BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003I16

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588958.1|  PREDICTED: uncharacterized protein YMR315W         238   1e-73   Nicotiana tomentosiformis
ref|XP_004228627.1|  PREDICTED: uncharacterized oxidoreductase C2...    238   2e-73   Solanum lycopersicum
ref|XP_009773348.1|  PREDICTED: uncharacterized protein LOC104223588    234   3e-72   Nicotiana sylvestris
ref|XP_006348416.1|  PREDICTED: uncharacterized protein YMR315W-like    233   6e-72   Solanum tuberosum [potatoes]
ref|XP_010651284.1|  PREDICTED: uncharacterized protein LOC100245...    218   2e-66   
ref|XP_010651283.1|  PREDICTED: uncharacterized protein LOC100245...    218   3e-66   Vitis vinifera
gb|KCW51233.1|  hypothetical protein EUGRSUZ_J00813                     216   3e-66   Eucalyptus grandis [rose gum]
emb|CBI16434.3|  unnamed protein product                                218   4e-66   Vitis vinifera
ref|XP_008449757.1|  PREDICTED: uncharacterized protein YMR315W         218   4e-66   
ref|XP_002285606.1|  PREDICTED: uncharacterized protein LOC100245...    218   6e-66   Vitis vinifera
ref|XP_002513445.1|  oxidoreductase, putative                           216   2e-65   Ricinus communis
ref|XP_010031848.1|  PREDICTED: uncharacterized protein YMR315W         216   4e-65   Eucalyptus grandis [rose gum]
emb|CDP14087.1|  unnamed protein product                                211   3e-63   Coffea canephora [robusta coffee]
emb|CAN75498.1|  hypothetical protein VITISV_020272                     210   1e-62   Vitis vinifera
gb|KFK39395.1|  hypothetical protein AALP_AA3G239500                    209   2e-62   Arabis alpina [alpine rockcress]
ref|XP_009364727.1|  PREDICTED: uncharacterized protein LOC103954617    208   4e-62   Pyrus x bretschneideri [bai li]
ref|XP_007014900.1|  Oxidoreductase, putative isoform 2                 207   4e-62   
emb|CDY19604.1|  BnaA05g20120D                                          207   8e-62   Brassica napus [oilseed rape]
ref|XP_007014899.1|  Oxidoreductase, putative isoform 1                 207   1e-61   
gb|ACU17312.1|  unknown                                                 203   1e-61   Glycine max [soybeans]
ref|XP_009145584.1|  PREDICTED: uncharacterized protein YMR315W         207   1e-61   Brassica rapa
ref|XP_006298014.1|  hypothetical protein CARUB_v10014059mg             206   2e-61   
ref|XP_009364714.1|  PREDICTED: uncharacterized protein LOC103954601    206   2e-61   Pyrus x bretschneideri [bai li]
emb|CDY06381.1|  BnaC05g31490D                                          206   3e-61   
gb|KJB66097.1|  hypothetical protein B456_010G128200                    205   4e-61   Gossypium raimondii
gb|KJB66095.1|  hypothetical protein B456_010G128200                    205   4e-61   Gossypium raimondii
gb|KJB66099.1|  hypothetical protein B456_010G128200                    205   4e-61   Gossypium raimondii
ref|XP_010091995.1|  Uncharacterized protein L484_007981                205   4e-61   
ref|XP_010488066.1|  PREDICTED: glucose-fructose oxidoreductase d...    205   4e-61   Camelina sativa [gold-of-pleasure]
gb|KDP20201.1|  hypothetical protein JCGZ_07921                         205   6e-61   Jatropha curcas
ref|XP_010509356.1|  PREDICTED: glucose-fructose oxidoreductase d...    204   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_002883268.1|  oxidoreductase family protein                      204   1e-60   
ref|XP_008358862.1|  PREDICTED: uncharacterized protein YMR315W-l...    204   2e-60   Malus domestica [apple tree]
ref|XP_006406349.1|  hypothetical protein EUTSA_v10021019mg             204   2e-60   Eutrema salsugineum [saltwater cress]
dbj|BAB02487.1|  unnamed protein product                                202   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011025252.1|  PREDICTED: uncharacterized protein YMR315W i...    203   2e-60   Populus euphratica
ref|XP_011025251.1|  PREDICTED: uncharacterized protein YMR315W i...    203   3e-60   Populus euphratica
ref|XP_006386095.1|  hypothetical protein POPTR_0003s22050g             203   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_008243595.1|  PREDICTED: uncharacterized protein YMR315W         203   3e-60   Prunus mume [ume]
ref|XP_006386094.1|  hypothetical protein POPTR_0003s22050g             203   3e-60   Populus trichocarpa [western balsam poplar]
gb|ABK96297.1|  unknown                                                 203   4e-60   Populus trichocarpa x Populus deltoides
ref|NP_188715.2|  NAD(P)-binding Rossmann-fold superfamily protein      202   5e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003543553.1|  PREDICTED: uncharacterized protein YMR315W         202   6e-60   Glycine max [soybeans]
ref|XP_010544236.1|  PREDICTED: uncharacterized protein YMR315W i...    202   6e-60   Tarenaya hassleriana [spider flower]
ref|XP_010544235.1|  PREDICTED: uncharacterized protein YMR315W i...    202   7e-60   Tarenaya hassleriana [spider flower]
ref|XP_007205433.1|  hypothetical protein PRUPE_ppa007778mg             202   9e-60   
ref|XP_006445972.1|  hypothetical protein CICLE_v10015756mg             197   1e-59   
ref|XP_006494722.1|  PREDICTED: uncharacterized protein YMR315W-like    201   2e-59   Citrus sinensis [apfelsine]
gb|KJB66096.1|  hypothetical protein B456_010G128200                    201   3e-59   Gossypium raimondii
ref|XP_006445973.1|  hypothetical protein CICLE_v10015756mg             198   3e-59   
ref|XP_008358864.1|  PREDICTED: uncharacterized protein YMR315W-l...    199   9e-59   Malus domestica [apple tree]
gb|KJB66098.1|  hypothetical protein B456_010G128200                    199   1e-58   Gossypium raimondii
ref|XP_010257400.1|  PREDICTED: uncharacterized protein LOC104597...    199   1e-58   Nelumbo nucifera [Indian lotus]
ref|XP_006445974.1|  hypothetical protein CICLE_v10015756mg             198   3e-58   Citrus clementina [clementine]
ref|XP_011090402.1|  PREDICTED: uncharacterized protein YMR315W-like    198   3e-58   Sesamum indicum [beniseed]
ref|XP_011080243.1|  PREDICTED: uncharacterized protein LOC105163544    198   3e-58   Sesamum indicum [beniseed]
ref|XP_010257398.1|  PREDICTED: uncharacterized protein LOC104597...    199   3e-58   Nelumbo nucifera [Indian lotus]
ref|XP_011461910.1|  PREDICTED: uncharacterized protein YMR315W         197   4e-58   Fragaria vesca subsp. vesca
ref|XP_010913920.1|  PREDICTED: uncharacterized protein LOC105039...    196   1e-57   Elaeis guineensis
ref|XP_007150403.1|  hypothetical protein PHAVU_005G150400g             196   2e-57   Phaseolus vulgaris [French bean]
ref|XP_010913917.1|  PREDICTED: uncharacterized protein LOC105039...    196   3e-57   Elaeis guineensis
ref|XP_009385566.1|  PREDICTED: glucose-fructose oxidoreductase d...    195   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK46300.1|  unknown                                                 194   6e-57   Lotus japonicus
ref|XP_010257399.1|  PREDICTED: uncharacterized protein LOC104597...    194   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_003577920.1|  PREDICTED: uncharacterized protein LOC100827110    193   2e-56   Brachypodium distachyon [annual false brome]
gb|KHG07862.1|  Uncharacterized protein F383_13730                      192   3e-56   Gossypium arboreum [tree cotton]
ref|XP_004956459.1|  PREDICTED: uncharacterized protein YMR315W-like    191   1e-55   Setaria italica
ref|XP_008787293.1|  PREDICTED: uncharacterized protein LOC103705381    191   1e-55   Phoenix dactylifera
ref|XP_002459955.1|  hypothetical protein SORBIDRAFT_02g018670          190   3e-55   Sorghum bicolor [broomcorn]
ref|NP_001149836.1|  NAD-dependent dyhydrogenase, Gfo/Idh/MocA fa...    189   1e-54   Zea mays [maize]
ref|XP_006850072.1|  hypothetical protein AMTR_s00022p00213490          188   2e-54   
ref|XP_008668038.1|  PREDICTED: NAD-dependent dyhydrogenase, Gfo/...    187   3e-54   Zea mays [maize]
ref|XP_006660493.1|  PREDICTED: uncharacterized protein YMR315W-like    186   9e-54   Oryza brachyantha
gb|EMT01460.1|  hypothetical protein F775_26364                         186   1e-53   
ref|NP_001062764.1|  Os09g0280300                                       183   2e-52   
ref|XP_010673578.1|  PREDICTED: uncharacterized protein YMR315W i...    183   2e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673579.1|  PREDICTED: uncharacterized protein YMR315W i...    182   2e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004486934.1|  PREDICTED: uncharacterized protein YMR315W-like    180   3e-51   Cicer arietinum [garbanzo]
gb|EEE69341.1|  hypothetical protein OsJ_28659                          179   8e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EYU18011.1|  hypothetical protein MIMGU_mgv1a008840mg                173   9e-49   Erythranthe guttata [common monkey flower]
gb|EPS68382.1|  hypothetical protein M569_06387                         171   3e-48   Genlisea aurea
ref|XP_003597479.1|  Oxidoreductase, putative                           169   6e-47   Medicago truncatula
gb|KGN54119.1|  hypothetical protein Csa_4G286920                       157   1e-44   Cucumis sativus [cucumbers]
gb|EYU46309.1|  hypothetical protein MIMGU_mgv1a0096471mg               142   3e-39   Erythranthe guttata [common monkey flower]
ref|XP_001754780.1|  predicted protein                                  133   1e-33   
ref|XP_001762266.1|  predicted protein                                  132   2e-33   
ref|XP_002969664.1|  hypothetical protein SELMODRAFT_92921              130   1e-32   
ref|XP_002981277.1|  hypothetical protein SELMODRAFT_114540             130   1e-32   
gb|KJB66094.1|  hypothetical protein B456_010G128200                    124   2e-30   Gossypium raimondii
ref|XP_004169964.1|  PREDICTED: uncharacterized protein LOC101228167    117   9e-30   
ref|XP_004142242.1|  PREDICTED: uncharacterized LOC101204258            117   2e-28   
ref|XP_001776337.1|  predicted protein                                  116   2e-27   
ref|XP_004152962.1|  PREDICTED: uncharacterized protein LOC101204258    109   4e-27   
ref|XP_002973220.1|  hypothetical protein SELMODRAFT_413759             113   2e-26   
ref|XP_004162028.1|  PREDICTED: uncharacterized LOC101204258            109   1e-25   
ref|XP_002976631.1|  hypothetical protein SELMODRAFT_416506             107   3e-24   Selaginella moellendorffii
gb|KJB66101.1|  hypothetical protein B456_010G128200                    105   4e-24   Gossypium raimondii
ref|XP_010466287.1|  PREDICTED: uncharacterized protein LOC104746495    103   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002973823.1|  hypothetical protein SELMODRAFT_414190             102   2e-22   
gb|EYU46307.1|  hypothetical protein MIMGU_mgv1a0096473mg             58.9    8e-09   Erythranthe guttata [common monkey flower]
gb|KIH93169.1|  hypothetical protein SPBR_02922                       63.5    9e-09   Sporothrix brasiliensis 5110
ref|XP_003347717.1|  hypothetical protein SMAC_03815                  62.8    2e-08   Sordaria macrospora k-hell
gb|ERT01696.1|  hypothetical protein HMPREF1624_02949                 62.8    2e-08   Sporothrix schenckii ATCC 58251
ref|XP_960192.1|  NAD-binding Rossmann fold oxidoreductase            62.4    2e-08   Neurospora crassa OR74A
gb|KHE80312.1|  NAD(P)-binding protein                                62.4    2e-08   Neurospora crassa
gb|EKV16143.1|  Oxidoreductase family, NAD-binding Rossmann fold ...  61.6    5e-08   Penicillium digitatum Pd1
gb|KGO75187.1|  Oxidoreductase, N-terminal                            61.2    8e-08   Penicillium italicum
gb|EFQ28397.1|  oxidoreductase family protein                         60.1    1e-07   Colletotrichum graminicola M1.001
gb|KEQ84242.1|  NAD(P)-binding protein                                60.1    2e-07   Aureobasidium pullulans EXF-150
emb|CDM31202.1|  NAD(P)-binding domain                                59.3    3e-07   Penicillium roqueforti FM164
gb|KEQ61018.1|  oxidoreductase-like protein family                    58.9    3e-07   Aureobasidium melanogenum CBS 110374
gb|KEQ74017.1|  NAD(P)-binding protein                                58.5    5e-07   Aureobasidium namibiae CBS 147.97
dbj|GAA91490.1|  oxidoreductase family, NAD-binding Rossmann fold...  58.2    5e-07   Aspergillus kawachii IFO 4308
ref|XP_001397204.1|  NAD-binding Rossmann fold oxidoreductase fam...  58.2    6e-07   Aspergillus niger CBS 513.88
ref|XP_009854174.1|  hypothetical protein NEUTE1DRAFT_131795          58.2    7e-07   Neurospora tetrasperma FGSC 2508
gb|KEQ94380.1|  hypothetical protein AUEXF2481DRAFT_270651            57.8    1e-06   Aureobasidium subglaciale EXF-2481
gb|KGO40526.1|  Oxidoreductase, N-terminal                            56.6    2e-06   Penicillium expansum
ref|XP_011117421.1|  hypothetical protein AOL_s00004g470              55.1    8e-06   Arthrobotrys oligospora ATCC 24927
ref|XP_001275918.1|  NAD-binding Rossmann fold oxidoreductase fam...  54.7    8e-06   Aspergillus clavatus NRRL 1
ref|XP_001906379.1|  hypothetical protein                             53.9    2e-05   Podospora anserina S mat+
ref|XP_001261103.1|  hypothetical protein NFIA_091650                 53.5    2e-05   Aspergillus fischeri NRRL 181
gb|KIR46111.1|  NAD-binding Rossmann fold oxidoreductase              53.1    3e-05   Cryptococcus gattii CA1280
gb|KIR84978.1|  NAD-binding Rossmann fold oxidoreductase              53.1    3e-05   Cryptococcus gattii VGIV IND107
gb|KIK67859.1|  hypothetical protein GYMLUDRAFT_36656                 53.1    4e-05   Gymnopus luxurians FD-317 M1
gb|KIR51601.1|  NAD-binding Rossmann fold oxidoreductase              52.8    5e-05   Cryptococcus gattii Ru294
ref|XP_571074.1|  hypothetical protein                                52.8    5e-05   Cryptococcus neoformans var. neoformans JEC21
gb|KIL66602.1|  hypothetical protein M378DRAFT_74962                  52.4    5e-05   Amanita muscaria Koide BX008
ref|XP_002956633.1|  hypothetical protein VOLCADRAFT_119466           52.4    6e-05   Volvox carteri f. nagariensis
ref|XP_003194439.1|  hypothetical protein CGB_E5470C                  52.4    6e-05   Cryptococcus gattii WM276
gb|KGB79428.1|  hypothetical protein CNBG_5266                        52.4    7e-05   Cryptococcus gattii VGII R265
gb|KIR28998.1|  NAD-binding Rossmann fold oxidoreductase              52.4    7e-05   Cryptococcus gattii VGII LA55
gb|KIR99656.1|  NAD-binding Rossmann fold oxidoreductase              52.0    7e-05   Cryptococcus gattii VGII 2001/935-1
gb|KJB66100.1|  hypothetical protein B456_010G128200                  50.4    1e-04   Gossypium raimondii
gb|EHK24126.1|  hypothetical protein TRIVIDRAFT_45259                 51.2    1e-04   Trichoderma virens Gv29-8
ref|XP_003840030.1|  similar to oxidoreductase family                 51.2    2e-04   Leptosphaeria maculans JN3
gb|AFR95702.1|  NAD-binding Rossmann fold oxidoreductase              50.8    2e-04   Cryptococcus neoformans var. grubii H99
gb|EJT52097.1|  hypothetical protein A1Q1_06635                       50.8    2e-04   Trichosporon asahii var. asahii CBS 2479
ref|XP_002626131.1|  NAD-binding Rossmann fold oxidoreductase         50.4    3e-04   Blastomyces gilchristii SLH14081
gb|EQL35203.1|  hypothetical protein BDFG_03181                       50.1    3e-04   Blastomyces dermatitidis ATCC 26199
dbj|GAD91687.1|  hypothetical protein NFIA_091650                     48.9    3e-04   Byssochlamys spectabilis No. 5
gb|EGE83963.1|  NAD-binding Rossmann fold oxidoreductase              50.1    3e-04   Blastomyces dermatitidis ATCC 18188
gb|EKD02419.1|  hypothetical protein A1Q2_03311                       50.1    3e-04   Trichosporon asahii var. asahii CBS 8904
gb|EEQ92492.1|  NAD-binding Rossmann fold oxidoreductase              50.1    4e-04   Blastomyces dermatitidis ER-3
gb|KIL66581.1|  hypothetical protein M378DRAFT_123742                 50.1    4e-04   Amanita muscaria Koide BX008
ref|XP_002567221.1|  Pc21g01510                                       49.3    7e-04   Penicillium rubens Wisconsin 54-1255



>ref|XP_009588958.1| PREDICTED: uncharacterized protein YMR315W [Nicotiana tomentosiformis]
Length=361

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA+SQ+PQIAILG+GIFVKTQYIPRLAEI  LFVL+AIWSRSEESARSAVE+AR HFP+V
Sbjct  1    MAQSQVPQIAILGAGIFVKTQYIPRLAEIPDLFVLRAIWSRSEESARSAVEIARKHFPDV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            ECKWG AGLE+IIKD+SI GVAVV+AGQT V+MSL+LLK GKHVLQEKPAAA + EAE A
Sbjct  61   ECKWGDAGLEDIIKDSSITGVAVVLAGQTMVDMSLKLLKAGKHVLQEKPAAATVDEAETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L HYNSLST +T +PIWAVAENYRFEPAF E KK+I+EIG+MMN+QVI+EG+MNSSNPYF
Sbjct  121  LTHYNSLSTTLTHQPIWAVAENYRFEPAFIEGKKLISEIGEMMNIQVIVEGSMNSSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>ref|XP_004228627.1| PREDICTED: uncharacterized oxidoreductase C26H5.09c [Solanum 
lycopersicum]
Length=359

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +QLPQIAILG+GIFVKTQYIPRLAEIS LF+L+AIWSR+EES RSAVE+A+ HFPNVECK
Sbjct  2    AQLPQIAILGAGIFVKTQYIPRLAEISNLFILRAIWSRTEESVRSAVEIAQKHFPNVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG AGLEEIIKD+SI GVAVV+AGQT V+MSLRLLK GKHVLQEKPAA  + EAE AL H
Sbjct  62   WGDAGLEEIIKDSSITGVAVVLAGQTMVDMSLRLLKAGKHVLQEKPAAPTVDEAEKALTH  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            YNSLST +TQ+PIWAVAENYRFEPAF E K++I+EIG+MMN+QVI+EG MNSSNPYF+SS
Sbjct  122  YNSLSTTLTQQPIWAVAENYRFEPAFIEGKRLISEIGEMMNIQVIVEGAMNSSNPYFASS  181

Query  585  W  587
            W
Sbjct  182  W  182



>ref|XP_009773348.1| PREDICTED: uncharacterized protein LOC104223588 [Nicotiana sylvestris]
Length=361

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA+SQ+PQIAILG+GIFVKTQYIPRLAEI  LFVL+AIWSRSEESARSAVE+AR HFP+V
Sbjct  1    MAQSQVPQIAILGAGIFVKTQYIPRLAEIPHLFVLRAIWSRSEESARSAVEIARKHFPDV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            ECKWG AGLE+IIKD+SI GVAVV+AGQT V+MSLRLLK GKHVLQEKPAAA + EAE A
Sbjct  61   ECKWGDAGLEDIIKDSSITGVAVVLAGQTMVDMSLRLLKAGKHVLQEKPAAATVDEAETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L HYNSLS  +T +P+WAVAENYRFEPAF E +K+I+EIG+MMN+QVI+EG+MN+SNPYF
Sbjct  121  LTHYNSLSATLTHQPLWAVAENYRFEPAFIEGRKLISEIGEMMNIQVIVEGSMNNSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>ref|XP_006348416.1| PREDICTED: uncharacterized protein YMR315W-like [Solanum tuberosum]
Length=359

 Score =   233 bits (595),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +Q PQIAILG+GIFVKTQYIPRLAEIS LF+L+AIWSR+EESARSAVE+A+ HFPNVECK
Sbjct  2    AQHPQIAILGAGIFVKTQYIPRLAEISNLFILRAIWSRTEESARSAVEIAQKHFPNVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG AGLEEIIKD+SI GVAVV+AGQT V+MSLRLLK GKHVLQEKPA+A + EAE AL H
Sbjct  62   WGDAGLEEIIKDSSITGVAVVLAGQTMVDMSLRLLKAGKHVLQEKPASATVDEAEKALTH  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            YNSLS  +TQ+PIWAVAENYRFEPAF E K++I+EIG+MMN+Q+I+EG MNSSNPYF+SS
Sbjct  122  YNSLSATLTQQPIWAVAENYRFEPAFIEGKRLISEIGEMMNIQIIVEGAMNSSNPYFASS  181

Query  585  W  587
            W
Sbjct  182  W  182



>ref|XP_010651284.1| PREDICTED: uncharacterized protein LOC100245027 isoform X3 [Vitis 
vinifera]
Length=309

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+EII D+SI GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65   DGLDEIINDSSITGVAVVLAGQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EG+MNSSNPYFSSSW
Sbjct  125  ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSW  182



>ref|XP_010651283.1| PREDICTED: uncharacterized protein LOC100245027 isoform X2 [Vitis 
vinifera]
Length=322

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+EII D+SI GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65   DGLDEIINDSSITGVAVVLAGQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EG+MNSSNPYFSSSW
Sbjct  125  ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSW  182



>gb|KCW51233.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=270

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  57   QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  236
            QIAILG+GIFV+TQYIPRLAEISQL ++K+IWSR++ESA  AVE+AR HFP VECKWG  
Sbjct  6    QIAILGAGIFVRTQYIPRLAEISQLVLVKSIWSRTQESATGAVEIARKHFPEVECKWGDE  65

Query  237  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  416
            GL+EII+D SI  VAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA   + E AL  Y +L
Sbjct  66   GLDEIIRDDSIPAVAVVLAGQAQVEMSLRLLKAGKHVLQEKPAAASTTDIEMALSRYRAL  125

Query  417  STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
              +   KPIWAVAENYRFEPAF ECKK++A+IGDMMNVQVI+EG+MNSSNPYFSSSW
Sbjct  126  CASSPSKPIWAVAENYRFEPAFVECKKLLADIGDMMNVQVIVEGSMNSSNPYFSSSW  182



>emb|CBI16434.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+EII D+SI GVAVV+AGQ +VEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65   DGLDEIINDSSITGVAVVLAGQMKVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EG+MNSSNPYFSSSW
Sbjct  125  ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSW  182



>ref|XP_008449757.1| PREDICTED: uncharacterized protein YMR315W [Cucumis melo]
Length=355

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++AR +FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARKYFPTVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG AGL++II+D SI+GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA  +E E AL +
Sbjct  62   WGDAGLDDIIQDNSILGVAVVLAGQAQVEMSLRLLKAGKHVLQEKPAAASTSELEYALSN  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            YNSLS N  ++P+WAVAENYRFEPA  ECK +IA++GDMM+VQVI+EG+MNSSNPYFSSS
Sbjct  122  YNSLSANFLRQPLWAVAENYRFEPALVECKNLIADVGDMMSVQVIVEGSMNSSNPYFSSS  181

Query  585  W  587
            W
Sbjct  182  W  182



>ref|XP_002285606.1| PREDICTED: uncharacterized protein LOC100245027 isoform X1 [Vitis 
vinifera]
Length=359

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+EII D+SI GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65   DGLDEIINDSSITGVAVVLAGQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EG+MNSSNPYFSSSW
Sbjct  125  ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSW  182



>ref|XP_002513445.1| oxidoreductase, putative [Ricinus communis]
 gb|EEF48848.1| oxidoreductase, putative [Ricinus communis]
Length=359

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIAILG+GIFV+TQYIPRLAEIS LFVLKA+WSRSEESA+ AVE+AR HFP VECKWG 
Sbjct  5    PQIAILGAGIFVRTQYIPRLAEISNLFVLKAVWSRSEESAQGAVEIARKHFPGVECKWGD  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+EII D SI+ VAVV+AGQTQV+MSL+LLK GKHVLQEKPAAA I+E E AL  Y S
Sbjct  65   EGLDEIIHDHSILAVAVVLAGQTQVDMSLKLLKAGKHVLQEKPAAASISELEIALSSYKS  124

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            L  N   +PIWAVAENYRFEPAF EC+K++AEIGDMM VQVI+EG+MNSSNPYFSSSW
Sbjct  125  LCANSPGQPIWAVAENYRFEPAFVECRKLLAEIGDMMTVQVIVEGSMNSSNPYFSSSW  182



>ref|XP_010031848.1| PREDICTED: uncharacterized protein YMR315W [Eucalyptus grandis]
 gb|KCW51232.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=359

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  57   QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  236
            QIAILG+GIFV+TQYIPRLAEISQL ++K+IWSR++ESA  AVE+AR HFP VECKWG  
Sbjct  6    QIAILGAGIFVRTQYIPRLAEISQLVLVKSIWSRTQESATGAVEIARKHFPEVECKWGDE  65

Query  237  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  416
            GL+EII+D SI  VAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA   + E AL  Y +L
Sbjct  66   GLDEIIRDDSIPAVAVVLAGQAQVEMSLRLLKAGKHVLQEKPAAASTTDIEMALSRYRAL  125

Query  417  STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
              +   KPIWAVAENYRFEPAF ECKK++A+IGDMMNVQVI+EG+MNSSNPYFSSSW
Sbjct  126  CASSPSKPIWAVAENYRFEPAFVECKKLLADIGDMMNVQVIVEGSMNSSNPYFSSSW  182



>emb|CDP14087.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +QLP IAI+G+GIFVKTQYIPRLAEIS LFVLKAIWSRSEESAR AVE+AR  FP VECK
Sbjct  2    AQLPNIAIIGAGIFVKTQYIPRLAEISNLFVLKAIWSRSEESARGAVEVARKFFPEVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL+EIIKD+SIIGVAVV+AGQ QV+MSLRLLK GKHVLQEKPA A I EAE AL  
Sbjct  62   WGDGGLDEIIKDSSIIGVAVVLAGQIQVDMSLRLLKEGKHVLQEKPATASIDEAEAALSS  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y+SL T++  +P+WAVAENYRFEPAF E KK++AE+GD+M++QVIIEG+M SSNPYFSSS
Sbjct  122  YHSLRTHLPFQPVWAVAENYRFEPAFEESKKLMAEVGDVMSIQVIIEGSMTSSNPYFSSS  181

Query  585  W  587
            W
Sbjct  182  W  182



>emb|CAN75498.1| hypothetical protein VITISV_020272 [Vitis vinifera]
Length=364

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 140/178 (79%), Gaps = 13/178 (7%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5    PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+EII D+SI GVAVV       EMSLRLLK GKHVLQ    A         L HYNS
Sbjct  65   DGLDEIINDSSITGVAVV-------EMSLRLLKAGKHVLQAISEAETA------LSHYNS  111

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EG+MNSSNPYFSSSW
Sbjct  112  ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSW  169



>gb|KFK39395.1| hypothetical protein AALP_AA3G239500 [Arabis alpina]
Length=356

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            S  P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESAR AVE+AR HFP V+CK
Sbjct  5    SSPPGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESARGAVEIARKHFPEVKCK  64

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL EII+D+SI+GVAVVVAG +QVEMSLR+LK GKHVLQEKPAAA I+E E A+  
Sbjct  65   WGDEGLNEIIQDSSIVGVAVVVAGHSQVEMSLRMLKAGKHVLQEKPAAASISEIETAMSS  124

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y ++S + T+ PIWAVAENYRFEPAF E KK+I EIGDMMNVQ+IIEG+MNSSNPYFSSS
Sbjct  125  YKNISADSTRCPIWAVAENYRFEPAFVELKKLIGEIGDMMNVQLIIEGSMNSSNPYFSSS  184

Query  585  W  587
            W
Sbjct  185  W  185



>ref|XP_009364727.1| PREDICTED: uncharacterized protein LOC103954617 [Pyrus x bretschneideri]
Length=357

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PQIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GLEEII D+SI+GVAVV+AGQ QV+ SLR+LKGGKHVLQEKPAAA  +E E AL  Y S
Sbjct  63   KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKGGKHVLQEKPAAASTSELETALSSYKS  122

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  N   KPIWAVAENYRFEPAF E +K++ E+GD+M++QVI+EG+MNSSNPYFSSSW
Sbjct  123  IVDNAPDKPIWAVAENYRFEPAFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSW  180



>ref|XP_007014900.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
 gb|EOY32519.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
Length=344

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIA+LG+GIFVKTQYIPRLAEIS L  LK IWSR++ESAR AVELA+ HFP VECKWG 
Sbjct  5    PQIAVLGAGIFVKTQYIPRLAEISHLLCLKYIWSRTQESARGAVELAKQHFPGVECKWGD  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL +II+D SI+GVAVV+AGQ QV+MSL+LLKGGKHV+QEKPAAA   E E AL  Y S
Sbjct  65   QGLNDIIQDASILGVAVVLAGQAQVDMSLKLLKGGKHVIQEKPAAASTTETETALSSYKS  124

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            + +N  Q PIWAVAENYRFEPAF E KK+IA+IGDMMNVQ+IIEG+MNSSNPYFSSSW
Sbjct  125  ICSNPGQ-PIWAVAENYRFEPAFVESKKLIADIGDMMNVQIIIEGSMNSSNPYFSSSW  181



>emb|CDY19604.1| BnaA05g20120D [Brassica napus]
Length=347

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA +  P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1    MANASPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            ECKWG  GL EII+D+SI+GVAVV+AGQTQVEMSL++LK GKHVLQEKPAAA I E E A
Sbjct  61   ECKWGDEGLNEIIQDSSILGVAVVIAGQTQVEMSLKMLKAGKHVLQEKPAAASIGEIETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            +  Y ++S++   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEG+MNSSNPYF
Sbjct  121  MTSYKNISSDSPCRPIWAVAENYRFEPAFVELKKLVEEIGDMMNVQLIIEGSMNSSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>ref|XP_007014899.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
 gb|EOY32518.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
Length=358

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIA+LG+GIFVKTQYIPRLAEIS L  LK IWSR++ESAR AVELA+ HFP VECKWG 
Sbjct  5    PQIAVLGAGIFVKTQYIPRLAEISHLLCLKYIWSRTQESARGAVELAKQHFPGVECKWGD  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL +II+D SI+GVAVV+AGQ QV+MSL+LLKGGKHV+QEKPAAA   E E AL  Y S
Sbjct  65   QGLNDIIQDASILGVAVVLAGQAQVDMSLKLLKGGKHVIQEKPAAASTTETETALSSYKS  124

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            + +N  Q PIWAVAENYRFEPAF E KK+IA+IGDMMNVQ+IIEG+MNSSNPYFSSSW
Sbjct  125  ICSNPGQ-PIWAVAENYRFEPAFVESKKLIADIGDMMNVQIIIEGSMNSSNPYFSSSW  181



>gb|ACU17312.1| unknown [Glycine max]
Length=225

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA  QLPQIAILG+GIFVKTQY+PRL+EIS LF+LK+IWSR++ESA +AV++AR HFP V
Sbjct  1    MATKQLPQIAILGAGIFVKTQYLPRLSEISHLFILKSIWSRTQESATAAVDIARKHFPQV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            E KWG  G ++II D SI  VAVV+AGQ QV++SLRLLK GKHVLQEKPAA+C +E E A
Sbjct  61   ETKWGDNGFDDIIHDGSIDAVAVVLAGQNQVDISLRLLKAGKHVLQEKPAASCTSELEAA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L  Y S+S++   + IW+VAENYRFEP   ECKK+IA IG MM+VQVIIEG+MNSSNPYF
Sbjct  121  LSSYKSISSDAPGQLIWSVAENYRFEPGLVECKKLIAGIGKMMSVQVIIEGSMNSSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>ref|XP_009145584.1| PREDICTED: uncharacterized protein YMR315W [Brassica rapa]
Length=355

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA +  P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1    MANASPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            ECKWG  GL EII+D+SI+GVAVV+AGQTQVEMSL++LK GKHVLQEKPAAA I E E A
Sbjct  61   ECKWGDEGLNEIIQDSSILGVAVVIAGQTQVEMSLKMLKVGKHVLQEKPAAASIGEIETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            +  Y ++ST+   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEG+MNSSNPYF
Sbjct  121  MTSYKNISTDSPCRPIWAVAENYRFEPAFVELKKLVEEIGDMMNVQLIIEGSMNSSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>ref|XP_006298014.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
 gb|EOA30912.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
Length=355

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V+CKWG 
Sbjct  6    PGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEIARKHFPDVKCKWGD  65

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL EI++D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A++ Y  
Sbjct  66   EGLNEIMEDSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIEAAMLSYRI  125

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +S +   +PIWAVAENYRFEPAF E KK+IAEIGDMMNVQ+IIEG+MNSSNPYFSSSW
Sbjct  126  ISADTPCRPIWAVAENYRFEPAFVELKKLIAEIGDMMNVQLIIEGSMNSSNPYFSSSW  183



>ref|XP_009364714.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
 ref|XP_009364715.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
Length=357

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PQIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GLEEII D+SI+GVAVV+AGQ QV+ SLR+LKGGKHVLQEKPAAA  +E E AL  Y S
Sbjct  63   KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKGGKHVLQEKPAAASTSELETALSSYKS  122

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  N   KPIWAVAENYRFEP F E +K++ E+GD+M++QVI+EG+MNSSNPYFSSSW
Sbjct  123  IVDNAPDKPIWAVAENYRFEPTFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSW  180



>emb|CDY06381.1| BnaC05g31490D [Brassica napus]
Length=348

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA    P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1    MANPSPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            ECKWG  GL EII+DTSI+GVAVV+AGQTQVEMSL++LK GKHVLQEKPAAA I E E A
Sbjct  61   ECKWGDEGLNEIIQDTSILGVAVVIAGQTQVEMSLKMLKAGKHVLQEKPAAASIGEIETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            +  Y ++ST+   +PIWAVAENYRFEPAF E KK++ EIGD+MNVQ+IIEG+MNSSNPYF
Sbjct  121  MTSYKNISTDSPCRPIWAVAENYRFEPAFVELKKLVEEIGDIMNVQLIIEGSMNSSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>gb|KJB66097.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=357

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEG+MNSSNPYFSSS
Sbjct  122  YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  180

Query  585  W  587
            W
Sbjct  181  W  181



>gb|KJB66095.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEG+MNSSNPYFSSS
Sbjct  122  YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  180

Query  585  W  587
            W
Sbjct  181  W  181



>gb|KJB66099.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEG+MNSSNPYFSSS
Sbjct  122  YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  180

Query  585  W  587
            W
Sbjct  181  W  181



>ref|XP_010091995.1| Uncharacterized protein L484_007981 [Morus notabilis]
 gb|EXB48401.1| Uncharacterized protein L484_007981 [Morus notabilis]
Length=352

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 145/181 (80%), Gaps = 6/181 (3%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            ++ PQIAI+G+GIFV+TQYIPRL+EIS L  LKAIWSRSEESAR AVE+A+  FP VECK
Sbjct  2    AKAPQIAIVGAGIFVRTQYIPRLSEISDLVSLKAIWSRSEESARGAVEIAQKFFPGVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  G +EI++D SI+GVAVV+AGQ QV+ SLRLLK GKHVLQ              L  
Sbjct  62   WGDKGFDEIVQDNSILGVAVVLAGQAQVDFSLRLLKAGKHVLQATSELEAA------LAG  115

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            YNS+S N+  KPIWAVAENYRFEPAF E KK++AE+GDMM+VQVIIEG+MNSSNPYFSSS
Sbjct  116  YNSISVNVPSKPIWAVAENYRFEPAFVESKKLVAEVGDMMSVQVIIEGSMNSSNPYFSSS  175

Query  585  W  587
            W
Sbjct  176  W  176



>ref|XP_010488066.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=355

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            M     P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V
Sbjct  1    MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLLVLKAIWSRTEESAKGAVEIARKHFPDV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            +CKWG  GL EII D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A
Sbjct  61   KCKWGDEGLNEIIADSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            +  Y ++S +   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEG+MNSSNPYF
Sbjct  121  MSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLVVEIGDMMNVQLIIEGSMNSSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>gb|KDP20201.1| hypothetical protein JCGZ_07921 [Jatropha curcas]
Length=359

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P +AILG+GIFV+TQY+PRLAEIS LFVLKAIWSR+EESAR AVE+AR HFP VE KWG 
Sbjct  5    PHLAILGAGIFVRTQYLPRLAEISDLFVLKAIWSRTEESAREAVEIARKHFPGVEYKWGD  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+EII+D SI+GVAVV+AGQ QV++SL+LLK GKHVLQEKPAAA  +E E AL  Y S
Sbjct  65   KGLDEIIQDESILGVAVVLAGQAQVDISLKLLKAGKHVLQEKPAAASASEIETALSSYKS  124

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  N   +PIWAVAENYRFEPAF ECKK++AEIGDMM V+VI+EG+MNS+NPYFSSSW
Sbjct  125  IYANSPGQPIWAVAENYRFEPAFVECKKLLAEIGDMMTVEVIVEGSMNSANPYFSSSW  182



>ref|XP_010509356.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=354

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V+CKWG 
Sbjct  6    PGIAILGAGIFVKTQYIPRLAEISDLLVLKAIWSRTEESAKGAVEIARKHFPDVKCKWGD  65

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL EII+D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A+  Y  
Sbjct  66   EGLNEIIEDSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIETAMSSYRE  125

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +S +   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEG+MNSSNPYFSSSW
Sbjct  126  ISADSPCRPIWAVAENYRFEPAFVELKKLMVEIGDMMNVQLIIEGSMNSSNPYFSSSW  183



>ref|XP_002883268.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59527.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=360

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP V+CKWG 
Sbjct  6    PGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEIARKHFPEVKCKWGD  65

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL EII+D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  66   DGLNEIIQDSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIETAMSSYRN  125

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +S +   +PIWAVAENYRFEPAF E KK+IAE GDMMNVQ+IIEG+MNSSNPYFSSSW
Sbjct  126  ISADSPCRPIWAVAENYRFEPAFVELKKLIAETGDMMNVQLIIEGSMNSSNPYFSSSW  183



>ref|XP_008358862.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
 ref|XP_008358863.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
Length=357

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P IAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PHIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GLEEII D+SI+GVAVV+AGQ QV+ SLR+LK GKHVLQEKPAAA  +E E AL  Y S
Sbjct  63   KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKAGKHVLQEKPAAASTSELETALSSYKS  122

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  N   KPIWAVAENYRFEPAF E +K++ E+GD+M++QVI+EG+MNSSNPYFSSSW
Sbjct  123  IVDNAPDKPIWAVAENYRFEPAFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSW  180



>ref|XP_006406349.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
 gb|ESQ47802.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
Length=356

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP V+CKWG 
Sbjct  7    PAIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEVARKHFPEVKCKWGD  66

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL EII+D+SI+GVAVVVAGQ QVEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  67   EGLNEIIQDSSIVGVAVVVAGQNQVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYRN  126

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  +   +PIWAVAENYRFEPAF E KK++AE GDMMNVQ+IIEG+MNSSNPYFSSSW
Sbjct  127  IPADSPSRPIWAVAENYRFEPAFVELKKLVAETGDMMNVQLIIEGSMNSSNPYFSSSW  184



>dbj|BAB02487.1| unnamed protein product [Arabidopsis thaliana]
Length=316

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            M     P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1    MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLVDLKAIWSRTEESAKGAVEIARKHFPEV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            +CKWG  GL EII+D+SI+GVAVVVA +T VE+SL++LK GKHVLQEKPAAA I+E E A
Sbjct  61   KCKWGDEGLNEIIQDSSIVGVAVVVAAETMVELSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            +  Y ++S +   +PIWAVAENYRFEPAF E KK+IAEIGDMMNVQ+IIEG+MNSSNPYF
Sbjct  121  MSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLIAEIGDMMNVQLIIEGSMNSSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>ref|XP_011025252.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Populus 
euphratica]
Length=359

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE +MNS+NPYFSSS
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  585  W  587
            W
Sbjct  183  W  183



>ref|XP_011025251.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Populus 
euphratica]
Length=360

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE +MNS+NPYFSSS
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  585  W  587
            W
Sbjct  183  W  183



>ref|XP_006386095.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63892.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=360

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE +MNS+NPYFSSS
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  585  W  587
            W
Sbjct  183  W  183



>ref|XP_008243595.1| PREDICTED: uncharacterized protein YMR315W [Prunus mume]
Length=360

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = +3

Query  48   QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW  227
            ++PQIAILG+G F++TQYIPRLAEIS+L +LK+IWSR+EESAR AVE+A+ HFP VECKW
Sbjct  3    EVPQIAILGAGTFMRTQYIPRLAEISKLLLLKSIWSRTEESARGAVEIAQEHFPGVECKW  62

Query  228  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  407
            G  GL+EII+D+SI+GVAVV+AGQ QV+ SLRLLK GKHVLQEKPAAA  +E E AL  Y
Sbjct  63   GDKGLQEIIEDSSILGVAVVLAGQAQVDFSLRLLKAGKHVLQEKPAAASTSELETALSSY  122

Query  408  NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
             S+  N+  KPIWAVAENYRFEPAF E KK++ +IGD+M++QVI+EG+MNSSNPYFSSSW
Sbjct  123  RSIFANIPDKPIWAVAENYRFEPAFVEGKKLVNDIGDVMSIQVIVEGSMNSSNPYFSSSW  182



>ref|XP_006386094.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63891.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=359

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE +MNS+NPYFSSS
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  585  W  587
            W
Sbjct  183  W  183



>gb|ABK96297.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3    NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63   WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE +MNS+NPYFSSS
Sbjct  123  YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  585  W  587
            W
Sbjct  183  W  183



>ref|NP_188715.2| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAM12966.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15398.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76423.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            M     P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1    MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLVDLKAIWSRTEESAKGAVEIARKHFPEV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            +CKWG  GL EII+D+SI+GVAVVVA +T VE+SL++LK GKHVLQEKPAAA I+E E A
Sbjct  61   KCKWGDEGLNEIIQDSSIVGVAVVVAAETMVELSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            +  Y ++S +   +PIWAVAENYRFEPAF E KK+IAEIGDMMNVQ+IIEG+MNSSNPYF
Sbjct  121  MSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLIAEIGDMMNVQLIIEGSMNSSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>ref|XP_003543553.1| PREDICTED: uncharacterized protein YMR315W [Glycine max]
 gb|KHN30111.1| Hypothetical protein glysoja_010489 [Glycine soja]
Length=360

 Score =   202 bits (515),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA  QLPQIAILG+GIFVKTQY+PRL+EIS LF+LK+IWSR++ESA +AV++AR HFP V
Sbjct  1    MATKQLPQIAILGAGIFVKTQYLPRLSEISHLFILKSIWSRTQESATAAVDIARKHFPQV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            E KWG  G ++II D SI  VAVV+AGQ QV++SLRLLK GKHVLQEKPAA+C +E E A
Sbjct  61   ETKWGDNGFDDIIHDGSIDAVAVVLAGQNQVDISLRLLKAGKHVLQEKPAASCTSELEAA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L  Y S+S++   + IW+VAENYRFEP   ECKK+IA IG MM+VQVIIEG+MNSSNPYF
Sbjct  121  LSSYKSISSDAPGQLIWSVAENYRFEPGLVECKKLIAGIGKMMSVQVIIEGSMNSSNPYF  180

Query  576  SSSW  587
            SSSW
Sbjct  181  SSSW  184



>ref|XP_010544236.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Tarenaya 
hassleriana]
Length=355

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P +AILG+GIFV+TQYIPRLAEIS LFVL+AIWSR+EESA+ AVE+AR HFP+VECKWG 
Sbjct  6    PGLAILGAGIFVRTQYIPRLAEISDLFVLRAIWSRTEESAKGAVEIARKHFPDVECKWGE  65

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+EII+D SI+GV VV+AGQ QVEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  66   EGLDEIIRDNSIVGVGVVLAGQIQVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYKN  125

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +ST      IWAVAENYRFEPAF E KK++ EIG MMNVQ+I+EG+MNSSNPYFSSSW
Sbjct  126  ISTGSPSPSIWAVAENYRFEPAFVELKKLVGEIGTMMNVQLIVEGSMNSSNPYFSSSW  183



>ref|XP_010544235.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Tarenaya 
hassleriana]
Length=356

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P +AILG+GIFV+TQYIPRLAEIS LFVL+AIWSR+EESA+ AVE+AR HFP+VECKWG 
Sbjct  6    PGLAILGAGIFVRTQYIPRLAEISDLFVLRAIWSRTEESAKGAVEIARKHFPDVECKWGE  65

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+EII+D SI+GV VV+AGQ QVEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  66   EGLDEIIRDNSIVGVGVVLAGQIQVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYKN  125

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +ST      IWAVAENYRFEPAF E KK++ EIG MMNVQ+I+EG+MNSSNPYFSSSW
Sbjct  126  ISTGSPSPSIWAVAENYRFEPAFVELKKLVGEIGTMMNVQLIVEGSMNSSNPYFSSSW  183



>ref|XP_007205433.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
 gb|EMJ06632.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
Length=356

 Score =   202 bits (513),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = +3

Query  48   QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW  227
            + PQIAILG+G F++TQYIPRLAEIS+L +LK+IWSR+EESAR AVE+A+ HFP VECKW
Sbjct  3    EAPQIAILGAGTFMRTQYIPRLAEISKLLLLKSIWSRTEESARGAVEIAQKHFPGVECKW  62

Query  228  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  407
            G  GL+EII+D+SI+GVAVV+AGQ QV+ SLRLLK GKHVLQEKPAAA  +E E AL  Y
Sbjct  63   GDKGLQEIIEDSSILGVAVVLAGQAQVDFSLRLLKAGKHVLQEKPAAASTSELETALSSY  122

Query  408  NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
             S+  N+  KPIWAVAENYRFEPAF E KK++ +IGD+M++QV++EG+MNSSNPYFSSSW
Sbjct  123  RSIFANIPDKPIWAVAENYRFEPAFVEGKKLVNDIGDVMSIQVLVEGSMNSSNPYFSSSW  182



>ref|XP_006445972.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59212.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=219

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS
Sbjct  63   NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNS  122

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  +   +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EG+MNSSNPYFSSSW
Sbjct  123  ICPDPPGQPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSW  180



>ref|XP_006494722.1| PREDICTED: uncharacterized protein YMR315W-like [Citrus sinensis]
 gb|KDO64912.1| hypothetical protein CISIN_1g018445mg [Citrus sinensis]
Length=355

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GKHV+QEKPAAA I+E ENAL  YNS
Sbjct  63   NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKHVIQEKPAAANISEIENALSRYNS  122

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  +   +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EG+MNSSNPYFSSSW
Sbjct  123  ICPDPPGQPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSW  180



>gb|KJB66096.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=352

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 146/181 (81%), Gaps = 7/181 (4%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+Q  P           L  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQGIPEIETA------LAS  115

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEG+MNSSNPYFSSS
Sbjct  116  YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  174

Query  585  W  587
            W
Sbjct  175  W  175



>ref|XP_006445973.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59213.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=268

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS
Sbjct  63   NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNS  122

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  +   +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EG+MNSSNPYFSSSW
Sbjct  123  ICPDPPGQPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSW  180



>ref|XP_008358864.1| PREDICTED: uncharacterized protein YMR315W-like isoform X2 [Malus 
domestica]
Length=351

 Score =   199 bits (506),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 141/178 (79%), Gaps = 6/178 (3%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P IAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3    PHIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GLEEII D+SI+GVAVV+AGQ QV+ SLR+LK GKHVLQ              L  Y S
Sbjct  63   KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKAGKHVLQATSELETA------LSSYKS  116

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  N   KPIWAVAENYRFEPAF E +K++ E+GD+M++QVI+EG+MNSSNPYFSSSW
Sbjct  117  IVDNAPDKPIWAVAENYRFEPAFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSW  174



>gb|KJB66098.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=356

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62   WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+STN  Q PIWAVAENYRFEPAF E  K++A +GDMMNVQVIIEG+MNSSNPYFSSS
Sbjct  122  YKSVSTNPGQ-PIWAVAENYRFEPAFVE--KLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  178

Query  585  W  587
            W
Sbjct  179  W  179



>ref|XP_010257400.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010257401.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
Length=359

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  2    TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL+ II+D+S+ GVAVV+AGQTQV++SLRLL+ GKHVLQEKPAAA ++EA++AL  
Sbjct  62   WGDEGLDAIIQDSSLHGVAVVLAGQTQVDISLRLLRAGKHVLQEKPAAASVSEAKSALSC  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            YNSL  N  ++P+WAVAENYRFEPAF ECKK++ +IG+MM VQVI+EG+MNSSNPYFSSS
Sbjct  122  YNSLCANYPRQPLWAVAENYRFEPAFVECKKLMNDIGEMMCVQVIVEGSMNSSNPYFSSS  181

Query  585  W  587
            W
Sbjct  182  W  182



>ref|XP_006445974.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59214.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=355

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3    PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS
Sbjct  63   NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNS  122

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  +   +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EG+MNSSNPYFSSSW
Sbjct  123  ICPDPPGQPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSW  180



>ref|XP_011090402.1| PREDICTED: uncharacterized protein YMR315W-like [Sesamum indicum]
Length=358

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            PQIAILG+GIFVKT+YIPRL+EI  LFVLKAIWSR+EESAR AV++A+  FP VECKWG 
Sbjct  4    PQIAILGAGIFVKTEYIPRLSEIPDLFVLKAIWSRTEESARGAVDIAKKFFPRVECKWGD  63

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
            AGL EII+D SI+ V VV+A Q QV++SL+LL+ GKHVLQEKPAA+ I E + AL  YNS
Sbjct  64   AGLNEIIQDASIVAVLVVLAAQFQVDLSLKLLRSGKHVLQEKPAASSINEVKTALSSYNS  123

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            LST++ ++PIWA+AENYRFEPA  E KK++ +IGD++N Q+++E  MNSSNPYFSSSW
Sbjct  124  LSTSLPRQPIWAIAENYRFEPAILEGKKLMPDIGDLVNFQILVEAPMNSSNPYFSSSW  181



>ref|XP_011080243.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080244.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080245.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
Length=356

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 149/182 (82%), Gaps = 4/182 (2%)
 Frame = +3

Query  42   ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC  221
            E   PQIAI+G+GIFV+  YIPRLAEIS L VL+AIWSRSEESAR AVE A+  FPNVEC
Sbjct  2    EQTPPQIAIIGAGIFVRNTYIPRLAEISNLLVLRAIWSRSEESARGAVETAKKFFPNVEC  61

Query  222  KWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLM  401
            KWG AGLEEII+D SIIGVAVV+AGQ QV+MSLRLLK GKHVLQEKPAAA   E   A+ 
Sbjct  62   KWGEAGLEEIIQDASIIGVAVVLAGQAQVDMSLRLLKSGKHVLQEKPAAASGTELNAAIS  121

Query  402  HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSS  581
             Y+SL       PIWAVAENYRFEPAF E KK++AEIGD++N+ VIIEG+MNSSNPYFSS
Sbjct  122  SYSSLQP----APIWAVAENYRFEPAFVEGKKLMAEIGDVINIHVIIEGSMNSSNPYFSS  177

Query  582  SW  587
            SW
Sbjct  178  SW  179



>ref|XP_010257398.1| PREDICTED: uncharacterized protein LOC104597515 isoform X1 [Nelumbo 
nucifera]
Length=382

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  25   TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  84

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL+ II+D+S+ GVAVV+AGQTQV++SLRLL+ GKHVLQEKPAAA ++EA++AL  
Sbjct  85   WGDEGLDAIIQDSSLHGVAVVLAGQTQVDISLRLLRAGKHVLQEKPAAASVSEAKSALSC  144

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            YNSL  N  ++P+WAVAENYRFEPAF ECKK++ +IG+MM VQVI+EG+MNSSNPYFSSS
Sbjct  145  YNSLCANYPRQPLWAVAENYRFEPAFVECKKLMNDIGEMMCVQVIVEGSMNSSNPYFSSS  204

Query  585  W  587
            W
Sbjct  205  W  205



>ref|XP_011461910.1| PREDICTED: uncharacterized protein YMR315W [Fragaria vesca subsp. 
vesca]
Length=359

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 153/184 (83%), Gaps = 2/184 (1%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MAE+  PQIAI G+G FVKTQYIPRLAEIS L  LKAIWSRSEESAR AVE+AR HFP V
Sbjct  1    MAEA--PQIAICGAGTFVKTQYIPRLAEISNLVNLKAIWSRSEESARGAVEIARKHFPGV  58

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            ECKWG  GLEEII D+SI+GVAVV+AGQ QV+ SL+LL+ GK+VLQEKPAAA  +E E A
Sbjct  59   ECKWGDQGLEEIIADSSILGVAVVLAGQAQVDFSLKLLRAGKNVLQEKPAAATTSELEIA  118

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L  Y S+  N   KPIWA+AENYRFEPAF E KK++ EIGD+M++QVI+EG+MNSSNPYF
Sbjct  119  LSSYKSIVANTPNKPIWAIAENYRFEPAFVEGKKLMTEIGDVMSIQVIVEGSMNSSNPYF  178

Query  576  SSSW  587
            SSSW
Sbjct  179  SSSW  182



>ref|XP_010913920.1| PREDICTED: uncharacterized protein LOC105039462 isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  51   LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  230
            LPQIAI+G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8    LPQIAIIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPQVECKWG  67

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
             +GLE+II+D+SI GV VV+AGQ QV++SL++LK GKHV+QEKPAA   +EA+ AL  Y 
Sbjct  68   DSGLEDIIQDSSIKGVVVVLAGQVQVDISLKMLKMGKHVIQEKPAAESTSEADTALSRYK  127

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            SL  +   +PIWAVAENYRFEPAF E +K+I EIGDMMN+QVI+EG+MNSSNPYFSSSW
Sbjct  128  SLCDHFRSQPIWAVAENYRFEPAFVEARKLINEIGDMMNIQVIVEGSMNSSNPYFSSSW  186



>ref|XP_007150403.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
 gb|ESW22397.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
Length=383

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +++PQIAILG+GIFVK+QYIPRL+EIS LF LKAIWSRS+ESA +AVE+AR HFP VECK
Sbjct  27   TKVPQIAILGAGIFVKSQYIPRLSEISHLFHLKAIWSRSQESATAAVEVARKHFPGVECK  86

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GLE+II+D SI  VAVV+A Q QV++SLR+LK GKHVLQEKPAA+C +E E AL  
Sbjct  87   WGDCGLEDIIQDGSIDAVAVVLAVQNQVDISLRVLKAGKHVLQEKPAASCTSELETALSS  146

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y S+S +   + IW+VAENYRFE    ECKK+I  IG MM+VQVIIEG+MNSSNPYFSS+
Sbjct  147  YRSISADAPSQLIWSVAENYRFESGLLECKKLIGGIGKMMSVQVIIEGSMNSSNPYFSSN  206

Query  585  W  587
            W
Sbjct  207  W  207



>ref|XP_010913917.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913918.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913919.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
Length=364

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  51   LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  230
            LPQIAI+G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8    LPQIAIIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPQVECKWG  67

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
             +GLE+II+D+SI GV VV+AGQ QV++SL++LK GKHV+QEKPAA   +EA+ AL  Y 
Sbjct  68   DSGLEDIIQDSSIKGVVVVLAGQVQVDISLKMLKMGKHVIQEKPAAESTSEADTALSRYK  127

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            SL  +   +PIWAVAENYRFEPAF E +K+I EIGDMMN+QVI+EG+MNSSNPYFSSSW
Sbjct  128  SLCDHFRSQPIWAVAENYRFEPAFVEARKLINEIGDMMNIQVIVEGSMNSSNPYFSSSW  186



>ref|XP_009385566.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1 [Musa acuminata subsp. malaccensis]
Length=364

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = +3

Query  30   LPMAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFP  209
            +  +++  PQIAI+G+GIFV+TQYIPRL EI+   ++K+IWSR+EESA++A ELA++  P
Sbjct  1    MAASDAAPPQIAIIGAGIFVRTQYIPRLREIADHLIIKSIWSRTEESAKAAAELAQDFAP  60

Query  210  NVECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeae  389
            N+ECKWG +GLEEII+D+SI  VAVV+A Q QVE+SLR+LK GKHV+QEKPAA  ++EAE
Sbjct  61   NIECKWGDSGLEEIIQDSSITAVAVVLAAQVQVEISLRMLKAGKHVIQEKPAAGTVSEAE  120

Query  390  naLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNP  569
             A+  YNS   N   +P+WA+AENYRFEPAF E +K++ +IGDMM+VQVIIEG+MNSSNP
Sbjct  121  TAISCYNSFCNNFPHQPVWALAENYRFEPAFVESRKLLNDIGDMMHVQVIIEGSMNSSNP  180

Query  570  YFSSSW  587
            YFSSSW
Sbjct  181  YFSSSW  186



>gb|AFK46300.1| unknown [Lotus japonicus]
Length=359

 Score =   194 bits (494),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = +3

Query  42   ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC  221
            E++ P+IAILG+G FVK+QY+PRL+EIS LF+LKAIWSR++ESARSAVE+A  +F  VEC
Sbjct  2    ETKRPEIAILGAGTFVKSQYLPRLSEISHLFILKAIWSRTQESARSAVEIAHRNFAGVEC  61

Query  222  KWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLM  401
            KWG  GL++II D SI  VAVV+AGQ QVE+SLR+LK GKH+LQEKPAA+CI+E E AL 
Sbjct  62   KWGDDGLDDIIHDGSITAVAVVLAGQNQVEISLRMLKAGKHILQEKPAASCISELETALS  121

Query  402  HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSS  581
            +Y S+  +  ++ +W+VAENYRFEPA  ECKK+IA+IG MM+VQVIIEG+MNSSNPYFSS
Sbjct  122  NYKSICADAPRQLVWSVAENYRFEPALVECKKLIADIGKMMSVQVIIEGSMNSSNPYFSS  181

Query  582  SW  587
            SW
Sbjct  182  SW  183



>ref|XP_010257399.1| PREDICTED: uncharacterized protein LOC104597515 isoform X2 [Nelumbo 
nucifera]
Length=376

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 146/181 (81%), Gaps = 6/181 (3%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  25   TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  84

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG  GL+ II+D+S+ GVAVV+AGQTQV++SLRLL+ GKHVLQ    A         L  
Sbjct  85   WGDEGLDAIIQDSSLHGVAVVLAGQTQVDISLRLLRAGKHVLQAVSEAKSA------LSC  138

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            YNSL  N  ++P+WAVAENYRFEPAF ECKK++ +IG+MM VQVI+EG+MNSSNPYFSSS
Sbjct  139  YNSLCANYPRQPLWAVAENYRFEPAFVECKKLMNDIGEMMCVQVIVEGSMNSSNPYFSSS  198

Query  585  W  587
            W
Sbjct  199  W  199



>ref|XP_003577920.1| PREDICTED: uncharacterized protein LOC100827110 [Brachypodium 
distachyon]
Length=360

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = +3

Query  39   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  218
             E  LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSRS+ESA +AVELAR+  P++E
Sbjct  3    GEGDLPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRSQESAEAAVELARDFVPDIE  62

Query  219  CKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  398
            CKWG  GLEEI+ D SI+GVAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL
Sbjct  63   CKWGDVGLEEIMGDRSIMGVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAEAAL  122

Query  399  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFS  578
              YNS       KPIWA+AENYRFEPAF E  K++++IGDMMN+QVI+EG+MNSSNPYF+
Sbjct  123  SIYNSFPKQFPYKPIWALAENYRFEPAFVESNKLMSDIGDMMNIQVIVEGSMNSSNPYFN  182

Query  579  SSW  587
            SSW
Sbjct  183  SSW  185



>gb|KHG07862.1| Uncharacterized protein F383_13730 [Gossypium arboreum]
Length=353

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 138/182 (76%), Gaps = 8/182 (4%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavel-arNHFPNVEC  221
            + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSE+ +       A+ HFP VEC
Sbjct  2    ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEKESSRGAVEIAKQHFPGVEC  61

Query  222  KWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLM  401
            KWG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK  KHV+Q  P           L 
Sbjct  62   KWGDQGLNDIVQDSSLIGTAVVLAGQVQVDISLKLLKAAKHVIQGIPEIETA------LA  115

Query  402  HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSS  581
             Y S+ TN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEG+MNSSNPYFSS
Sbjct  116  SYKSVCTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSS  174

Query  582  SW  587
            SW
Sbjct  175  SW  176



>ref|XP_004956459.1| PREDICTED: uncharacterized protein YMR315W-like [Setaria italica]
Length=365

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = +3

Query  39   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  218
              + LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P +E
Sbjct  7    GRAGLPRIAVVGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPEIE  66

Query  219  CKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  398
            CKWG AGLEEI+ D+SI+GVAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL
Sbjct  67   CKWGDAGLEEIMGDSSIMGVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETAL  126

Query  399  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFS  578
              YNS       KPIWA+ ENYRFEPAF E  K+I +IGDMMN+QVIIEG+MNSSNPYF+
Sbjct  127  SIYNSFPNQFPYKPIWALGENYRFEPAFVESSKLIKDIGDMMNIQVIIEGSMNSSNPYFN  186

Query  579  SSW  587
            SSW
Sbjct  187  SSW  189



>ref|XP_008787293.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787294.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787295.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787297.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787298.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787299.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787300.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
Length=364

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  51   LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  230
            LPQIA++G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8    LPQIAVIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPKVECKWG  67

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
             +GLE+II+D+SI GVAVV+AGQ QV++SL+LL+ GKHV+QEKPAA    EA+ AL  Y 
Sbjct  68   DSGLEDIIQDSSIKGVAVVLAGQVQVDISLKLLRMGKHVIQEKPAAESTIEADTALSCYK  127

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            SL  +   +PIWAVAENYRFEPAF E +K++ EIGDM+N+QVI+EG+MNSSNPYFSSSW
Sbjct  128  SLCDHFPSQPIWAVAENYRFEPAFVEARKLVNEIGDMINIQVIVEGSMNSSNPYFSSSW  186



>ref|XP_002459955.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
 gb|EER96476.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
Length=364

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = +3

Query  39   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  218
              ++LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P++E
Sbjct  7    GRAELPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPDIE  66

Query  219  CKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  398
            CKWG  GLEEI+ D+SI+GVAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL
Sbjct  67   CKWGDVGLEEIMGDSSIMGVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETAL  126

Query  399  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFS  578
              YNS       KPIWAV ENYRFEPAF E  K+I +IGDMM++QVIIEG+MNSSNPYF+
Sbjct  127  SIYNSFPNQFPHKPIWAVGENYRFEPAFIESSKLINDIGDMMHIQVIIEGSMNSSNPYFN  186

Query  579  SSW  587
            S+W
Sbjct  187  STW  189



>ref|NP_001149836.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
 gb|ACG36942.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +3

Query  39   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  218
              ++LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P++E
Sbjct  7    GRAELPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPDIE  66

Query  219  CKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  398
            CKWG AGLEEI+ D+SI+GVA+V+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL
Sbjct  67   CKWGDAGLEEIMGDSSIMGVAIVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETAL  126

Query  399  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFS  578
              Y+S       KPIWAV ENYRFEPAF E  K+I +IGDMM++QVIIEG+MNSSNPYF+
Sbjct  127  SIYHSFQNLFPHKPIWAVGENYRFEPAFIESSKLINDIGDMMHIQVIIEGSMNSSNPYFN  186

Query  579  SSW  587
            S+W
Sbjct  187  STW  189



>ref|XP_006850072.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
 gb|ERN11653.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
Length=368

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  42   ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC  221
            E  LP IA+LG GIFV++QYIPRL EISQ  VL+ IWSRSEESA++A ELA    PNVE 
Sbjct  10   EKMLPHIALLGGGIFVRSQYIPRLKEISQTVVLRVIWSRSEESAKAAAELAHEFSPNVEY  69

Query  222  KWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLM  401
            KWG AGL +II+D+SI GV +V+  Q QV++SLR+L+ GKHVLQEKPAA+ ++EAENA++
Sbjct  70   KWGDAGLNDIIQDSSIHGVLIVLTAQVQVDISLRMLRAGKHVLQEKPAASSLSEAENAML  129

Query  402  HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSS  581
             Y+SL  N   +PIWAVAENYRFEPAF E +++  E+GDMM+VQVI+E +MNSSNPYFSS
Sbjct  130  FYHSLHANFPHRPIWAVAENYRFEPAFVESQRLAKEVGDMMSVQVIVESSMNSSNPYFSS  189

Query  582  SW  587
            SW
Sbjct  190  SW  191



>ref|XP_008668038.1| PREDICTED: NAD-dependent dyhydrogenase, Gfo/Idh/MocA family isoform 
X1 [Zea mays]
 tpg|DAA39396.1| TPA: NAD-dependent dihydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +3

Query  39   AESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVE  218
              ++LP+IA++G+GIF +TQYIPRL EI+ L VLK+IWSR++ESA++A ELAR+  P++E
Sbjct  7    GRAELPRIAVIGAGIFARTQYIPRLREIAHLVVLKSIWSRTQESAKAAAELARDFAPDIE  66

Query  219  CKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  398
            CKWG AGLEEI+ D+SI+GVA+V+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL
Sbjct  67   CKWGDAGLEEIMGDSSIMGVAIVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETAL  126

Query  399  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFS  578
              Y+S       KPIWAV ENYRFEPAF E  K+I +IGDMM++QVIIEG+MNSSNPYF+
Sbjct  127  SIYHSFQNLFPHKPIWAVGENYRFEPAFIESSKLINDIGDMMHIQVIIEGSMNSSNPYFN  186

Query  579  SSW  587
            S+W
Sbjct  187  STW  189



>ref|XP_006660493.1| PREDICTED: uncharacterized protein YMR315W-like [Oryza brachyantha]
Length=359

 Score =   186 bits (473),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA   LP+IA+LG+G F +TQYIPRL EI+ L +L+AIWSR++ESA +A ELAR+  P +
Sbjct  1    MAADGLPRIAVLGAGTFARTQYIPRLREIAHLVLLRAIWSRTQESAEAAAELARDFAPEI  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            EC+WG AGL EI++D SI  VAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE A
Sbjct  61   ECRWGDAGLAEIMEDASISAVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTMEAETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L  YNS       +PIWA+AENYRFEPAF E +K++ +IGDMMN+QVI+EG+MNSSNPYF
Sbjct  121  LSVYNSFPNQPPYRPIWALAENYRFEPAFVESRKLMNDIGDMMNIQVIVEGSMNSSNPYF  180

Query  576  SSSW  587
            +SSW
Sbjct  181  NSSW  184



>gb|EMT01460.1| hypothetical protein F775_26364 [Aegilops tauschii]
Length=355

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 139/179 (78%), Gaps = 6/179 (3%)
 Frame = +3

Query  51   LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  230
            LP+IA++G+GIF +TQYIPRL EIS L VLKAIWSR++ESA +A ELAR+  P +ECKWG
Sbjct  8    LPRIAVVGAGIFARTQYIPRLREISHLVVLKAIWSRTQESAEAAAELARDFAPGIECKWG  67

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
             AGLEEI+ D SI+GVAVV+AGQ QVE+SL++LK GKHV+Q    A         L  YN
Sbjct  68   DAGLEEIMGDPSILGVAVVLAGQVQVELSLKMLKAGKHVIQASTEAETA------LSVYN  121

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            S    +  KPIWAV ENYRFEPAF E  K++ +IGDMMN+QVI+EG+MNSSNPYF+SSW
Sbjct  122  SFPNKLPCKPIWAVGENYRFEPAFVESSKLMDDIGDMMNIQVIVEGSMNSSNPYFNSSW  180



>ref|NP_001062764.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAD26513.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24678.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAG93408.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84244.1| hypothetical protein OsI_30682 [Oryza sativa Indica Group]
Length=359

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA   LP+IA++G+GIF +TQYIPRL EI+ L +LK IWSR++ESA +A ELAR+  P +
Sbjct  1    MAGDGLPRIAVVGAGIFARTQYIPRLREIAHLVLLKTIWSRTKESAEAAAELARDFAPEI  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            + +WG AGLEEI+ D SI  VAVV+AGQ QV++SL++LK GKHV+QEKPA+    EAE A
Sbjct  61   QPRWGDAGLEEIMGDASISAVAVVLAGQVQVDLSLKMLKAGKHVIQEKPASGSTMEAETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L  YNS       KPIWA+AENYRFEPAF E +K++++IGDMMN+QVI+EG+MNSSNPYF
Sbjct  121  LSVYNSFPNQFPYKPIWALAENYRFEPAFVESRKLMSDIGDMMNIQVIVEGSMNSSNPYF  180

Query  576  SSSW  587
            +SSW
Sbjct  181  NSSW  184



>ref|XP_010673578.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=360

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +3

Query  57   QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  236
            QI I+G+G FVK QYIPRL+EIS L  ++ IWSRSEESARSAVELA   FP VECKWG  
Sbjct  11   QITIIGAGTFVKNQYIPRLSEISHLVSIRYIWSRSEESARSAVELASKSFPEVECKWGDV  70

Query  237  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  416
            G++EIIKD+S++GVAVV+AGQ QV+M+LRLLK GKHV+QEKPAAA   EAE AL  Y+ +
Sbjct  71   GIDEIIKDSSVVGVAVVLAGQIQVDMALRLLKAGKHVIQEKPAAASNEEAELALSSYDLV  130

Query  417  STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
              + + KPIWAVAENYRFEP F E +K++ EIGDMM+VQVI+EG++NSSNPYFSSSW
Sbjct  131  CPSNSSKPIWAVAENYRFEPGFIEGRKLVEEIGDMMSVQVIVEGSVNSSNPYFSSSW  187



>ref|XP_010673579.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +3

Query  57   QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  236
            QI I+G+G FVK QYIPRL+EIS L  ++ IWSRSEESARSAVELA   FP VECKWG  
Sbjct  6    QITIIGAGTFVKNQYIPRLSEISHLVSIRYIWSRSEESARSAVELASKSFPEVECKWGDV  65

Query  237  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  416
            G++EIIKD+S++GVAVV+AGQ QV+M+LRLLK GKHV+QEKPAAA   EAE AL  Y+ +
Sbjct  66   GIDEIIKDSSVVGVAVVLAGQIQVDMALRLLKAGKHVIQEKPAAASNEEAELALSSYDLV  125

Query  417  STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
              + + KPIWAVAENYRFEP F E +K++ EIGDMM+VQVI+EG++NSSNPYFSSSW
Sbjct  126  CPSNSSKPIWAVAENYRFEPGFIEGRKLVEEIGDMMSVQVIVEGSVNSSNPYFSSSW  182



>ref|XP_004486934.1| PREDICTED: uncharacterized protein YMR315W-like [Cicer arietinum]
Length=361

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 147/185 (79%), Gaps = 1/185 (1%)
 Frame = +3

Query  36   MAESQ-LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPN  212
            MA  Q  PQIAILG+G FVK+QY+PRL+EIS LF LKAIWSR+EESA +AVE+A  HF  
Sbjct  1    MATKQGTPQIAILGAGTFVKSQYLPRLSEISNLFHLKAIWSRTEESATAAVEIANKHFSG  60

Query  213  VECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaen  392
            V  KWG  GL +II+D SI  VA+V+AGQ QV++SL+LLK GKHVLQEKPAA+C +E E 
Sbjct  61   VHSKWGDNGLHDIIQDPSISAVAIVLAGQNQVDISLKLLKAGKHVLQEKPAASCTSELET  120

Query  393  aLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPY  572
            AL +Y  +S +   + IW+VAENYRFEPA  E KK+IA IG MM+VQVIIEG+MNSSNPY
Sbjct  121  ALSNYKLISADAPGQVIWSVAENYRFEPALVEGKKLIAGIGKMMSVQVIIEGSMNSSNPY  180

Query  573  FSSSW  587
            FSSSW
Sbjct  181  FSSSW  185



>gb|EEE69341.1| hypothetical protein OsJ_28659 [Oryza sativa Japonica Group]
Length=364

 Score =   179 bits (454),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MA   LP+IA++G+GIF +TQYIPRL EI+ L +LK IWSR++ESA +A ELAR+  P +
Sbjct  1    MAGDGLPRIAVVGAGIFARTQYIPRLREIAHLVLLKTIWSRTKESAEAAAELARDFAPEI  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            + +WG AGLEEI+ D SI  VAVV+AGQ QV++SL++LK GKHV+QEKPA+    EAE A
Sbjct  61   QPRWGDAGLEEIMGDASISAVAVVLAGQVQVDLSLKMLKAGKHVIQEKPASGSTMEAETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L  YNS       KPIWA+AENYRFEPAF E +K++++IGDMMN+QVI+EG+MNSSNPYF
Sbjct  121  LSVYNSFPNQFPYKPIWALAENYRFEPAFVESRKLMSDIGDMMNIQVIVEGSMNSSNPYF  180

Query  576  SSS  584
            +SS
Sbjct  181  NSS  183



>gb|EYU18011.1| hypothetical protein MIMGU_mgv1a008840mg [Erythranthe guttata]
Length=360

 Score =   173 bits (439),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P+IAILG+GIFV+T+YIPRL+EISQLF LKAIWSR+EESA+ AVE+A+  FP VECKWG 
Sbjct  4    PKIAILGAGIFVRTEYIPRLSEISQLFSLKAIWSRTEESAKGAVEIAKEFFPEVECKWGD  63

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL+++I+D+SI  V VV+A Q QV++SLR+LK GKHVLQEKPAAA I + E AL  YNS
Sbjct  64   DGLDDVIEDSSIDAVLVVLAAQFQVDLSLRILKSGKHVLQEKPAAASITKVETALSSYNS  123

Query  414  L-STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            L ST +  KPIWAVAENYRFEPAF E KK++ +IG+M+N Q+I+E  MNSS+PYFSSSW
Sbjct  124  LTSTGLPSKPIWAVAENYRFEPAFLEGKKLMGDIGEMVNFQIIVEVPMNSSSPYFSSSW  182



>gb|EPS68382.1| hypothetical protein M569_06387, partial [Genlisea aurea]
Length=340

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 141/177 (80%), Gaps = 5/177 (3%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEI-SQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA  236
            +AI+G+GIFV++ YIPRLAEI +  FVL+AIWSRSE+SA+SA  +A+  FP VECKWG A
Sbjct  4    VAIVGAGIFVRSTYIPRLAEIGNNSFVLRAIWSRSEDSAKSAHAIAKPFFPGVECKWGEA  63

Query  237  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  416
            GL++I+ D SI  V VV+AGQ QV+MSLRLL  GKHVLQEKPAAA + E + A+  Y SL
Sbjct  64   GLDDIVGDASIAAVMVVIAGQAQVDMSLRLLSAGKHVLQEKPAAASVNELQKAISGYQSL  123

Query  417  STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
             +     PIWAVAENYRFEPAF E +K++ EIG+++N  VI+EG+MNSSNPYFSSSW
Sbjct  124  PS----APIWAVAENYRFEPAFVEGRKLMTEIGNVVNFHVIVEGSMNSSNPYFSSSW  176



>ref|XP_003597479.1| Oxidoreductase, putative [Medicago truncatula]
 gb|AES67730.1| oxidoreductase family, NAD-binding rossmann fold protein [Medicago 
truncatula]
Length=356

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +3

Query  57   QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFP-NVECKWGG  233
            QIAILG+G FVK QY+PRL+EIS LF LK+IWSR+++SA +AVE+A   F  NVE K+G 
Sbjct  5    QIAILGAGTFVKHQYLPRLSEISHLFNLKSIWSRTQDSANAAVEIANKLFGGNVESKFGD  64

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GL +II+D+SI  V VV+AGQ QV++SL+LLK GKHVLQEKPAA+ I E E AL +Y S
Sbjct  65   NGLNDIIQDSSITAVLVVLAGQYQVDISLKLLKAGKHVLQEKPAASGINELETALSNYKS  124

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +S +   + IW+VAENYRFEPA  E KK+IA++G MM+VQVIIEG+MNSSNPYFSSSW
Sbjct  125  ISADAPGQIIWSVAENYRFEPALVEGKKLIADLGKMMSVQVIIEGSMNSSNPYFSSSW  182



>gb|KGN54119.1| hypothetical protein Csa_4G286920 [Cucumis sativus]
Length=175

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
            WG AGL++II+D+SI+GVAVV+AGQ QV+MSLRLLK GKHVLQEKPAAA  +E E AL +
Sbjct  62   WGDAGLDDIIQDSSILGVAVVLAGQAQVDMSLRLLKAGKHVLQEKPAAASTSELEYALSN  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG  515
            Y SLS N +++ +WAVAENYRFEPAF E +  I ++G
Sbjct  122  YKSLSANFSRQRLWAVAENYRFEPAFVE-RGFILDMG  157



>gb|EYU46309.1| hypothetical protein MIMGU_mgv1a0096471mg, partial [Erythranthe 
guttata]
Length=147

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 123/151 (81%), Gaps = 4/151 (3%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNV  215
            MAE + PQIAILG+GIFV+  YIPRLAEIS L VL+AIWSR++ESAR AVE+A+ +FP+V
Sbjct  1    MAEQRPPQIAILGAGIFVRNTYIPRLAEISNLLVLRAIWSRTQESARGAVEIAKQYFPDV  60

Query  216  ECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            ECKWG AGL +II D SI+GVAVV+AGQTQV+MSLR LK GKHVLQEKPAAA + E E A
Sbjct  61   ECKWGEAGLNDIILDASIVGVAVVLAGQTQVDMSLRFLKAGKHVLQEKPAAASVNELETA  120

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTE  488
            +  YNS +      PIWAVAENYRFEPAF E
Sbjct  121  ISSYNSFNP----APIWAVAENYRFEPAFVE  147



>ref|XP_001754780.1| predicted protein [Physcomitrella patens]
 gb|EDQ80234.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 128/178 (72%), Gaps = 0/178 (0%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGG  233
            P +A+LGSGIF  +QY+P+L E+S++  L+ IWSRSE+ A+ A+  AR++ PNVE KWG 
Sbjct  6    PGLALLGSGIFASSQYLPKLGELSEVISLRVIWSRSEDGAKKALLSARSYAPNVEAKWGQ  65

Query  234  AGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
             GLE I++D SI  VA+V+  Q Q+E+ LR L+ GKHV+QEKP  A +A+   A   Y +
Sbjct  66   EGLEAILQDKSIQAVAIVLPAQHQLELVLRALEAGKHVIQEKPVGASVADVRKAWSTYQA  125

Query  414  LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            L+ N  + PIWAVAENYRFEPA  +  K   EIG +M VQV+IE  +NSS+PYFSSSW
Sbjct  126  LAVNDKKLPIWAVAENYRFEPALIQTGKFAKEIGQIMGVQVLIEAPINSSSPYFSSSW  183



>ref|XP_001762266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73058.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 129/179 (72%), Gaps = 0/179 (0%)
 Frame = +3

Query  51   LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  230
            +P +A+LGSGIF  +QYIP+L E+  +  L  IWSRSE+ A+ A++LA+++ PN E KWG
Sbjct  5    IPGLALLGSGIFASSQYIPKLGELGGIVSLNTIWSRSEDGAKKALQLAKSYAPNAEAKWG  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE I++D SI  VAVV+  Q Q+E+ LR L+ GKHV+QEKP    +A+  +A   Y 
Sbjct  65   QEGLESILQDKSIHAVAVVLPAQHQLEIVLRALEAGKHVIQEKPVGPSVADVRSAWSAYQ  124

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +L+ N T+ PIWAVAENYRFEPA  +  K + E+G +M VQV+IE  MNSS+PYFSSSW
Sbjct  125  ALAKNDTKLPIWAVAENYRFEPALIQAGKFVKELGQIMGVQVLIEAPMNSSSPYFSSSW  183



>ref|XP_002969664.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
 gb|EFJ28788.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
Length=348

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 115/185 (62%), Gaps = 14/185 (8%)
 Frame = +3

Query  48   QLPQIAILGSGIFVKTQYIPRLAEISQLF-VLKAIWsrseesarsavelarNHFPNVECK  224
             +P +AILG+GIF  +QY+P L++ S    +LKAIWSRS+++A +A  L    FP+V  K
Sbjct  3    SVPGVAILGAGIFTTSQYLPILSKQSSTAPILKAIWSRSKDAAENAASLVAKFFPDVVAK  62

Query  225  WGGAGLEEIIKDtsiigva----vvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaen  392
            WG  GL +I++D+SI  VA      V       +SLR LK GKHVLQ             
Sbjct  63   WGEDGLIQILEDSSIHAVAIVLPAQVQVFKLYSISLRALKSGKHVLQALSDVRD------  116

Query  393  aLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPY  572
             ++ Y+S     +Q P+WAVAENYRFEP   E  +++  IGDMM+ +VI+E  MNSSNPY
Sbjct  117  -VLSYHS--GMGSQAPVWAVAENYRFEPGLIEAARLVKSIGDMMSFEVIVELPMNSSNPY  173

Query  573  FSSSW  587
            +SS+W
Sbjct  174  YSSAW  178



>ref|XP_002981277.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
 gb|EFJ17465.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
Length=338

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 115/184 (63%), Gaps = 14/184 (8%)
 Frame = +3

Query  51   LPQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKW  227
            +P +AILG+GIF  +QY+P L+ + S   +LKAIWSRS+++A +A       FP+V  KW
Sbjct  4    VPGVAILGAGIFTTSQYLPILSNQSSTAPILKAIWSRSKDAAENAASSVAKFFPDVVAKW  63

Query  228  GGAGLEEIIKDtsiigva----vvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaena  395
            G  GL +I++D+SI  VA      V    +  +SLR LK GKHVLQ              
Sbjct  64   GEDGLIQILEDSSIHAVAIVLPAQVQVFKRYSISLRALKSGKHVLQALSDVRD-------  116

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            ++ Y+S     +Q P+WAVAENYRFEP   E  +++  IGDMM+ +VI+E  MNSSNPY+
Sbjct  117  VLSYHS--GMGSQAPVWAVAENYRFEPGLIEAARLVKSIGDMMSFEVIVELPMNSSNPYY  174

Query  576  SSSW  587
            SS+W
Sbjct  175  SSAW  178



>gb|KJB66094.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=288

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = +3

Query  309  EMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFTE  488
            ++SL+LLK GKHV+QEKPAA  I E E AL  Y S+STN  Q PIWAVAENYRFEPAF E
Sbjct  20   DISLKLLKAGKHVIQEKPAATSIPEIETALASYKSVSTNPGQ-PIWAVAENYRFEPAFVE  78

Query  489  CKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
             KK++A +GDMMNVQVIIEG+MNSSNPYFSSSW
Sbjct  79   SKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSSW  111



>ref|XP_004169964.1| PREDICTED: uncharacterized protein LOC101228167 [Cucumis sativus]
Length=110

 Score =   117 bits (292),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQ  353
            WG AGL++II+D+SI+GVAVV+AGQ QV+MSLRLLK GKHVLQ
Sbjct  62   WGDAGLDDIIQDSSILGVAVVLAGQAQVDMSLRLLKAGKHVLQ  104



>ref|XP_004142242.1| PREDICTED: uncharacterized LOC101204258 [Cucumis sativus]
Length=220

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  45   SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECK  224
            ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2    AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQ  353
            WG AGL++II+D+SI+GVAVV+AGQ QV+MSLRLLK GKHVLQ
Sbjct  62   WGDAGLDDIIQDSSILGVAVVLAGQAQVDMSLRLLKAGKHVLQ  104



>ref|XP_001776337.1| predicted protein [Physcomitrella patens]
 gb|EDQ58836.1| predicted protein [Physcomitrella patens]
Length=366

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 105/180 (58%), Gaps = 3/180 (2%)
 Frame = +3

Query  48   QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW  227
            +LP IA+LG G+F +  YIP L+ +S +  L+ +WSRSE  AR   E   +  P+VE +W
Sbjct  9    RLPAIALLGCGVFARDAYIPVLSSLSPIASLRYVWSRSEFKARQMQENVLHFAPDVEAEW  68

Query  228  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  407
            G AGLE I+    +   AV +   TQ  +  R L+ GKHVLQEKP A  +     ++  Y
Sbjct  69   GDAGLEIILSSQLVHCCAVALPILTQPAVVTRALRAGKHVLQEKPVAGSVEIGLKSMSFY  128

Query  408  NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +SL +     PIW VAENYRFEPAF +   M+  +G M++V V I+  M  SN YF   W
Sbjct  129  HSLPS---PAPIWTVAENYRFEPAFHDAAAMVKSLGTMVSVTVTIDVPMTKSNKYFGCEW  185



>ref|XP_004152962.1| PREDICTED: uncharacterized protein LOC101204258, partial [Cucumis 
sativus]
Length=81

 Score =   109 bits (272),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L +Y SLS N +++ +WAVAENYRFEPAF ECK +IA+IGDMM+VQVI+EG+MNSSNPYF
Sbjct  8    LSNYKSLSANFSRQRLWAVAENYRFEPAFVECKNLIADIGDMMSVQVIVEGSMNSSNPYF  67

Query  576  SSSW  587
            SSSW
Sbjct  68   SSSW  71



>ref|XP_002973220.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
 gb|EFJ25594.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
Length=349

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 117/179 (65%), Gaps = 4/179 (2%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  230
            P +A++G G F + QY P  + +++ +  LKA+WSRS+ESA  +V L ++  P V+ KWG
Sbjct  3    PSLALIGVGNFAQKQYFPLFSTKLTDVVSLKALWSRSQESAERSVSLIKDCVPGVQAKWG  62

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GL++I+ D +I+GVA+V+  Q Q E  ++ LK GKHV+QEKP A    +A++    Y 
Sbjct  63   QQGLDDILNDDTILGVAIVLQPQVQGEFVMQALKAGKHVIQEKPIAPSTQQAQSLTSFYE  122

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            SL T    +P+WA+AENYRFE A  E  K++ +IG M+ V+V +E  MN S P FSS W
Sbjct  123  SLGT---MRPVWAIAENYRFERALVEAHKLVKDIGHMVAVEVTVESPMNISRPSFSSIW  178



>ref|XP_004162028.1| PREDICTED: uncharacterized LOC101204258, partial [Cucumis sativus]
Length=244

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L +Y SLS N +++ +WAVAENYRFEPAF ECK +IA+IGDMM+VQVI+EG+MNSSNPYF
Sbjct  8    LSNYKSLSANFSRQRLWAVAENYRFEPAFVECKNLIADIGDMMSVQVIVEGSMNSSNPYF  67

Query  576  SSSW  587
            SSSW
Sbjct  68   SSSW  71



>ref|XP_002976631.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
 gb|EFJ22300.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
Length=341

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 113/179 (63%), Gaps = 4/179 (2%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  230
            P +A++G G F + QY P  + +++ +  LKA+WSRS+ESA  +V L ++  P V+ KWG
Sbjct  3    PSLALIGVGNFAQKQYFPLFSTKLTDVVSLKALWSRSQESAERSVSLIKDCVPGVQPKWG  62

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GL++I+ D +I+ VA+V+  Q Q E  ++ LK GKHV+QEKP A    +A+     Y 
Sbjct  63   QQGLDDILSDDTILAVAIVLQPQVQGEFVMQALKAGKHVIQEKPIAPSTQQAQGLTSFYE  122

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            SL T    +P+WA+AENYRFE A  E  K+  +IG M+ V+V +E  MN S   FSS W
Sbjct  123  SLGT---MRPVWAIAENYRFERALVEAHKLAKDIGHMVAVEVTVESPMNISRSSFSSIW  178



>gb|KJB66101.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=259

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 1/64 (2%)
 Frame = +3

Query  396  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
            L  Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEG+MNSSNPYF
Sbjct  20   LASYKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYF  78

Query  576  SSSW  587
            SSSW
Sbjct  79   SSSW  82



>ref|XP_010466287.1| PREDICTED: uncharacterized protein LOC104746495 [Camelina sativa]
Length=235

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y  +S +   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEG+MNSSNPYFSSS
Sbjct  4    YREISADSPSRPIWAVAENYRFEPAFVELKKLMVEIGDMMNVQLIIEGSMNSSNPYFSSS  63

Query  585  W  587
            W
Sbjct  64   W  64



>ref|XP_002973823.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
 ref|XP_002983567.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ15468.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ24778.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
Length=341

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 113/179 (63%), Gaps = 4/179 (2%)
 Frame = +3

Query  54   PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelarNHFPNVECKWG  230
            P  A++G+G F K QY+P L+ ++      KAIWSRS+ESA SAV L ++  P V+ KWG
Sbjct  3    PGFALIGAGGFAKKQYLPLLSTKLMDRVSFKAIWSRSQESAESAVSLIKDRVPEVQPKWG  62

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              G  +I+ D SIIGVA+V+  + Q   +++ L  GKHVLQEKP A    +A++ +  Y 
Sbjct  63   EEGFNDILMDNSIIGVAIVLEPEIQGTYAIQALTAGKHVLQEKPLAPSTQKAQSLVNLYK  122

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
             L  +   K +WA+ ENYRFE A  E  K++ +IG M+ V+VI+E  MN S P FSS W
Sbjct  123  GLDND---KLVWAIGENYRFEQALAEASKLVKDIGHMVAVEVILESPMNISRPSFSSVW  178



>gb|EYU46307.1| hypothetical protein MIMGU_mgv1a0096473mg, partial [Erythranthe 
guttata]
 gb|EYU46308.1| hypothetical protein MIMGU_mgv1a0096473mg, partial [Erythranthe 
guttata]
Length=38

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  492  KKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            KK++AEIGD++N+ VIIEG+MNSSNPYFSSSW
Sbjct  2    KKLMAEIGDIINIHVIIEGSMNSSNPYFSSSW  33



>gb|KIH93169.1| hypothetical protein SPBR_02922 [Sporothrix brasiliensis 5110]
Length=369

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 101/182 (55%), Gaps = 13/182 (7%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW----  227
            IA+LG+GIF + Q++P + + S L  LKA++SRS+ SA +    A    P ++  W    
Sbjct  5    IALLGAGIFAQAQHLPAI-KASDLLALKAVYSRSQASAEAFASKAG--VPGLDVYWDEPA  61

Query  228  -GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
              G GL +++  + +  V+V +    Q +     L  GKHV+ EKP A  +A A+  +  
Sbjct  62   AAGRGLADLLARSDVAAVSVCMPINLQPQAIRAALAAGKHVISEKPVADTVAHAQALIAD  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECK-KMIAEIGDMMNVQVIIEGTMNSSNPYFSS  581
            Y++L     +KPIWAVAENYR+  +    + K+ A  GD+++  ++    + +   YF++
Sbjct  122  YDALP----RKPIWAVAENYRYMQSLQLAEAKLRALGGDLVSFSLVSNKFVRTDGNYFNT  177

Query  582  SW  587
            +W
Sbjct  178  AW  179



>ref|XP_003347717.1| hypothetical protein SMAC_03815 [Sordaria macrospora k-hell]
 emb|CCC11108.1| unnamed protein product [Sordaria macrospora k-hell]
Length=355

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 92/187 (49%), Gaps = 12/187 (6%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNH---FPNVECKWG  230
            +A+LG+GIF + Q++P +  +  L  LKAI+SRSE SA +    A N    + +V    G
Sbjct  4    VALLGAGIFAREQHLPAIESVPSL-SLKAIYSRSESSANTLASAASNPVDVYYDVPTGTG  62

Query  231  GA--GLEEIIKDtsiigvavvvagqtqvEMSL-----RLLKGGKHVLQekpaaaciaeae  389
             A  G EE   D  +    +         ++      + LK GKHVL EKP A  +  A+
Sbjct  63   EAKVGPEEKTLDALLARTDIDAVVIALPILAQPAVIQKALKAGKHVLSEKPVAKDVEAAK  122

Query  390  naLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNV-QVIIEGTMNSSN  566
              +  Y  L     +KP+WAV ENYR+ P+     + + E+G  +   ++ + G +   N
Sbjct  123  GLIEFYAGLEQGEKKKPLWAVGENYRYTPSLMAAAEKVKEVGGKLTTFRLNMNGWVEEEN  182

Query  567  PYFSSSW  587
             YF + W
Sbjct  183  KYFKTEW  189



>gb|ERT01696.1| hypothetical protein HMPREF1624_02949 [Sporothrix schenckii ATCC 
58251]
Length=369

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 100/182 (55%), Gaps = 13/182 (7%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKW----  227
            IA+LG+GIF + Q++P + + S L  LKA++SRS+ SA +    A    P ++  W    
Sbjct  5    IALLGAGIFAQAQHLPAI-KASDLLALKAVYSRSQASAEAFASKAG--VPGLDVYWDEPA  61

Query  228  -GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
              G GL +++  + +  V+V +    Q +     L  GKHV+ EKP A  +A A+  +  
Sbjct  62   AAGRGLADLLARSDVAAVSVCMPINLQPQAIRAALAAGKHVISEKPVADTVAHAQALIAD  121

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECK-KMIAEIGDMMNVQVIIEGTMNSSNPYFSS  581
            Y++L     +KPIWAVAENYR+  +    + K+ A  GD+++  ++    +     YF++
Sbjct  122  YDALP----RKPIWAVAENYRYMQSLQLAEAKLRALGGDLVSFSLVSNKFVRPDGNYFNT  177

Query  582  SW  587
            +W
Sbjct  178  AW  179



>ref|XP_960192.1| NAD-binding Rossmann fold oxidoreductase [Neurospora crassa OR74A]
 gb|EAA30956.1| NAD-binding Rossmann fold oxidoreductase [Neurospora crassa OR74A]
Length=357

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 101/189 (53%), Gaps = 14/189 (7%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelar---NHFPNVECKWG  230
            IA+LG+GIF + Q++P +  +  L  LKAI+SRSE SA +    A    + + +V     
Sbjct  4    IALLGAGIFAREQHLPAIESVPSL-SLKAIYSRSESSANTLASAASSPVDVYYDVPTAGS  62

Query  231  GAG--------LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaea  386
            G+G        L+ ++  T I  V + +    Q  +  + LK GKHVL EKP A  + EA
Sbjct  63   GSGEAANVEKTLDALLARTDIDAVVIALPILAQPAVIEKALKAGKHVLSEKPVAKDVEEA  122

Query  387  enaLMHYNSLS-TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNV-QVIIEGTMNS  560
            +  +  Y +L   N  +KP+WAVAEN+R+ P+  +  + + EIG  +   ++ + G +  
Sbjct  123  KRLVGFYEALDLDNNKKKPLWAVAENFRYTPSLLKAAEKVKEIGGKLTTFRLNMNGWVEE  182

Query  561  SNPYFSSSW  587
             N YF + W
Sbjct  183  GNKYFKTEW  191



>gb|KHE80312.1| NAD(P)-binding protein, partial [Neurospora crassa]
Length=355

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 101/189 (53%), Gaps = 14/189 (7%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelar---NHFPNVECKWG  230
            IA+LG+GIF + Q++P +  +  L  LKAI+SRSE SA +    A    + + +V     
Sbjct  4    IALLGAGIFAREQHLPAIESVPSL-SLKAIYSRSESSANTLASAASSPVDVYYDVPTAGS  62

Query  231  GAG--------LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaea  386
            G+G        L+ ++  T I  V + +    Q  +  + LK GKHVL EKP A  + EA
Sbjct  63   GSGEAANVEKTLDALLARTDIDAVVIALPILAQPAVIEKALKAGKHVLSEKPVAKDVEEA  122

Query  387  enaLMHYNSLS-TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNV-QVIIEGTMNS  560
            +  +  Y +L   N  +KP+WAVAEN+R+ P+  +  + + EIG  +   ++ + G +  
Sbjct  123  KRLVGFYEALDLDNNKKKPLWAVAENFRYTPSLLKAAEKVKEIGGKLTTFRLNMNGWVEE  182

Query  561  SNPYFSSSW  587
             N YF + W
Sbjct  183  GNKYFKTEW  191



>gb|EKV16143.1| Oxidoreductase family, NAD-binding Rossmann fold protein [Penicillium 
digitatum Pd1]
 gb|EKV18638.1| Oxidoreductase family, NAD-binding Rossmann fold protein [Penicillium 
digitatum PHI26]
Length=500

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 91/176 (52%), Gaps = 3/176 (2%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGAG  239
            +AI+GSGIF K Q++P +   S  F LKAI+SRS +SA+             E       
Sbjct  5    VAIIGSGIFAKEQHLPAVQAASN-FQLKAIYSRSLKSAQDLASGISEVDLYSEDSGSDKS  63

Query  240  LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLS  419
              +++  + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L  Y S  
Sbjct  64   YAQLLARSDIGAVIIALPILVQPEFIRKALHAGKHVLSEKPIAKDVATAQELLKWYKS--  121

Query  420  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            T  T+K  WAVAEN+RF   +    + + ++G + N +V +   M+ +N YF ++W
Sbjct  122  TIDTRKVFWAVAENFRFLTKYLFAAEQVQKLGRVQNFRVNVHSLMDENNKYFHTAW  177



>gb|KGO75187.1| Oxidoreductase, N-terminal [Penicillium italicum]
Length=507

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 91/176 (52%), Gaps = 3/176 (2%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGAG  239
            +AI+GSG+F K Q++P +   S  F LKAI+SRS +SA+             E       
Sbjct  5    VAIIGSGLFAKEQHLPAVQAASN-FQLKAIYSRSLKSAQDLASGTSEVDLYSEDSGSDKS  63

Query  240  LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLS  419
              +++  + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L  Y S  
Sbjct  64   YADLLARSDIGAVIIALPILVQPEFIKKSLLAGKHVLSEKPIAKDVATAQELLKWYKS--  121

Query  420  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            T  T K  WAVAEN+R+   F    + + ++G + N +V +   MN +N YF+++W
Sbjct  122  TIDTSKVFWAVAENFRYITKFIFAAEQVQKLGKVKNFRVNVHSLMNENNKYFNTAW  177



>gb|EFQ28397.1| oxidoreductase family protein [Colletotrichum graminicola M1.001]
Length=347

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 94/179 (53%), Gaps = 6/179 (3%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHF-PNVECKWGGA  236
            +AI+G GIF K Q++P + E S    LKAI+SRS +SA    +LA N   P++     G 
Sbjct  6    VAIVGGGIFAKEQHLPAV-EASDQLTLKAIYSRSRKSAEDTAKLATNSASPDLYSDDSGD  64

Query  237  G--LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
            G   E+++    I  + + +    Q E   + L  GKHVL EKP A  +A A+  + +YN
Sbjct  65   GKSFEDLLARDDIQALILALPIVNQPEYIEKALAAGKHVLAEKPIAPDVARAQKLIDYYN  124

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
             +S    +   +AVAENYRF+P +T  +  +  +G ++   V +   +     Y  ++W
Sbjct  125  KVSAE--KGVTFAVAENYRFQPRYTAARDEVQTLGKIIGFNVRVFFYVQLGGKYIETTW  181



>gb|KEQ84242.1| NAD(P)-binding protein [Aureobasidium pullulans EXF-150]
Length=346

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 96/179 (54%), Gaps = 6/179 (3%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA-  236
            IA++GSGIF++  ++P +     LF L AI+SRS  SA+   +   +  P++  +  G+ 
Sbjct  5    IAVIGSGIFIQEAHLPGIKANGDLFSLNAIYSRSLASAQKLSKEVESTTPDLYAEDAGSD  64

Query  237  -GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
                ++++ + +  V + +    Q E   + L  GKHVL EKP A  +A A   +  Y+ 
Sbjct  65   KSYAKLLERSDVEAVVIALPILAQPEFIKKALSAGKHVLSEKPVAKDLATAHELIDWYH-  123

Query  414  LSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
              TN+ T+K IWAVAEN+R+   F    + + E+GD++  ++ +   +     Y+ + W
Sbjct  124  --TNIDTKKTIWAVAENFRYLGRFQYGAEQVKELGDILGFRLRMHAFVKPGAKYYETEW  180



>emb|CDM31202.1| NAD(P)-binding domain [Penicillium roqueforti FM164]
Length=346

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 91/177 (51%), Gaps = 5/177 (3%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGAG  239
            +AI+GSG+F K Q++P +  +S  F LKAI+SR+ +SA+             E    G  
Sbjct  5    VAIIGSGLFAKEQHLPAVQAVSN-FQLKAIYSRTLKSAQDLASGTSEVDLYSEDSGSGKS  63

Query  240  LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLS  419
              +++  + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L  Y S  
Sbjct  64   YTDLLARSDIGAVIIALPILVQPEFIRKALLAGKHVLSEKPIAKDVATAQELLNWYKS--  121

Query  420  TNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
             N+ T K  WAVAEN+R+   F    + + ++G + N +V +   M+  N YF + +
Sbjct  122  -NIDTSKVFWAVAENFRYITKFLFAAEQVQKLGKVQNFRVNVHSLMDKENKYFPTDY  177



>gb|KEQ61018.1| oxidoreductase-like protein family [Aureobasidium melanogenum 
CBS 110374]
Length=346

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 95/179 (53%), Gaps = 6/179 (3%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA-  236
            IA++GSGIFV+  ++P +     LF LKA +SRS  SA+   +   +  P++  +  G+ 
Sbjct  5    IAVIGSGIFVQEAHLPGIKANGDLFSLKATYSRSLSSAQKLSKAVESSIPDLYAEDAGSD  64

Query  237  -GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
                ++++ + I  V + +    Q     + L  GKHVL EKP A  +A A   +  YN 
Sbjct  65   KSYAKLLERSDIEAVVIALPILAQPNFIKKALSAGKHVLSEKPIAKDLATAHELIDWYNK  124

Query  414  LSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
               N+ T+K IWAVAE++R+   F    + + E+GD++  ++ +  ++     Y+ + W
Sbjct  125  ---NIDTKKTIWAVAEHFRYLGRFQYGAEQVKELGDVLGFRLRMHASVGPGAKYYETEW  180



>gb|KEQ74017.1| NAD(P)-binding protein [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=347

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 95/179 (53%), Gaps = 6/179 (3%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA-  236
            IA++GSGIFV+  ++P +     LF LKAI+SRS  SA+   +      P++  +  G+ 
Sbjct  5    IAVIGSGIFVQEAHLPGIKANKDLFSLKAIYSRSLSSAQKLSKEVETFTPDLYAEDAGSD  64

Query  237  -GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
                +++K + +  V + +   TQ +   + L  GKHVL EKP A  +  A   +  Y+ 
Sbjct  65   KSYADLLKRSDVEAVVIALPILTQPDFIKKALLAGKHVLSEKPVAKDLTTAHELIDWYHK  124

Query  414  LSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
               N+ T+K IWAVAEN+R+   F    + + E+G+++  ++ +   +     Y+ + W
Sbjct  125  ---NIDTKKTIWAVAENFRYLGRFQYGAERVKELGEILGFRLRMHALVQPGAKYYETEW  180



>dbj|GAA91490.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
kawachii IFO 4308]
Length=344

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 92/183 (50%), Gaps = 12/183 (7%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNH---FPNVEC---  221
            +AI+GSGIF K +++P L   S LF LKAI+SRS +SA S +  ++       NVE    
Sbjct  7    VAIIGSGIFAKEEHLPILT-TSPLFTLKAIYSRSLKSAESLISGSKGDDVVMKNVELYSE  65

Query  222  -KWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaL  398
                G   ++++    +  V + +    Q       L+ GKHVL EKP A  ++ A   L
Sbjct  66   DSEAGRRFQDLLAREDVRAVVIALPIPAQPSYIRAALQAGKHVLSEKPIAVDLSTARALL  125

Query  399  MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFS  578
              Y +L T    KP+W VAEN+RF   FT   + + ++G +   +V +   +   + Y  
Sbjct  126  SEYQALET----KPLWGVAENWRFLAKFTRVAEEVRKLGSVKAFRVGVRTLIGEGSKYHQ  181

Query  579  SSW  587
            + W
Sbjct  182  TEW  184



>ref|XP_001397204.1| NAD-binding Rossmann fold oxidoreductase family protein [Aspergillus 
niger CBS 513.88]
 emb|CAK42628.1| unnamed protein product [Aspergillus niger]
Length=342

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 94/181 (52%), Gaps = 10/181 (6%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHF-PNVEC----K  224
            +AI+GSGIF K +++P L+  S LF LKAI+SRS +SA + +  ++     NVE      
Sbjct  7    VAIIGSGIFAKEEHLPILS-ASPLFTLKAIYSRSLKSAETLISGSKEDVVKNVELYSEDS  65

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
              G   ++++    +  V + +    Q       L+ GKHVL EKP A  ++ A   L  
Sbjct  66   ESGRQFQDLLAREDVQAVIIALPIPAQPSYIRASLQAGKHVLSEKPIAGDLSTARALLSE  125

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSS  584
            Y SL+T    KP+W VAEN+RF   F+   + + ++G +   +V +   +   + Y  + 
Sbjct  126  YQSLAT----KPLWGVAENWRFLAKFSRVAEEVRKLGAVKAFRVSVRTLIGEGSKYHQTE  181

Query  585  W  587
            W
Sbjct  182  W  182



>ref|XP_009854174.1| hypothetical protein NEUTE1DRAFT_131795 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO54186.1| hypothetical protein NEUTE1DRAFT_131795 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ68383.1| NAD(P)-binding protein [Neurospora tetrasperma FGSC 2509]
Length=352

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 99/187 (53%), Gaps = 15/187 (8%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelar---NHFPNVECKWG  230
            IA+LG+GIF + Q++P +  +  L  LKAI+SRSE SA +    A    + + +V    G
Sbjct  4    IALLGAGIFAREQHLPAIESVPSL-SLKAIYSRSESSANTLASAASSPVDVYYDVPTGSG  62

Query  231  GAG-------LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeae  389
             A        L+ ++  T I  V + +    Q  +  + LK GKHVL EKP A  + EA+
Sbjct  63   EANVWPEEKTLDALLARTDIDAVVIALPILAQPAVIEKALKAGKHVLSEKPVAKDVEEAK  122

Query  390  naLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNV-QVIIEGTMNSSN  566
              +  Y +L     +KP+WAVAEN+R+ P+  +  + + EIG  +   ++ + G +   N
Sbjct  123  RLVGFYEALDN---KKPLWAVAENFRYTPSLLKAAEKVKEIGGKLTTFRLNMNGWVEEGN  179

Query  567  PYFSSSW  587
             YF + W
Sbjct  180  KYFKTEW  186



>gb|KEQ94380.1| hypothetical protein AUEXF2481DRAFT_270651 [Aureobasidium subglaciale 
EXF-2481]
Length=346

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 94/179 (53%), Gaps = 6/179 (3%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGA-  236
            IA++GSGIFV+  ++P +      F LKAI+SRS  SA+   +   +  P++  +  G+ 
Sbjct  5    IAVIGSGIFVQEAHLPGIKANGDQFSLKAIYSRSLASAQKLSKEVESSTPDLYAEDAGSD  64

Query  237  -GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
                ++++ + +  V + +    Q +   + L  GKHVL EKP A  +  A   +  Y+ 
Sbjct  65   KSYAKLLERSDVEAVVIALPILAQPDFIKKALSAGKHVLSEKPVAKDLKTAHELINWYHE  124

Query  414  LSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
               N+ T+K IWAVAEN+R+   F    + + E+GD++  ++ +   +     Y+ + W
Sbjct  125  ---NIDTKKVIWAVAENFRYLGRFQYGAEQVKELGDILGFRLRMHANVKPGAKYYETEW  180



>gb|KGO40526.1| Oxidoreductase, N-terminal [Penicillium expansum]
 gb|KGO63123.1| Oxidoreductase, N-terminal [Penicillium expansum]
 gb|KGO66915.1| Oxidoreductase, N-terminal [Penicillium expansum]
Length=500

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 89/176 (51%), Gaps = 3/176 (2%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGAG  239
            +AI+GSG+F K Q++P +   S  F LKAI+SRS +SA+             E       
Sbjct  5    VAIIGSGLFAKEQHLPAVQAASN-FQLKAIYSRSLKSAQDLASGTSEVDLYSEDSGSDKS  63

Query  240  LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLS  419
               ++  + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L  Y S  
Sbjct  64   YANLLARSDIGAVIIALPILVQPEFIKKALLAGKHVLSEKPIAKDVATAQELLKWYKS--  121

Query  420  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            T  T K  WAVAEN+R+   +    + + ++G + N +V +   M+ +N YF ++W
Sbjct  122  TIDTTKVFWAVAENFRYITKYLFAAEQVQKLGKVQNFRVNVHSLMDENNKYFHTAW  177



>ref|XP_011117421.1| hypothetical protein AOL_s00004g470 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53811.1| hypothetical protein AOL_s00004g470 [Arthrobotrys oligospora 
ATCC 24927]
Length=366

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 91/177 (51%), Gaps = 5/177 (3%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFP-NVECKWGGA  236
            +AILGSGIFV++Q+ P   +  +L  LKAI+SR + S  S +           +    G 
Sbjct  6    VAILGSGIFVESQHKPACLQDPELLTLKAIYSRRKTSVESIIANETIPIDVYSDDSEPGN  65

Query  237  GLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSL  416
             L++++K + I  V + +    Q E   + L  GKHVL EKP A  +A A   +    + 
Sbjct  66   NLDDLLKRSDIAFVIIALPIPHQPEFIKKALSAGKHVLSEKPVAKDLATANELIRWKKTN  125

Query  417  STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            + ++    IW+VAEN+R+ PAF   ++ +  +G ++   V +   +     YF ++W
Sbjct  126  APDL----IWSVAENFRYWPAFDYAEEKVKSLGKVLAFHVEVLQLVAPGGKYFETAW  178



>ref|XP_001275918.1| NAD-binding Rossmann fold oxidoreductase family protein [Aspergillus 
clavatus NRRL 1]
 gb|EAW14492.1| NAD-binding Rossmann fold oxidoreductase family protein [Aspergillus 
clavatus NRRL 1]
Length=341

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 93/176 (53%), Gaps = 3/176 (2%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGAG  239
            +AI+GSGIF + +++P + + ++ F L+A++SRS +SA+       +     E    G G
Sbjct  5    VAIIGSGIFAREEHLPAV-QAAKDFQLRAVYSRSLKSAQELASGTPDVELYSEDSGPGKG  63

Query  240  LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLS  419
              +++    I  V + +    Q E   + L  GKHVL EKP A  IA A + L  Y++  
Sbjct  64   YADLLARQDIAAVVIALPILVQPEFIRKALAAGKHVLSEKPIAKDIATARDLLQWYHA--  121

Query  420  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
               T+K +WAVAEN+R+   F    + + ++G + N +V     +   + Y+ ++W
Sbjct  122  NVDTRKTLWAVAENFRYMTKFIRAAEEVQKLGRVKNFRVHCHYLVEKDSKYYKTAW  177



>ref|XP_001906379.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP67045.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP28788.1| Putative Oxidoreductase [Podospora anserina S mat+]
Length=352

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 94/182 (52%), Gaps = 7/182 (4%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWG---  230
            IA+LG+GIF + +++P +     L  LKA++SRS+ S+ +  +      P  +  +    
Sbjct  4    IALLGAGIFARHEHLPAILASPDLLSLKAVYSRSQTSSVALADALPADGPKPDIYYDSPS  63

Query  231  --GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
              G GL +++K   I+ V V +    Q E+    LK GKHVL EKP AA +  A   +  
Sbjct  64   EPGRGLADLLKRDDIVAVDVALPILAQPEVIKAALKAGKHVLSEKPVAADVKGARELIKW  123

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGD-MMNVQVIIEGTMNSSNPYFSS  581
            Y +      +KP+W VAEN+R+  +     + +  IG  +++ ++   G +   N YF++
Sbjct  124  YET-ELPAEKKPLWGVAENFRYMKSLVFAGEEVKRIGGRVVSFKLEKFGWVAEDNKYFNT  182

Query  582  SW  587
             W
Sbjct  183  QW  184



>ref|XP_001261103.1| hypothetical protein NFIA_091650 [Neosartorya fischeri NRRL 181]
 gb|EAW19206.1| predicted protein [Neosartorya fischeri NRRL 181]
Length=360

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 93/174 (53%), Gaps = 5/174 (3%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGAG  239
            +AI+GSGIF + +++P + + ++ F LKAI+SRS +SA+             E    G G
Sbjct  5    VAIIGSGIFAREEHLPAV-QAAKDFQLKAIYSRSLKSAQDLASGTTRVDLYSEDSGPGKG  63

Query  240  LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLS  419
              +++    I  V + +    Q +   + L  GKHVL EKP A  IA A N L  Y++  
Sbjct  64   YADLLAREDIAAVLIALPILVQPDFIRKALTAGKHVLSEKPIAKDIATARNLLQWYHA--  121

Query  420  TNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFS  578
             N+ T K +WAVAEN+R+   F    + + ++G + N +V     +++ + YFS
Sbjct  122  -NIDTSKTLWAVAENFRYMTKFLRTAEEVQKLGRVKNFRVNSHALISTGSKYFS  174



>gb|KIR46111.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1280]
 gb|KIR58861.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1873]
Length=400

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 91/185 (49%), Gaps = 14/185 (8%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQL--FVLKAIWsrseesarsavelarNH-FPNVECKWG  230
            +A+LGSG+F +  Y+P L  +++    VL  IWSRSE SA++      +   P+ +  +G
Sbjct  5    VALLGSGVFAQASYVPALLSLARFKTLVLHTIWSRSESSAQTLHAKYTSSGAPSPQLLYG  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE ++ +  I  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y 
Sbjct  65   EDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAMELIEEYE  124

Query  411  SLSTNMTQKP---IWAVAENYRFEPAFTECKKMIA---EIGDMMNVQVIIEGTMNSSNPY  572
                    KP   IW VAENY  EPA      ++A   E+G ++   +     +   + Y
Sbjct  125  R-----DYKPKGLIWRVAENYAHEPALRFAGDILAKTSELGPVLFWDIKFTAYVEDGSKY  179

Query  573  FSSSW  587
             ++ W
Sbjct  180  HATGW  184



>gb|KIR84978.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
IND107]
Length=400

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 91/185 (49%), Gaps = 14/185 (8%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQL--FVLKAIWsrseesarsavelarNH-FPNVECKWG  230
            +A+LGSG+F +  Y+P L  +++    VL  IWSRSE SA++      +   P+ +  +G
Sbjct  5    VALLGSGVFAQASYVPALLSLARFKTLVLHTIWSRSESSAQTLHAKYTSSGAPSPQLLYG  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE ++ +  I  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y 
Sbjct  65   EDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVQEAMELIEEYE  124

Query  411  SLSTNMTQKP---IWAVAENYRFEPAFTECKKMIA---EIGDMMNVQVIIEGTMNSSNPY  572
                    KP   IW VAENY  EPA      ++A   E+G ++   +     +   + Y
Sbjct  125  R-----DYKPKGLIWRVAENYAHEPALRFAGDILAKTPELGPVLFWDIKFTAYVEDGSKY  179

Query  573  FSSSW  587
             ++ W
Sbjct  180  HATGW  184



>gb|KIK67859.1| hypothetical protein GYMLUDRAFT_36656 [Gymnopus luxurians FD-317 
M1]
Length=376

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 98/192 (51%), Gaps = 10/192 (5%)
 Frame = +3

Query  36   MAESQLPQIAILGSGIFVKTQYIPRLAEI-SQLFVLKAIWsrseesarsavelar-----  197
            MA+S++  IAILG+GIFV   Y+P LA + S    LKAI+SRSE+S+    + A      
Sbjct  1    MADSKISGIAILGAGIFVLEAYLPALAALGSASPPLKAIYSRSEKSSSEIAQKAAKILGL  60

Query  198  NHFPNVECKWGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaci  377
            ++ P+V        L+ ++  + I  V + +    Q  + L+ L  GKH+L EKP A  +
Sbjct  61   SYTPDVYFDQNDHNLDTLLSRSDIAAVIIALPITVQPNIVLKCLSAGKHILSEKPVAPDV  120

Query  378  aeaenaLMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMI--AEIGDMMNVQVIIEGT  551
            A     +     +        +W VAENY  EPA+   +  I   +IG+++  +  +   
Sbjct  121  AHGIQLIQEAEPICKE--HNLVWRVAENYEAEPAYRAARDAIQAGKIGNVIFFKASVFNY  178

Query  552  MNSSNPYFSSSW  587
            ++ S+ ++ + W
Sbjct  179  IDKSSKWYKTPW  190



>gb|KIR51601.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
Ru294]
Length=400

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 91/185 (49%), Gaps = 14/185 (8%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQL--FVLKAIWsrseesarsavelarNH-FPNVECKWG  230
            +A+LGSG+F +  Y+P L  +++    VL  IWSRSE SA++      +   P+ +  +G
Sbjct  5    VALLGSGVFAQASYVPALLSLARFKTLVLHTIWSRSESSAQTLHAKYTSSGAPSPQLLYG  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE ++ +  I  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y 
Sbjct  65   EDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAVELIEEYE  124

Query  411  SLSTNMTQKP---IWAVAENYRFEPAFTECKKMIA---EIGDMMNVQVIIEGTMNSSNPY  572
                    KP   IW +AENY  EPA      ++A   E+G ++   +     +   + Y
Sbjct  125  R-----DYKPKGLIWRIAENYAHEPALRFAGDILAKTPELGPVLFWDIKFTAYVEDGSKY  179

Query  573  FSSSW  587
             ++ W
Sbjct  180  HATGW  184



>ref|XP_571074.1| hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 ref|XP_775145.1| hypothetical protein CNBE4190 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL20498.1| hypothetical protein CNBE4190 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW43767.1| conserved hypothetical protein [Cryptococcus neoformans var. 
neoformans JEC21]
Length=400

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 92/185 (50%), Gaps = 14/185 (8%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQL--FVLKAIWsrseesarsavelarN-HFPNVECKWG  230
            +A+LGSG+F +  Y+P L  +++    VL  IWSRSE SA++  +   +   P+ +  +G
Sbjct  5    VALLGSGVFAQASYVPALLSLARFRTLVLHTIWSRSESSAQTLHDKYTSVGAPSPQLLYG  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE ++ +  I  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y 
Sbjct  65   DDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAMELIEEYE  124

Query  411  SLSTNMTQKP---IWAVAENYRFEPAFTECKKMIA---EIGDMMNVQVIIEGTMNSSNPY  572
                    KP   IW VAENY  EPA      ++A   E+G ++   +     +   + Y
Sbjct  125  R-----DYKPKGLIWRVAENYAHEPALRFAGDILAKTPELGPVLFWDLKFTSYVEDGSKY  179

Query  573  FSSSW  587
             ++ W
Sbjct  180  HATGW  184



>gb|KIL66602.1| hypothetical protein M378DRAFT_74962 [Amanita muscaria Koide 
BX008]
Length=377

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 100/203 (49%), Gaps = 30/203 (15%)
 Frame = +3

Query  45   SQLPQI--AILGSGIFVKTQYIPRLAEISQLFV------LKAIWsrseesarsavelarN  200
            S  PQI  AILG+GIF    +IP    IS  FV      LKA++SRSE+SA+     A  
Sbjct  2    SSSPQIGLAILGAGIFATEAWIP---AISAAFVQHPHYHLKAVYSRSEKSAQELSSKATQ  58

Query  201  HF-------PNVECKWG--GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQ  353
                     P V    G     L+ ++  + I  V VV+    Q ++ L++L  GKHVL 
Sbjct  59   ALKPRLAPSPTVYHDSGDESCNLDALLARSDIQAVIVVLPITLQPKIILKVLGAGKHVLS  118

Query  354  ekpaaaciaeaenaLMHYNSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE--IGD  518
            EKP AA + +    +  YN        KP   IW VAEN+  EP + +  +++ E  IGD
Sbjct  119  EKPVAADVKQGIELIRAYND-----KYKPRGLIWKVAENFEAEPGYRKAAELVREGRIGD  173

Query  519  MMNVQVIIEGTMNSSNPYFSSSW  587
            ++  + +IE  +   + Y+ + W
Sbjct  174  LIQFKAVIEAHVTQESKYYKTPW  196



>ref|XP_002956633.1| hypothetical protein VOLCADRAFT_119466 [Volvox carteri f. nagariensis]
 gb|EFJ42235.1| hypothetical protein VOLCADRAFT_119466 [Volvox carteri f. nagariensis]
Length=475

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +3

Query  321  RLLKGGKHVLQekpaaaciaeaenaLMHYNSL---STNMTQKPIWAVAENYRFEPAFTEC  491
            R L  GK V+QEKP AA +  A  A+  Y      + +  + P+W  AENYR+E  F   
Sbjct  149  RCLAAGKAVVQEKPVAATVEGALRAIASYRRAVGEAVDPQRTPLWMFAENYRYESVFVAA  208

Query  492  KKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
             + ++E+G ++ + +I +  M+  N Y+ S+W
Sbjct  209  SRRVSELGKIIKLDLIADLPMDERNRYYGSTW  240



>ref|XP_003194439.1| hypothetical protein CGB_E5470C [Cryptococcus gattii WM276]
 gb|ADV22652.1| conserved hypothetical protein [Cryptococcus gattii WM276]
 gb|KIR78390.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
EJB2]
 gb|KIY33083.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
E566]
 gb|KJE02904.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
NT-10]
Length=404

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 91/185 (49%), Gaps = 14/185 (8%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQL--FVLKAIWsrseesarsavel-arNHFPNVECKWG  230
            +A+LGSG+F +  Y+P L  +++    VL  IWSRSE SA++       +  P+ +  +G
Sbjct  5    VALLGSGVFAQASYVPALLSLARFKTLVLHTIWSRSESSAQTLHAKYTSSGAPSPQLLYG  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE ++ +  I  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y 
Sbjct  65   EDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAVELIEEY-  123

Query  411  SLSTNMTQKP---IWAVAENYRFEPAFTECKKMIA---EIGDMMNVQVIIEGTMNSSNPY  572
                    KP   IW +AENY  EPA      ++A   E+G ++   +     +   + Y
Sbjct  124  ----ERDYKPKGLIWRIAENYAHEPALRFAGDILAKTPELGPVLFWDIKFTAYVEDGSKY  179

Query  573  FSSSW  587
             ++ W
Sbjct  180  HATGW  184



>gb|KGB79428.1| hypothetical protein CNBG_5266 [Cryptococcus gattii R265]
 gb|KIR73591.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1014]
Length=400

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 90/182 (49%), Gaps = 8/182 (4%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEI--SQLFVLKAIWsrseesarsavelarNH-FPNVECKWG  230
            +A+LGSG+F +  Y+P L  +  S+  VL  +WSRSE SA++      +   P+ +  + 
Sbjct  5    VALLGSGVFAQASYVPALLSLARSKTLVLHTVWSRSESSAQTLHAKYTSSGAPSPQLLYD  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE ++ +  +  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y 
Sbjct  65   EDGLEAVLANKEVDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAMELIEEYE  124

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIA---EIGDMMNVQVIIEGTMNSSNPYFSS  581
                  T+  IW VAENY  EPA      ++A   E+G ++   +     +   + Y ++
Sbjct  125  --RDYKTKGLIWRVAENYAHEPALRFAGDILAKTPELGPVLFWDIKFTAYVEDGSKYHAT  182

Query  582  SW  587
             W
Sbjct  183  GW  184



>gb|KIR28998.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
LA55]
 gb|KIR34811.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
MMRL2647]
 gb|KIR38271.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
Ram5]
 gb|KIR93080.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CBS 10090]
 gb|KIY58151.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
99/473]
Length=400

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 90/182 (49%), Gaps = 8/182 (4%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEI--SQLFVLKAIWsrseesarsavelarNH-FPNVECKWG  230
            +A+LGSG+F +  Y+P L  +  S+  VL  +WSRSE SA++      +   P+ +  + 
Sbjct  5    VALLGSGVFAQASYVPALLSLARSKTLVLHTVWSRSESSAQTLHAKYTSSGAPSPQLLYD  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE ++ +  +  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y 
Sbjct  65   EDGLEAVLANKEVDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAMELIEEYE  124

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIA---EIGDMMNVQVIIEGTMNSSNPYFSS  581
                  T+  IW VAENY  EPA      ++A   E+G ++   +     +   + Y ++
Sbjct  125  --RDYKTKGLIWRVAENYAHEPALRFAGDILAKTPELGPVLFWDIKFTAYVEDGSKYHAT  182

Query  582  SW  587
             W
Sbjct  183  GW  184



>gb|KIR99656.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
2001/935-1]
Length=400

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 90/182 (49%), Gaps = 8/182 (4%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEI--SQLFVLKAIWsrseesarsavel-arNHFPNVECKWG  230
            +A+LGSG+F +  Y+P L  +  S+  VL  +WSRSE SA++       +  P+ +  + 
Sbjct  5    VALLGSGVFAQASYVPALLSLARSKTLVLHTVWSRSESSAQTLHAKYTSSGAPSPQLLYD  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE ++ +  +  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y 
Sbjct  65   EDGLEAVLANKEVDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAMELIEEYE  124

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIA---EIGDMMNVQVIIEGTMNSSNPYFSS  581
                  T+  IW VAENY  EPA      ++A   E+G ++   +     +   + Y ++
Sbjct  125  --RDYKTKGLIWRVAENYAHEPALRFAGDILAKTPELGPVLFWDIKFTAYVEDGSKYHAT  182

Query  582  SW  587
             W
Sbjct  183  GW  184



>gb|KJB66100.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=200

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  519  MMNVQVIIEGTMNSSNPYFSSSW  587
            MMNVQVIIEG+MNSSNPYFSSSW
Sbjct  1    MMNVQVIIEGSMNSSNPYFSSSW  23



>gb|EHK24126.1| hypothetical protein TRIVIDRAFT_45259 [Trichoderma virens Gv29-8]
Length=350

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 91/180 (51%), Gaps = 7/180 (4%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPN----VECKW  227
            +AI+G G+FVK  ++P + E  +LF LKAI+SRS +SA+    L  +  P      E   
Sbjct  7    VAIIGGGLFVKGSHLPAVLEC-ELFSLKAIYSRSLKSAQETANLIPDSVPQPDLYSEDSG  65

Query  228  GGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHY  407
             G   ++I++   I  V + +   +Q       L  GKHVL EKP A  ++ A   + + 
Sbjct  66   AGKSYQDILQRDDISAVIIALPILSQPSFIEAALSAGKHVLAEKPIAKDVSAARALIANA  125

Query  408  NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
              + ++   K   A+AEN RF P+F       A++G + N  V +   +   N +++++W
Sbjct  126  QRICSST--KATLAIAENIRFFPSFAYAASEAAKLGKVHNFSVRVLWRIEPDNKWYNTTW  183



>ref|XP_003840030.1| similar to oxidoreductase family [Leptosphaeria maculans JN3]
 emb|CBX96551.1| similar to oxidoreductase family [Leptosphaeria maculans JN3]
Length=342

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 92/176 (52%), Gaps = 4/176 (2%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGAG  239
            +AI+GSGIF K +++P + + +    LKA++SRS +SAR+  E   +     +    G  
Sbjct  5    VAIIGSGIFAKGEHLPAI-QATPTLSLKAVYSRSFKSARALTEDLSDGAIYSDDSPNGKR  63

Query  240  LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLS  419
             E++++   I GV + +   TQ E   + L  GKHVL  +   A       AL+ +   +
Sbjct  64   YEDLLRRDDITGVVIALPILTQPEFIKKALAAGKHVL-AEKPIAKDVATAQALLSWTQDA  122

Query  420  TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            +  T   ++AVAEN+R+  +F    + IA +G ++  +V +   + +   YF ++W
Sbjct  123  SETT--AMYAVAENFRYLDSFLYAAREIASLGRVLTFRVRVAAYVEAGGKYFETAW  176



>gb|AFR95702.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus neoformans 
var. grubii H99]
Length=400

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 91/185 (49%), Gaps = 14/185 (8%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQL--FVLKAIWsrseesarsavelarN-HFPNVECKWG  230
            +A+LGSG+F +  Y+P L  +++    VL  IWSRSE SA++      +   P+ +  +G
Sbjct  5    VALLGSGVFAQASYVPALLSLARFKTLVLHTIWSRSESSAQTLHAKYTSVGAPSPQLLYG  64

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
              GLE ++ +  I  V  V+    Q ++  +  K GKHVL EKP A  + EA   +  Y 
Sbjct  65   DDGLEAVLANKEIDAVLFVLPITKQPDLVRKAWKAGKHVLSEKPLARDVKEAVELIEEYE  124

Query  411  SLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGTMNSSNPY  572
                    KP   IW VAENY  EPA      ++++   +G ++   +     +   + Y
Sbjct  125  R-----DYKPKGLIWRVAENYAHEPALRFAGDILSKTPNLGPVLFWDIKFTAYVEDGSKY  179

Query  573  FSSSW  587
             ++ W
Sbjct  180  HATGW  184



>gb|EJT52097.1| hypothetical protein A1Q1_06635 [Trichosporon asahii var. asahii 
CBS 2479]
Length=405

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 90/183 (49%), Gaps = 9/183 (5%)
 Frame = +3

Query  57   QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarN----HFPNVECK  224
            + A+LG G+F    Y+P LA +  L V   IWSRS ESA      A+     + P+ E K
Sbjct  19   KAALLGGGLFATNSYVPSLALVPGLSV-STIWSRSPESASKLAAKAKETGLPNSPSPEVK  77

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
             G  GL+ I+ D SI  + +V+    Q E+  R  K GKHV+ EKP    + +A   +  
Sbjct  78   SGPDGLDAILADDSIRAIIMVLPLGVQPELIRRAWKAGKHVISEKPVGRDVEQASQLVEE  137

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGTMNSSNPYFS  578
            Y        +  +W VAEN+  EP      +++A  ++G ++  ++  E  +     Y +
Sbjct  138  YE--REWAPKGLVWRVAENFAHEPFLHRAARLLASPQVGPVLYYRMNFETVLLDGASYHA  195

Query  579  SSW  587
            ++W
Sbjct  196  TTW  198



>ref|XP_002626131.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ76920.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
SLH14081]
Length=345

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 97/181 (54%), Gaps = 8/181 (4%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC---KWG  230
            IA+LG+GIF +  ++P + + +   VL A++SRSE SA S VE   N    ++    +  
Sbjct  4    IALLGAGIFAREAHVPAILKNAAAKVL-AVYSRSENSANSVVEALNNTTTPIDVYSDEKP  62

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
            G GL+E+++   I  V V++       +  + L  GKHVL EKP A  IA     +  Y 
Sbjct  63   GHGLDELLQRPDIEAVIVLLPILVLPAVVRKCLAAGKHVLAEKPIAKDIATGRALITEYE  122

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGTMNSSNPYFSSS  584
              +T   +  +++VAE +R++  F +  +++A   IG++ +V   +  +M   N YF ++
Sbjct  123  --TTYAPRNLVFSVAEQFRYDTGFLKASEVVASGTIGELRHVHARVATSMAPENKYFQTA  180

Query  585  W  587
            W
Sbjct  181  W  181



>gb|EQL35203.1| hypothetical protein BDFG_03181 [Blastomyces dermatitidis ATCC 
26199]
Length=345

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 97/181 (54%), Gaps = 8/181 (4%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC---KWG  230
            IA+LG+GIF +  ++P + + +   VL A++SRSE SA S VE   N    ++    +  
Sbjct  4    IALLGAGIFAREAHVPAILKNAAAKVL-AVYSRSENSANSVVEALNNTTTPIDVYSDEKP  62

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
            G GL+E+++   I  V V++       +  + L  GKHVL EKP A  IA     +  Y 
Sbjct  63   GHGLDELLQRPDIEAVIVLLPILVLPAVVRKCLAAGKHVLAEKPIAKDIATGRALITEYE  122

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGTMNSSNPYFSSS  584
              +T   +  +++VAE +R++  F +  +++A   IG++ +V   +  +M   N YF ++
Sbjct  123  --TTYAPRNLVFSVAEQFRYDTGFLKASEVVASGTIGELRHVHARVATSMAPENKYFQTA  180

Query  585  W  587
            W
Sbjct  181  W  181



>dbj|GAD91687.1| hypothetical protein NFIA_091650, partial [Byssochlamys spectabilis 
No. 5]
Length=173

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 94/175 (54%), Gaps = 9/175 (5%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGAG  239
            +AI+GSGIF + +++P + + ++ F LKAI+SRS +SA++      N   N+  +  G+G
Sbjct  5    VAIVGSGIFAREEHLPAV-QAAKDFTLKAIYSRSLKSAQNLAGE--NSSINLYSEDSGSG  61

Query  240  --LEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNS  413
               ++++    I  V + +    Q E   + L  GKHVL EKP +  IA A+  +  Y S
Sbjct  62   KTYDDLLAREDIQAVIIALPIPIQPEFVRKALSAGKHVLSEKPISQDIAAAQELIKWYES  121

Query  414  LSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYF  575
               N+ T K  W VAENYR+   +    + I ++G + N +V +   +   + Y+
Sbjct  122  ---NIDTSKVFWGVAENYRYMKQYVYAAEQIRKLGRVRNFRVNMHTKVQPDSKYY  173



>gb|EGE83963.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
ATCC 18188]
Length=345

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 97/181 (54%), Gaps = 8/181 (4%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC---KWG  230
            IA+LG+GIF +  ++P + + +   VL A++SRSE SA S VE   N    ++    +  
Sbjct  4    IALLGAGIFAREAHVPAILKNAAAKVL-AVYSRSENSANSVVEALNNTTTPIDVYSDEKP  62

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
            G GL+E+++   I  V V++       +  + L  GKHVL EKP A  IA     +  Y 
Sbjct  63   GHGLDELLQRPDIEAVIVLLPILVLPAVVRKCLAAGKHVLAEKPIAKDIATGRALITEYE  122

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGTMNSSNPYFSSS  584
              +T   +  +++VAE +R++  F +  +++A   IG++ +V   +  +M   N YF ++
Sbjct  123  --TTYAPRNLVFSVAEQFRYDTGFLKASEVVASGTIGELHHVHARVATSMAPENKYFQTA  180

Query  585  W  587
            W
Sbjct  181  W  181



>gb|EKD02419.1| hypothetical protein A1Q2_03311 [Trichosporon asahii var. asahii 
CBS 8904]
Length=405

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 90/183 (49%), Gaps = 9/183 (5%)
 Frame = +3

Query  57   QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarN----HFPNVECK  224
            + A+LG G+F    Y+P LA +  L V   IWSRS ESA      A+     + P+ E K
Sbjct  19   KAALLGGGLFATNSYVPSLALVPGLSV-STIWSRSPESASKLAAKAKETGLPNSPSPEVK  77

Query  225  WGGAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMH  404
             G  GL+ I+ D SI  + +V+    Q E+  R  K GKHV+ EKP    + +A   +  
Sbjct  78   SGPDGLDAILADDSIRAIIMVLPLGVQPELIRRAWKAGKHVISEKPVGRDVEQASQLVEE  137

Query  405  YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGTMNSSNPYFS  578
            Y        +  +W VAEN+  EP      +++A  ++G ++  ++  E  +     Y +
Sbjct  138  YE--REWAPKGLVWRVAENFAHEPFLHRAARLLASPQVGPVVYYRMNFETVLLDGASYHA  195

Query  579  SSW  587
            ++W
Sbjct  196  TTW  198



>gb|EEQ92492.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
ER-3]
Length=345

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 97/181 (54%), Gaps = 8/181 (4%)
 Frame = +3

Query  60   IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVEC---KWG  230
            IA+LG+GIF +  ++P + + +   VL A++SRSE SA S VE   N    ++    +  
Sbjct  4    IALLGAGIFAREAHVPAILKNAAAKVL-AVYSRSENSANSVVEALNNTTTPIDVYSDEKP  62

Query  231  GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYN  410
            G GL+E+++   I  V V++       +  + L  GKHVL EKP A  IA     +  Y 
Sbjct  63   GHGLDELLQRPDIEAVIVLLPILVLPAVVRKCLAAGKHVLAEKPIAKDIATGRALITEYE  122

Query  411  SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGTMNSSNPYFSSS  584
              +T   +  +++VAE +R++  F +  +++A   IG++ +V   +  +M   N YF ++
Sbjct  123  --TTYAPRNLVFSVAEQFRYDTGFLKASEVVASGTIGELHHVHARVATSMAPENKYFQTA  180

Query  585  W  587
            W
Sbjct  181  W  181



>gb|KIL66581.1| hypothetical protein M378DRAFT_123742 [Amanita muscaria Koide 
BX008]
Length=379

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 99/203 (49%), Gaps = 30/203 (15%)
 Frame = +3

Query  45   SQLPQI--AILGSGIFVKTQYIPRLAEISQLFV------LKAIWsrseesarsavelarN  200
            S  PQI  AILG+GIF    +IP    IS   V      LKA++SRSE+SA+     A  
Sbjct  2    SSSPQIGLAILGAGIFATEAWIP---AISAALVQHPHHHLKAVYSRSEKSAQELSSKATQ  58

Query  201  HF-------PNVECKWG--GAGLEEIIKDtsiigvavvvagqtqvEMSLRLLKGGKHVLQ  353
                     P V    G     L+ ++  + I  V VV+    Q ++ L+ L+ GKHVL 
Sbjct  59   ALKPRLSPSPTVYHDSGDEACNLDALLARSDIQAVIVVLPITVQPKIVLKALEAGKHVLS  118

Query  354  ekpaaaciaeaenaLMHYNSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE--IGD  518
            EKP AA + +    +  YN        KP   IW VAENY  EP + +  +++ E  IG 
Sbjct  119  EKPVAADVKQGVELIRVYND-----KYKPRGLIWKVAENYEAEPGYRKAAELVREGRIGQ  173

Query  519  MMNVQVIIEGTMNSSNPYFSSSW  587
            ++  + ++E  +   + Y+ +SW
Sbjct  174  LIQFKAVVEVNVTQESKYYKTSW  196



>ref|XP_002567221.1| Pc21g01510 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP95048.1| Pc21g01510 [Penicillium rubens Wisconsin 54-1255]
Length=332

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 85/171 (50%), Gaps = 5/171 (3%)
 Frame = +3

Query  78   GIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelarNHFPNVECKWGGAGLEEIIK  257
            G+F K Q++P +   S  F LKAI+SRS +SA+             E    G    +++ 
Sbjct  4    GLFAKEQHLPAVQAASN-FQLKAIYSRSLKSAKDLASGTAEVDLYSEDSGSGKSYTDLLA  62

Query  258  DtsiigvavvvagqtqvEMSLRLLKGGKHVLQekpaaaciaeaenaLMHYNSLSTNM-TQ  434
             + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L    S   N+ T+
Sbjct  63   RSDIGAVIIALPILVQPEFIKKALLAGKHVLSEKPIAKDVATAQELLKWCKS---NIDTR  119

Query  435  KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGTMNSSNPYFSSSW  587
            K  WAVAEN+R+   F    + + ++G + N +V +   M+  N YF ++W
Sbjct  120  KVFWAVAENFRYMKKFLFAAEQVQKLGKVQNFRVNVHSLMDKGNKYFHTAW  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925