSPPFVFLPAVKSILRPDFQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E LK++   WVILGHSERR ++ E++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLKNLDIPWVILGHSERRALLNESNE  108



>ref|XP_003905933.1| PREDICTED: triosephosphate isomerase [Papio anubis]
 ref|XP_005570030.1| PREDICTED: triosephosphate isomerase isoform X1 [Macaca fascicularis]
 ref|XP_007965614.1| PREDICTED: triosephosphate isomerase [Chlorocebus sabaeus]
Length=286

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD  404
            +AMA S KFFVGGNWK NG K+++ +L+  LN+AK+ +D +VV APP  YID  +  L  
Sbjct  36   IAMAPSRKFFVGGNWKMNGRKQNLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDP  95

Query  405  QIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  96   KIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_010384203.1| PREDICTED: triosephosphate isomerase [Rhinopithecus roxellana]
Length=286

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +3

Query  225  VAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTD  404
            +AMA S KFFVGGNWK NG K+++ +L+  LN+AK+ +D +VV APP  YID  +  L  
Sbjct  36   IAMAPSRKFFVGGNWKMNGRKQNLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDP  95

Query  405  QIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  96   KIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_005652645.1| PREDICTED: triosephosphate isomerase isoform X1 [Sus scrofa]
Length=368

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA + KFFVGGNWK NG K ++ +L++ LN+AKL +D +VV APP  YID  + 
Sbjct  115  CAGSSAMAPARKFFVGGNWKMNGRKNNLGELINTLNAAKLPADTEVVCAPPTAYIDFARQ  174

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  175  KLDPKIAVAAQNCYKVANGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  228



>ref|XP_004307511.1| PREDICTED: triosephosphate isomerase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=253

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT + + K+V+ LN  K+ S   V+VVV+PP++++  VK++L    +++
Sbjct  4    KFFVGGNWKCNGTIDEVKKIVNLLNDGKVPSPDCVEVVVSPPYVFLPLVKSTLRPDFQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E LK++   WVILGHSERR ++GET+E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLKNLEVPWVILGHSERRALLGETNE  108



>ref|XP_002117956.1| hypothetical protein TRIADDRAFT_38509 [Trichoplax adhaerens]
 gb|EDV19524.1| hypothetical protein TRIADDRAFT_38509 [Trichoplax adhaerens]
Length=248

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQ  425
            KF VGGNWK NG++ESI  ++  L    L    +VVV PPF+Y+  VK +L D++ I+AQ
Sbjct  5    KFIVGGNWKMNGSRESIDGIIQFLKQGPLNESTEVVVGPPFVYLSYVKENLPDKVSIAAQ  64

Query  426  NCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            NC+ +  GAFTGEIS E   DIGC+WVILGHSERR+V GETDE
Sbjct  65   NCYYASKGAFTGEISAEMAVDIGCEWVILGHSERRNVFGETDE  107



>ref|XP_008823594.1| PREDICTED: triosephosphate isomerase [Nannospalax galili]
Length=286

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  219  AVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASL  398
            A  AMA S KFFVGGNWK NG K+ +  L+S LN+AK+ +D +VV APP  YID  +  L
Sbjct  34   APCAMAPSRKFFVGGNWKMNGRKKCLGDLISTLNAAKVPADTEVVCAPPTAYIDYARQKL  93

Query  399  TDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
              +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  94   DPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|NP_001126005.1| triosephosphate isomerase [Pongo abelii]
 sp|Q5R928.1|TPIS_PONAB RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Pongo abelii]
 emb|CAH91732.1| hypothetical protein [Pongo abelii]
Length=249

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDYGATWVVLGHSERRHVFGESDE  108



>gb|ABD92704.1| triosephosphate isomerase 1 [Sus scrofa]
Length=248

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA + KFFVGGNWK NG K ++ +L++ LN+AKL +D +VV APP  YID  +  L  +I
Sbjct  1    MAPARKFFVGGNWKMNGRKNNLGELINTLNAAKLPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVANGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  108



>gb|ELK10405.1| Triosephosphate isomerase [Pteropus alecto]
Length=249

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K S+ +L+S LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKTSLGELISTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>dbj|BAI48105.1| triosephosphate isomerase 1 [Sus scrofa]
Length=248

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA + KFFVGGNWK NG K ++ +L++ LN+AKL +D +VV APP  YID  +  L  +I
Sbjct  1    MAPARKFFVGGNWKMNGRKNNLGELINTLNAAKLPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVANGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  108



>ref|XP_002283671.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X1 [Vitis 
vinifera]
 emb|CBI16125.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFF+GGNWKCNGT E + K+V+ LN A++ S+  V+VVV+PPF+++  VK+ L    +++
Sbjct  4    KFFIGGNWKCNGTVEEVKKIVTVLNEAEVPSEDIVEVVVSPPFVFLPLVKSLLRSDFQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCWI +GGAFTGEIS E L ++G  WVILGHSERR ++ E++E
Sbjct  64   AQNCWIRRGGAFTGEISAEMLVNLGIPWVILGHSERRSLLAESNE  108



>ref|XP_005378895.1| PREDICTED: triosephosphate isomerase [Chinchilla lanigera]
Length=249

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K ++ +L++ LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKNTLGELINTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  108



>ref|XP_009587902.1| PREDICTED: triosephosphate isomerase, cytosolic isoform X1 [Nicotiana 
tomentosiformis]
Length=254

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 2/104 (2%)
 Frame = +3

Query  249  FFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEISA  422
            FFVGGNWKCNGT E + K+VS LN+ ++ S   V+VVV+PPF+++  VK  L     ++A
Sbjct  5    FFVGGNWKCNGTSEEVKKIVSTLNAGQVPSQDVVEVVVSPPFVFLPLVKNELRPDFHVAA  64

Query  423  QNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            QNCW+ KGGAFTGE+S E L ++   WVILGHSERR ++GE+DE
Sbjct  65   QNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRAILGESDE  108



>gb|AAH17917.1| Triosephosphate isomerase 1 [Homo sapiens]
 gb|AIC63193.1| TPI1, partial [synthetic construct]
Length=249

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>gb|AAH70129.1| TPI1 protein [Homo sapiens]
Length=252

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>dbj|BAF62362.1| triosephosphate isomerase 1 [Pan troglodytes verus]
Length=249

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>ref|XP_006737921.1| PREDICTED: triosephosphate isomerase [Leptonychotes weddellii]
Length=286

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K+++ +L++ LN+AK+ +D +VV APP  YID  + 
Sbjct  32   CVGSSAMAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQ  91

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  92   KLDAKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_003547334.1| PREDICTED: triosephosphate isomerase, cytosolic [Glycine max]
 gb|KHN33382.1| Triosephosphate isomerase, cytosolic [Glycine soja]
Length=253

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN AK+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPVVKSLLRPDFHVS  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGA+TGE+S E L ++G  WVI+GHSERR ++ E++E
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLGIPWVIIGHSERRQLLNESNE  108



>ref|NP_000356.1| triosephosphate isomerase isoform 1 [Homo sapiens]
 ref|NP_001065250.1| triosephosphate isomerase [Pan troglodytes]
 ref|XP_004092190.1| PREDICTED: triosephosphate isomerase [Nomascus leucogenys]
 sp|P60175.2|TPIS_PANTR RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Pan troglodytes]
 emb|CAA49379.1| triosephosphate isomerase [Homo sapiens]
 gb|AAA35438.1| triose-phosphate isomerase [Pan troglodytes]
 gb|AAB59511.1| triosephosphate isomerase (EC 5.3.1.1) [Homo sapiens]
 gb|AAB51316.1| triosephosphate isomerase [Homo sapiens]
 gb|AAH07086.1| Triosephosphate isomerase 1 [Homo sapiens]
 gb|AAH07812.1| Triosephosphate isomerase 1 [Homo sapiens]
 gb|AAH09329.1| Triosephosphate isomerase 1 [Homo sapiens]
 gb|AAH11611.1| Triosephosphate isomerase 1 [Homo sapiens]
 gb|AAH15100.1| Triosephosphate isomerase 1 [Homo sapiens]
 emb|CAG46503.1| TPI1 [Homo sapiens]
 gb|ABM84175.1| triosephosphate isomerase 1 [synthetic construct]
 gb|ABM87577.1| triosephosphate isomerase 1 [synthetic construct]
 dbj|BAG36090.1| unnamed protein product [Homo sapiens]
 gb|ACJ13722.1| epididymis secretory protein Li 49 [Homo sapiens]
 dbj|BAJ20336.1| triosephosphate isomerase 1 [synthetic construct]
 gb|AIC49893.1| TPI1, partial [synthetic construct]
Length=249

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>ref|NP_001013607.1| triosephosphate isomerase [Bos taurus]
 sp|Q5E956.3|TPIS_BOVIN RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Bos taurus]
 gb|AAX09081.1| triosephosphate isomerase 1 [Bos taurus]
 gb|AAI02904.1| Triosephosphate isomerase 1 [Bos taurus]
 tpg|DAA29222.1| TPA: triosephosphate isomerase [Bos taurus]
Length=249

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K ++ +L++ LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVANGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  108



>ref|XP_004692958.1| PREDICTED: triosephosphate isomerase isoform X1 [Condylura cristata]
 ref|XP_004692960.1| PREDICTED: triosephosphate isomerase isoform X3 [Condylura cristata]
Length=249

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+ + +L+  LN+AKL +D++VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKKCLGELIGTLNAAKLPADIEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>ref|XP_004413981.1| PREDICTED: triosephosphate isomerase [Odobenus rosmarus divergens]
Length=286

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K+++ +L++ LN+AK+ +D +VV APP  YID  + 
Sbjct  32   CVGSNAMAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQ  91

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  92   KLDAKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_005106755.1| PREDICTED: triosephosphate isomerase-like [Aplysia californica]
Length=249

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            M G  KFFVGGNWK NG K+SI  +V+ + +  L S+ D+VVAPP+ YI   +  L   +
Sbjct  1    MPGDRKFFVGGNWKMNGDKKSIDDIVAFMKTGPLNSNTDIVVAPPYCYIQYSRDGLPANV  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            E++AQNC+  K GAFTGEIS   +KD+G  WVI GHSERRH++GE+DE
Sbjct  61   EVAAQNCYTEKSGAFTGEISPLMVKDLGATWVITGHSERRHIMGESDE  108



>pdb|4POD|A Chain A, Structure Of Triosephosphate Isomerase I170v Mutant 
Human Enzyme.
 pdb|4POD|B Chain B, Structure Of Triosephosphate Isomerase I170v Mutant 
Human Enzyme.
Length=254

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  6    MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  65

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  66   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  113



>pdb|4POC|A Chain A, Structure Of Triosephosphate Isomerase Wild Type Human 
Enzyme.
 pdb|4POC|B Chain B, Structure Of Triosephosphate Isomerase Wild Type Human 
Enzyme.
Length=254

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  6    MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  65

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  66   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  113



>ref|XP_006170851.1| PREDICTED: triosephosphate isomerase [Tupaia chinensis]
 gb|ELV09750.1| Triosephosphate isomerase [Tupaia chinensis]
Length=285

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K+++  L++ LN+AK+ +D +VV APP  YID  + 
Sbjct  32   CVGSSAMAPSRKFFVGGNWKMNGRKQNLGDLINTLNAAKVPADTEVVCAPPTAYIDFARQ  91

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  92   KLDPKIAVAAQNCYKVANGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_007469457.1| PREDICTED: LOW QUALITY PROTEIN: triosephosphate isomerase [Lipotes 
vexillifer]
Length=286

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K ++ +L++ LN+AK+ +D +VV APP +YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAPPTVYIDFARQKLDHK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  97   IAVAAQNCYKVANGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_002283693.1| PREDICTED: triosephosphate isomerase, cytosolic [Vitis vinifera]
 emb|CBI31684.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN+ ++ S   V+VVV+PPF+++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTGEEVKKIVSTLNAGEVPSGDVVEVVVSPPFVFLPLVKSTLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGEIS E L ++G  WVI+GHSERR ++ E++E
Sbjct  64   AQNCWVKKGGAFTGEISAEMLVNLGIPWVIIGHSERRLLLNESNE  108



>gb|ABA86966.1| triosephosphate isomerase [Glycine max]
 gb|ACU23019.1| unknown [Glycine max]
 gb|KHN30170.1| Triosephosphate isomerase, cytosolic [Glycine soja]
Length=253

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN AK+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPFVKSLLRPDFHVS  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGA+TGE+S E L ++G  WVI+GHSERR ++ E++E
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLGIPWVIIGHSERRQLLNESNE  108



>emb|CAN70587.1| hypothetical protein VITISV_041523 [Vitis vinifera]
Length=254

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN+ ++ S   V+VVV+PPF+++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTGEEVKKIVSTLNAGEVPSGDVVEVVVSPPFVFLPLVKSTLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGEIS E L ++G  WVI+GHSERR ++ E++E
Sbjct  64   AQNCWVKKGGAFTGEISAEMLVNLGIPWVIIGHSERRLLLNESNE  108



>gb|ABB02628.1| triose phosphate isomerase cytosolic isoform-like [Solanum tuberosum]
Length=254

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = +3

Query  249  FFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEISA  422
            FFVGGNWKCNGT E I K+V+ LN+ ++ S   V+VVV+PPF+++  VK  L     ++A
Sbjct  5    FFVGGNWKCNGTSEEIKKIVATLNAGQVPSQDVVEVVVSPPFVFLPLVKNELRSDFHVAA  64

Query  423  QNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            QNCW+ KGGAFTGE+S + L ++G  WVILGHSERR ++GE++E
Sbjct  65   QNCWVKKGGAFTGEVSADMLVNLGIPWVILGHSERRAILGESNE  108



>ref|XP_010609974.1| PREDICTED: triosephosphate isomerase [Fukomys damarensis]
 gb|KFO20267.1| Triosephosphate isomerase [Fukomys damarensis]
Length=249

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K ++ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKSTLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDLGAAWVVLGHSERRHVFGESDE  108



>ref|XP_006776159.1| PREDICTED: triosephosphate isomerase-like [Myotis davidii]
Length=145

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K ++ +L+  LNSAK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKANLGELIICLNSAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVMDGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>ref|XP_002752312.2| PREDICTED: triosephosphate isomerase [Callithrix jacchus]
Length=385

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = +3

Query  213  CRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKA  392
            C    AMA S KFFVGGNWK NG K+++ +L+  LN+AK+  D +VV APP  YID  + 
Sbjct  131  CLGSSAMAPSRKFFVGGNWKMNGRKQNLGELIGTLNAAKVPGDTEVVCAPPTAYIDFARQ  190

Query  393  SLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             L  +I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  191  KLDPKIAVAAQNCYKVSNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  244



>gb|AEK69741.1| (S)-tetrahydroprotoberberine oxidase [Corydalis saxicola]
Length=232

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E I K+V+ LN A++ S   VDVV++PP++++  VK+SL     ++
Sbjct  39   KFFVGGNWKCNGTGEEIKKIVATLNQAEVPSADIVDVVLSPPYVFLPLVKSSLRPDFHVA  98

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++   WVILGHSERR ++ E++E
Sbjct  99   AQNCWVKKGGAFTGEVSAEMLVNLEIPWVILGHSERRALLNESNE  143



>ref|XP_011077218.1| PREDICTED: triosephosphate isomerase, cytosolic [Sesamum indicum]
Length=254

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT + + K+VS LN+A++ S   V+VVV+PPF+++  VK++L     ++
Sbjct  4    KFFVGGNWKCNGTTDEVKKIVSMLNAAEVPSQDVVEVVVSPPFVFLPLVKSTLRSDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGA+TGE+S E L ++   WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAYTGEVSAEMLVNLDVPWVILGHSERRALLGESNE  108



>ref|XP_004766701.1| PREDICTED: triosephosphate isomerase [Mustela putorius furo]
 ref|XP_004800893.1| PREDICTED: triosephosphate isomerase [Mustela putorius furo]
Length=286

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K+++ +L++ LN+AK+ +D +VV APP  YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQKLDAK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  97   IAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



>ref|XP_003750702.2| PREDICTED: triosephosphate isomerase [Rattus norvegicus]
 gb|EDM01924.1| rCG29914, isoform CRA_b [Rattus norvegicus]
Length=286

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K+ + +L+  LN+AKL +D +VV APP  YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKLPADTEVVCAPPTAYIDFARQKLDPK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRH+ GE+DE
Sbjct  97   IAVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHIFGESDE  145



>ref|XP_008143086.1| PREDICTED: triosephosphate isomerase [Eptesicus fuscus]
Length=283

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 86/134 (64%), Gaps = 4/134 (3%)
 Frame = +3

Query  165  FHNLHSHLRLPTSRK----ACRAVVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKL  332
            F  L+   + P  R+     C     MA S KFFVGGNWK NG K ++ +L++ LN+AK+
Sbjct  9    FSALYISSQWPRLRRETDLQCVGFSDMAPSRKFFVGGNWKMNGRKTTLAELITTLNAAKV  68

Query  333  ESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKDIGCKWVIL  512
             +D +VV APP  YID  +  L  +I ++AQNC+    GAFTGEIS   +KD G  WV+L
Sbjct  69   PADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVPNGAFTGEISPCMIKDCGATWVVL  128

Query  513  GHSERRHVIGETDE  554
            GHSERRHV GE+DE
Sbjct  129  GHSERRHVFGESDE  142



>ref|NP_001132639.1| uncharacterized protein LOC100194114 [Zea mays]
 gb|ACF81567.1| unknown [Zea mays]
Length=250

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLE-SDV-DVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT + + K+V  LN   +  SDV +VVV+PP++++  VK+ L  + +++
Sbjct  4    KFFVGGNWKCNGTTDQVEKIVKTLNEGNVPPSDVVEVVVSPPYVFLPVVKSQLRQEFQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGEIS E L ++G  WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEISAEMLVNLGVPWVILGHSERRALLGESNE  108



>ref|XP_006593480.1| PREDICTED: triosephosphate isomerase isoform X1 [Glycine max]
Length=248

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN AK+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPFVKSLLRPDFHVS  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGA+TGE+S E L ++G  WVI+GHSERR ++ E++E
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLGIPWVIIGHSERRQLLNESNE  108



>ref|XP_006992124.1| PREDICTED: triosephosphate isomerase [Peromyscus maniculatus 
bairdii]
Length=286

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K+ + +L+  LN+AK+ +D +VV APP  YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKVPADTEVVCAPPTAYIDFARQKLDPK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  97   IAVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  145



>ref|XP_004026051.1| PREDICTED: triosephosphate isomerase-like isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004026052.1| PREDICTED: triosephosphate isomerase-like isoform 2 [Gorilla 
gorilla gorilla]
 sp|Q2QD07.1|TPIS_GORGO RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Gorilla gorilla gorilla]
 gb|ABC40672.1| rcTPI1 [Gorilla gorilla]
Length=249

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+S+ +L+  LN+AK+ +D  VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTKVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>ref|XP_005066069.1| PREDICTED: triosephosphate isomerase [Mesocricetus auratus]
Length=286

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+ + +L+  LN+AKL +D +VV APP  YID  +  L  +I
Sbjct  38   MAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKLPADTEVVCAPPSAYIDFARQKLDPKI  97

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G +WV+LGHSERRHV GE+DE
Sbjct  98   AVAAQNCYKVTNGAFTGEISPGMIKDLGAEWVVLGHSERRHVFGESDE  145



>gb|AAR04016.1| cytosolic triosephosphate isomerase [Euglena gracilis]
Length=255

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAK--LESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT+ESI+K++ + N      ++DV+VV+  PF+Y D  +  L     +S
Sbjct  4    KFFVGGNWKCNGTRESISKIIEEFNKGPSVADADVEVVIGCPFVYADYTREKLRQDWALS  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHV--IGETDE  554
             QNCWI KGGAFTGEIS E +KD G  WVILGHSERRH+  + E+DE
Sbjct  64   VQNCWIGKGGAFTGEISAEMIKDAGIPWVILGHSERRHLPELKESDE  110



>ref|NP_001183983.1| triosephosphate isomerase [Canis lupus familiaris]
 ref|XP_002922306.2| PREDICTED: triosephosphate isomerase [Ailuropoda melanoleuca]
 sp|P54714.3|TPIS_CANFA RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Canis lupus familiaris]
Length=249

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+++ +L++ LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQKLDAKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>ref|XP_007935321.1| PREDICTED: triosephosphate isomerase isoform X1 [Orycteropus 
afer afer]
Length=286

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 88/142 (62%), Gaps = 1/142 (1%)
 Frame = +3

Query  129  DSSPSLSTTHSFFHNLHSHLRLPTSRKACRAVVAMAGSGKFFVGGNWKCNGTKESITKLV  308
            +    L  T  +       LR  T  + C +   MA S KFFVGGNWK NG K+ + +L+
Sbjct  5    EKEAGLCLTAFYISGQWQRLRGGTDLQ-CLSSSTMAPSRKFFVGGNWKMNGRKKGLGELI  63

Query  309  SDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQIEISAQNCWISKGGAFTGEISVEQLKD  488
            + LN+AK+ +D +VV APP  YID  +  L  +I ++AQNC+    GAFTGEIS   +KD
Sbjct  64   TTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKD  123

Query  489  IGCKWVILGHSERRHVIGETDE  554
             G  WV+LGHSERRHV GE+DE
Sbjct  124  CGATWVVLGHSERRHVFGESDE  145



>ref|NP_001032228.1| triosephosphate isomerase [Sus scrofa]
 sp|Q29371.4|TPIS_PIG RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Sus scrofa]
 gb|ABA02206.1| triosephosphate isomerase 1 [Sus scrofa]
Length=248

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA + KFFVGGNWK NG K ++ +L++ LN+AKL +D +VV APP  YID  +  L  +I
Sbjct  1    MAPARKFFVGGNWKMNGRKNNLGELINTLNAAKLPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEI    +KD+G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVANGAFTGEIGPGMIKDLGATWVVLGHSERRHVFGESDE  108



>ref|NP_001028244.1| triosephosphate isomerase [Rattus norvegicus]
 gb|AAR23524.1| triosephosphate isomerase [Rattus norvegicus]
Length=249

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+ + +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGKKKCLGELICTLNAAKMPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDE  108



>gb|KJB73932.1| hypothetical protein B456_011G261700 [Gossypium raimondii]
Length=254

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN+ ++ S   V+VVV+PPF+++  VK SL     ++
Sbjct  4    KFFVGGNWKCNGTTEEVNKIVSTLNAGEVPSQDVVEVVVSPPFVFLPLVKTSLRPDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++   WVI+GHSERR ++ E++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLSIPWVIIGHSERRLILKESNE  108



>ref|NP_075211.2| triosephosphate isomerase [Rattus norvegicus]
 sp|P48500.2|TPIS_RAT RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Rattus norvegicus]
 gb|AAI26088.1| Triosephosphate isomerase 1 [Rattus norvegicus]
Length=249

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+ + +L+  LN+AKL +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKLPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRH+ GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHIFGESDE  108



>gb|AAA42278.1| triosephosphate isomerase [Rattus norvegicus]
Length=249

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+ + +L+  LN+AKL +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKLPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD+G  WV+LGHSERRH+ GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHIFGESDE  108



>ref|NP_001237472.1| triosephosphate isomerase [Glycine max]
 gb|AAT46998.1| triosephosphate isomerase [Glycine max]
Length=253

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKL--ESDVDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+V+ LN AK+  E  V+VVV+PPF+++  VK+ L     +S
Sbjct  4    KFFVGGNWKCNGTTEEVKKIVTTLNEAKVPGEDVVEVVVSPPFVFLPFVKSLLRPDFHVS  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGA+TGE+S E L ++G  WVI+GHSERR ++ E +E
Sbjct  64   AQNCWVRKGGAYTGEVSAEMLVNLGIPWVIIGHSERRQLLNELNE  108



>sp|P15426.2|TPIS_MACMU RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Macaca mulatta]
 sp|Q60HC9.3|TPIS_MACFA RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: 
Full=Triose-phosphate isomerase [Macaca fascicularis]
 gb|AAA36922.1| triosephosphate isomerase [Macaca mulatta]
 dbj|BAD51986.1| triosephosphate isomerase 1 [Macaca fascicularis]
Length=249

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+++ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKQNLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>ref|XP_010256927.1| PREDICTED: triosephosphate isomerase, cytosolic [Nelumbo nucifera]
Length=253

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT E + K+VS LN A+  S   V+VVV+PPF+++  VK+SL     ++
Sbjct  4    KFFVGGNWKCNGTAEEVKKIVSTLNEAEAPSGDVVEVVVSPPFVFLPLVKSSLRSDFHVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++   WVILGHSERR ++ E++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLDIPWVILGHSERRLLLNESNE  108



>gb|ABY76196.1| triosephosphate isomerase [Oryza coarctata]
Length=253

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT + + K+V  LN  ++ S   V+VVV+PP++++  VK+ L  + +++
Sbjct  4    KFFVGGNWKCNGTTDQMDKIVKILNEGQVPSTDVVEVVVSPPYVFLPVVKSQLRPEFQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++G  WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLGVPWVILGHSERRSLLGESNE  108



>ref|XP_010371267.1| PREDICTED: LOW QUALITY PROTEIN: triosephosphate isomerase-like 
[Rhinopithecus roxellana]
Length=249

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  MAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQI  410
            MA S KFFVGGNWK NG K+++ +L+  LN+AK+ +D +VV APP  YID  +  L  +I
Sbjct  1    MAPSRKFFVGGNWKMNGRKQNLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI  60

Query  411  EISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
             ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  61   AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  108



>gb|ADM86861.1| triosephosphate isomerase [Oryza sativa Japonica Group]
 gb|AFI71270.1| triosephosphate isomerase [Oryza sativa Japonica Group]
Length=253

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +3

Query  246  KFFVGGNWKCNGTKESITKLVSDLNSAKLESD--VDVVVAPPFLYIDQVKASLTDQIEIS  419
            KFFVGGNWKCNGT + + K+V  LN  ++ S   V+VVV+PP++++  VK+ L  +I+++
Sbjct  4    KFFVGGNWKCNGTTDQVDKIVKILNEGQIASTDVVEVVVSPPYVFLPVVKSQLRPEIQVA  63

Query  420  AQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            AQNCW+ KGGAFTGE+S E L ++   WVILGHSERR ++GE++E
Sbjct  64   AQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRSLLGESNE  108



>ref|XP_001422591.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00908.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=338

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 84/123 (68%), Gaps = 13/123 (11%)
 Frame = +3

Query  222  VVAMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLT  401
            V   AG+G+F VGGNWKCNGT+ S+  L+ +LN+ +L  DVDVVVAPPFL++D+   +L 
Sbjct  39   VATNAGNGRFIVGGNWKCNGTRASVKTLIEELNAGELR-DVDVVVAPPFLFLDEATETLK  97

Query  402  DQIEISAQNCWISKG------------GAFTGEISVEQLKDIGCKWVILGHSERRHVIGE  545
               E++AQNCW+  G            GAFTGE+S E L+D+   WVILGHSERR++  E
Sbjct  98   APYEVAAQNCWVEPGLVDPTHHYDSDTGAFTGEVSAEMLEDLRIPWVILGHSERRNLFNE  157

Query  546  TDE  554
            ++E
Sbjct  158  SNE  160



>ref|XP_001497522.2| PREDICTED: triosephosphate isomerase [Equus caballus]
Length=286

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AMAGSGKFFVGGNWKCNGTKESITKLVSDLNSAKLESDVDVVVAPPFLYIDQVKASLTDQ  407
            AMA S KFFVGGNWK NG K+S+ +L+S LN+AK+ +D +VV A P  YID  +  L  +
Sbjct  37   AMAPSRKFFVGGNWKMNGRKKSLGELISTLNAAKVPADTEVVCAAPTAYIDFARQKLDHK  96

Query  408  IEISAQNCWISKGGAFTGEISVEQLKDIGCKWVILGHSERRHVIGETDE  554
            I ++AQNC+    GAFTGEIS   +KD G  WV+LGHSERRHV GE+DE
Sbjct  97   IAVAAQNCYKVANGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDE  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800