BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003I08

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009138940.1|  PREDICTED: 60S ribosomal protein L11-1-like        314   1e-105   Brassica rapa
ref|NP_001266161.1|  60S ribosomal protein L11-like                     310   1e-104   Cicer arietinum [garbanzo]
ref|XP_002510391.1|  60S ribosomal protein L11, putative                310   1e-104   Ricinus communis
emb|CDX71934.1|  BnaC08g29400D                                          313   2e-104   
gb|KDP21119.1|  hypothetical protein JCGZ_21590                         309   3e-104   Jatropha curcas
ref|XP_004505457.1|  PREDICTED: 60S ribosomal protein L11-like          309   3e-104   
ref|XP_002522234.1|  60S ribosomal protein L11, putative                309   4e-104   Ricinus communis
sp|P46287.1|RL11_MEDSA  RecName: Full=60S ribosomal protein L11; ...    309   4e-104   Medicago sativa [alfalfa]
ref|XP_007215050.1|  hypothetical protein PRUPE_ppa012119mg             309   4e-104   Prunus persica
ref|XP_006850965.1|  hypothetical protein AMTR_s00025p00203150          309   5e-104   Amborella trichopoda
ref|XP_010246451.1|  PREDICTED: 60S ribosomal protein L11-like          309   5e-104   Nelumbo nucifera [Indian lotus]
ref|XP_010274422.1|  PREDICTED: 60S ribosomal protein L11               308   6e-104   Nelumbo nucifera [Indian lotus]
ref|XP_009628928.1|  PREDICTED: 60S ribosomal protein L11-1             308   6e-104   Nicotiana tomentosiformis
ref|XP_008381196.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    308   7e-104   Malus domestica [apple tree]
ref|XP_009132192.1|  PREDICTED: 60S ribosomal protein L11-2 isofo...    308   7e-104   Brassica rapa
ref|XP_006398262.1|  hypothetical protein EUTSA_v10001041mg             308   7e-104   Eutrema salsugineum [saltwater cress]
gb|AFK48866.1|  unknown                                                 308   7e-104   Lotus japonicus
ref|XP_009383242.1|  PREDICTED: 60S ribosomal protein L11               308   8e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404521.1|  PREDICTED: 60S ribosomal protein L11               308   9e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009378940.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    308   9e-104   Pyrus x bretschneideri [bai li]
ref|NP_001237077.1|  uncharacterized protein LOC100499863               308   1e-103   Glycine max [soybeans]
emb|CDY49245.1|  BnaA09g55240D                                          311   1e-103   Brassica napus [oilseed rape]
gb|EYU21905.1|  hypothetical protein MIMGU_mgv1a014651mg                308   1e-103   Erythranthe guttata [common monkey flower]
gb|EYU29260.1|  hypothetical protein MIMGU_mgv1a014673mg                308   1e-103   Erythranthe guttata [common monkey flower]
emb|CDY26360.1|  BnaA02g24100D                                          309   1e-103   Brassica napus [oilseed rape]
ref|XP_003540015.1|  PREDICTED: 60S ribosomal protein L11-like          307   2e-103   
ref|XP_011082984.1|  PREDICTED: 60S ribosomal protein L11               307   2e-103   Sesamum indicum [beniseed]
ref|XP_006446820.1|  hypothetical protein CICLE_v10016875mg             307   2e-103   Citrus clementina [clementine]
ref|XP_010525185.1|  PREDICTED: 60S ribosomal protein L11-1             307   2e-103   Tarenaya hassleriana [spider flower]
ref|XP_009629723.1|  PREDICTED: 60S ribosomal protein L11-1-like        307   3e-103   Nicotiana tomentosiformis
ref|XP_010915478.1|  PREDICTED: 60S ribosomal protein L11-like          307   3e-103   Elaeis guineensis
ref|XP_004293968.1|  PREDICTED: 60S ribosomal protein L11               307   3e-103   Fragaria vesca subsp. vesca
ref|XP_006843688.1|  hypothetical protein AMTR_s00007p00200160          307   3e-103   Amborella trichopoda
ref|XP_008225318.1|  PREDICTED: 60S ribosomal protein L11               307   3e-103   Prunus mume [ume]
ref|NP_191429.1|  60S ribosomal protein L11-2                           307   3e-103   Arabidopsis thaliana [mouse-ear cress]
gb|AFK35020.1|  unknown                                                 306   3e-103   Lotus japonicus
ref|XP_008228941.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    307   3e-103   Prunus mume [ume]
ref|XP_010529208.1|  PREDICTED: 60S ribosomal protein L11-1-like        306   3e-103   Tarenaya hassleriana [spider flower]
ref|XP_009365286.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    306   3e-103   Pyrus x bretschneideri [bai li]
ref|NP_850376.2|  60S ribosomal protein L16A                            306   3e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KHN42782.1|  60S ribosomal protein L11                               306   4e-103   Glycine soja [wild soybean]
ref|XP_008786958.1|  PREDICTED: 60S ribosomal protein L11-like          306   4e-103   Phoenix dactylifera
ref|XP_003628237.1|  60S ribosomal protein L11                          306   4e-103   Medicago truncatula
ref|XP_007132813.1|  hypothetical protein PHAVU_011G126600g             306   4e-103   Phaseolus vulgaris [French bean]
ref|XP_009408897.1|  PREDICTED: 60S ribosomal protein L11               306   4e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK22492.1|  unknown                                                 306   4e-103   Picea sitchensis
ref|XP_010936718.1|  PREDICTED: 60S ribosomal protein L11               306   4e-103   Elaeis guineensis
gb|AFK37822.1|  unknown                                                 306   4e-103   Medicago truncatula
ref|XP_009405599.1|  PREDICTED: 60S ribosomal protein L11-like is...    306   4e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403504.1|  PREDICTED: 60S ribosomal protein L11               306   5e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006414065.1|  hypothetical protein EUTSA_v10026344mg             306   5e-103   Eutrema salsugineum [saltwater cress]
ref|XP_009132184.1|  PREDICTED: 60S ribosomal protein L11-2 isofo...    306   5e-103   Brassica rapa
emb|CDX99436.1|  BnaC01g11160D                                          306   5e-103   
ref|XP_004134655.1|  PREDICTED: 60S ribosomal protein L11-1-like        306   5e-103   Cucumis sativus [cucumbers]
ref|XP_008381195.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    306   5e-103   Malus domestica [apple tree]
ref|XP_008343092.1|  PREDICTED: 60S ribosomal protein L11-like is...    306   5e-103   
gb|AFP44117.1|  60S ribosomal protein                                   306   5e-103   Lycoris longituba
ref|XP_009378939.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    306   6e-103   Pyrus x bretschneideri [bai li]
emb|CDX87764.1|  BnaC02g31850D                                          308   6e-103   
ref|XP_011081868.1|  PREDICTED: 60S ribosomal protein L11-like          306   7e-103   Sesamum indicum [beniseed]
ref|XP_006449533.1|  hypothetical protein CICLE_v10016873mg             306   7e-103   Citrus clementina [clementine]
ref|NP_001238636.1|  uncharacterized protein LOC100305912               306   7e-103   Glycine max [soybeans]
gb|KHG23956.1|  60S ribosomal L11-2 -like protein                       305   9e-103   Gossypium arboreum [tree cotton]
ref|XP_002309361.1|  60S ribosomal protein L11                          305   9e-103   Populus trichocarpa [western balsam poplar]
ref|XP_009790976.1|  PREDICTED: 60S ribosomal protein L11-1             305   9e-103   Nicotiana sylvestris
ref|XP_007148755.1|  hypothetical protein PHAVU_005G011400g             305   9e-103   Phaseolus vulgaris [French bean]
emb|CAA57395.1|  ribosomal protein L16                                  305   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009626014.1|  PREDICTED: 60S ribosomal protein L11-1-like        305   1e-102   Nicotiana tomentosiformis
ref|XP_010052848.1|  PREDICTED: 60S ribosomal protein L11-1             305   1e-102   Eucalyptus grandis [rose gum]
ref|XP_003598139.1|  60S ribosomal protein L11                          305   1e-102   Medicago truncatula
gb|AFK38385.1|  unknown                                                 305   1e-102   Lotus japonicus
gb|EYU41113.1|  hypothetical protein MIMGU_mgv1a014638mg                305   1e-102   Erythranthe guttata [common monkey flower]
ref|XP_011033383.1|  PREDICTED: 60S ribosomal protein L11-like          305   1e-102   Populus euphratica
ref|XP_011039398.1|  PREDICTED: 60S ribosomal protein L11               305   1e-102   Populus euphratica
emb|CAA57394.1|  ribosomal protein L16                                  305   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28544.1|  hypothetical protein AALP_AA7G010400                    305   1e-102   Arabis alpina [alpine rockcress]
gb|KJB57391.1|  hypothetical protein B456_009G161300                    305   2e-102   Gossypium raimondii
ref|XP_002880003.1|  60S ribosomal protein L11                          305   2e-102   Arabidopsis lyrata subsp. lyrata
ref|XP_011088013.1|  PREDICTED: 60S ribosomal protein L11-like          305   2e-102   Sesamum indicum [beniseed]
ref|XP_008345917.1|  PREDICTED: 60S ribosomal protein L11               305   2e-102   Malus domestica [apple tree]
ref|XP_009116550.1|  PREDICTED: 60S ribosomal protein L11-1             305   2e-102   Brassica rapa
ref|XP_010052835.1|  PREDICTED: 60S ribosomal protein L11-1-like        305   2e-102   Eucalyptus grandis [rose gum]
ref|XP_010427776.1|  PREDICTED: 60S ribosomal protein L11-1-like        305   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_002281886.1|  PREDICTED: 60S ribosomal protein L11               305   2e-102   Vitis vinifera
ref|XP_006285819.1|  hypothetical protein CARUB_v10007309mg             305   2e-102   Capsella rubella
gb|KHN01495.1|  60S ribosomal protein L11                               306   2e-102   Glycine soja [wild soybean]
ref|XP_009351472.1|  PREDICTED: 60S ribosomal protein L11               305   2e-102   Pyrus x bretschneideri [bai li]
ref|XP_002876475.1|  60S ribosomal protein L11                          305   2e-102   
ref|NP_001132260.1|  hypothetical protein                               305   2e-102   Zea mays [maize]
gb|ACJ86159.1|  unknown                                                 304   2e-102   Medicago truncatula
ref|XP_008443441.1|  PREDICTED: 60S ribosomal protein L11-1             305   2e-102   Cucumis melo [Oriental melon]
ref|XP_007025337.1|  Ribosomal protein large subunit 16A                307   2e-102   
ref|XP_003607648.1|  60S ribosomal protein L11-1                        304   2e-102   Medicago truncatula
ref|XP_010538572.1|  PREDICTED: 60S ribosomal protein L11-1-like ...    305   3e-102   Tarenaya hassleriana [spider flower]
gb|KHN27796.1|  60S ribosomal protein L11                               304   3e-102   Glycine soja [wild soybean]
ref|XP_009365285.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    305   3e-102   Pyrus x bretschneideri [bai li]
pir||T04865  ribosomal protein L11, cytosolic - Arabidopsis thaliana    304   3e-102
ref|XP_010538574.1|  PREDICTED: 60S ribosomal protein L11-1-like ...    304   3e-102   Tarenaya hassleriana [spider flower]
ref|XP_008362518.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    304   3e-102   
ref|XP_009405598.1|  PREDICTED: 60S ribosomal protein L11-like is...    304   3e-102   
ref|XP_008343091.1|  PREDICTED: 60S ribosomal protein L11-like is...    304   4e-102   
ref|XP_010052179.1|  PREDICTED: 60S ribosomal protein L11-1             304   4e-102   Eucalyptus grandis [rose gum]
gb|AAR83867.1|  ribosomal protein L11-like protein                      304   4e-102   Capsicum annuum
gb|KHG08920.1|  60S ribosomal L11-1 -like protein                       304   4e-102   Gossypium arboreum [tree cotton]
ref|XP_007048733.1|  Ribosomal L5P family protein isoform 1             304   4e-102   Theobroma cacao [chocolate]
ref|XP_010689742.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    304   5e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001149684.1|  60S ribosomal protein L11-1                        303   8e-102   Zea mays [maize]
ref|XP_008782472.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    303   1e-101   Phoenix dactylifera
gb|KDO77896.1|  hypothetical protein CISIN_1g029665mg                   303   1e-101   Citrus sinensis [apfelsine]
ref|XP_002451841.1|  hypothetical protein SORBIDRAFT_04g008530          303   1e-101   Sorghum bicolor [broomcorn]
ref|XP_004133952.1|  PREDICTED: 60S ribosomal protein L11-2-like ...    303   1e-101   Cucumis sativus [cucumbers]
ref|NP_001046386.1|  Os02g0235600                                       303   1e-101   
gb|ABK93207.1|  unknown                                                 303   1e-101   Populus trichocarpa [western balsam poplar]
ref|NP_001132427.1|  60S ribosomal protein L11-1                        303   1e-101   Zea mays [maize]
ref|XP_008366039.1|  PREDICTED: 60S ribosomal protein L11-1             303   1e-101   Malus domestica [apple tree]
ref|XP_004133951.1|  PREDICTED: 60S ribosomal protein L11-2-like ...    303   1e-101   Cucumis sativus [cucumbers]
ref|NP_001274979.1|  60S ribosomal protein L11-2-like                   302   1e-101   Solanum tuberosum [potatoes]
ref|NP_001148395.1|  LOC100282010                                       302   1e-101   Zea mays [maize]
ref|XP_004976770.1|  PREDICTED: 60S ribosomal protein L11-like          302   1e-101   Setaria italica
ref|NP_001242757.1|  uncharacterized protein LOC100778713               302   2e-101   Glycine max [soybeans]
ref|XP_008362517.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    302   2e-101   
gb|ADE77225.1|  unknown                                                 302   2e-101   Picea sitchensis
ref|XP_006578416.1|  PREDICTED: 60S ribosomal protein L11-like          302   3e-101   
ref|NP_001131414.1|  uncharacterized protein LOC100192743               301   3e-101   Zea mays [maize]
ref|XP_010689741.1|  PREDICTED: 60S ribosomal protein L11-1 isofo...    301   4e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006654147.1|  PREDICTED: 60S ribosomal protein L11-like          301   4e-101   Oryza brachyantha
ref|XP_002454974.1|  hypothetical protein SORBIDRAFT_03g002420          301   4e-101   
gb|ACG31637.1|  60S ribosomal protein L11-1                             301   4e-101   Zea mays [maize]
gb|AFW65990.1|  hypothetical protein ZEAMMB73_747842                    301   6e-101   
ref|XP_007214493.1|  hypothetical protein PRUPE_ppa020372mg             304   8e-101   
ref|XP_004968572.1|  PREDICTED: 60S ribosomal protein L11-like          300   9e-101   Setaria italica
ref|XP_010102117.1|  60S ribosomal protein L11-2                        301   1e-100   
ref|XP_006643887.1|  PREDICTED: 60S ribosomal protein L11-like          300   1e-100   Oryza brachyantha
ref|NP_001054899.1|  Os05g0207300                                       300   1e-100   
gb|KHG13747.1|  60S ribosomal L11-1 -like protein                       300   1e-100   Gossypium arboreum [tree cotton]
ref|XP_001759707.1|  predicted protein                                  300   2e-100   
gb|ADY38658.1|  putative 60S ribosomal protein L11                      300   2e-100   Wolffia arrhiza
ref|NP_001042339.1|  Os01g0205500                                       299   2e-100   
ref|XP_010940061.1|  PREDICTED: 60S ribosomal protein L11-like          299   3e-100   Elaeis guineensis
ref|XP_008790022.1|  PREDICTED: 60S ribosomal protein L11-like          299   3e-100   Phoenix dactylifera
ref|XP_001762314.1|  predicted protein                                  298   9e-100   
gb|AAT08727.1|  60S ribosomal protein L11                               298   9e-100   Hyacinthus orientalis [common hyacinth]
ref|XP_008795915.1|  PREDICTED: 60S ribosomal protein L11-like          298   1e-99    Phoenix dactylifera
ref|XP_001760204.1|  predicted protein                                  297   2e-99    
ref|XP_002270266.1|  PREDICTED: 60S ribosomal protein L11-1-like        297   3e-99    Vitis vinifera
ref|XP_006648487.1|  PREDICTED: 60S ribosomal protein L11-like          297   3e-99    Oryza brachyantha
gb|KHG21292.1|  60S ribosomal protein L11-1                             296   1e-98    Gossypium arboreum [tree cotton]
gb|KHG21293.1|  60S ribosomal protein L11-1                             294   7e-98    Gossypium arboreum [tree cotton]
ref|XP_003565263.1|  PREDICTED: 60S ribosomal protein L11               291   5e-97    Brachypodium distachyon [annual false brome]
gb|EMS61347.1|  60S ribosomal protein L11                               290   8e-97    Triticum urartu
emb|CDY60533.1|  BnaAnng16950D                                          290   1e-96    Brassica napus [oilseed rape]
emb|CDY62552.1|  BnaA03g58370D                                          290   1e-96    Brassica napus [oilseed rape]
gb|KHN20558.1|  Endoglucanase 9                                         305   2e-96    Glycine soja [wild soybean]
gb|KHN11195.1|  60S ribosomal protein L11                               288   3e-96    Glycine soja [wild soybean]
ref|XP_010516520.1|  PREDICTED: 60S ribosomal protein L11-1-like        288   5e-96    Camelina sativa [gold-of-pleasure]
ref|NP_851137.1|  60S ribosomal protein L11-2                           288   5e-96    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85332.1|  predicted protein                                      288   6e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
pdb|3J61|J  Chain J, Localization Of The Large Subunit Ribosomal ...    287   1e-95    Triticum aestivum [Canadian hard winter wheat]
gb|ACD56663.1|  putative ribosomal protein                              286   2e-95    Gossypium arboreum [tree cotton]
ref|XP_007048734.1|  Ribosomal L5P family protein isoform 2             286   2e-95    Theobroma cacao [chocolate]
gb|AAT64021.1|  putative ribosomal protein                              286   2e-95    Gossypium hirsutum [American cotton]
gb|ACN35575.1|  unknown                                                 286   3e-95    Zea mays [maize]
emb|CBI22012.3|  unnamed protein product                                286   3e-95    Vitis vinifera
gb|KJB34908.1|  hypothetical protein B456_006G089700                    285   7e-95    Gossypium raimondii
ref|XP_001751962.1|  predicted protein                                  284   1e-94    
ref|XP_002981065.1|  hypothetical protein SELMODRAFT_444767             284   2e-94    Selaginella moellendorffii
ref|XP_006656151.1|  PREDICTED: 60S ribosomal protein L11-like          284   3e-94    
gb|EMS66091.1|  60S ribosomal protein L11                               285   6e-94    Triticum urartu
gb|ADR71243.1|  60S ribosomal protein L11A                              282   1e-93    Hevea brasiliensis [jebe]
emb|CDP15952.1|  unnamed protein product                                282   1e-93    Coffea canephora [robusta coffee]
tpg|DAA52967.1|  TPA: hypothetical protein ZEAMMB73_694767              301   1e-93    
gb|AAB82139.1|  ribosomal protein                                       281   4e-93    Oryza sativa Indica Group [Indian rice]
emb|CBI30709.3|  unnamed protein product                                280   9e-93    Vitis vinifera
ref|XP_002438544.1|  hypothetical protein SORBIDRAFT_10g021710          280   1e-92    
gb|AAD21733.1|  60S ribosomal protein L11B                              278   5e-92    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD53703.1|  putative 60S ribosomal protein L11-1                   274   2e-90    Oryza sativa Japonica Group [Japonica rice]
gb|ABR25412.1|  60S ribosomal protein l11                               273   2e-90    Oryza sativa Indica Group [Indian rice]
gb|KHN28096.1|  60S ribosomal protein L11                               272   7e-90    Glycine soja [wild soybean]
gb|AAQ96376.1|  ribosomal protein L11-like protein                      271   1e-89    Solanum palustre
ref|XP_011397124.1|  60S ribosomal protein L11-1                        267   1e-87    Auxenochlorella protothecoides
ref|XP_009617442.1|  PREDICTED: 60S ribosomal protein L11-1-like        265   7e-87    Nicotiana tomentosiformis
gb|KDD76069.1|  hypothetical protein H632_c370p1                        264   3e-86    Helicosporidium sp. ATCC 50920
ref|XP_005647682.1|  ribosomal protein L5                               259   2e-84    Coccomyxa subellipsoidea C-169
emb|CBJ30107.1|  conserved unknown protein                              258   3e-84    Ectocarpus siliculosus
gb|KIY97763.1|  60S ribosomal protein L11                               256   2e-83    Monoraphidium neglectum
tpe|CAL69062.1|  TPA: putative 60S ribosomal protein L11                256   9e-83    Spadella cephaloptera
ref|XP_010244733.1|  PREDICTED: 60S ribosomal protein L11-1-like        252   6e-82    Nelumbo nucifera [Indian lotus]
gb|KJB57390.1|  hypothetical protein B456_009G161300                    251   9e-82    Gossypium raimondii
gb|AIU94837.1|  60S ribosomal protein                                   250   7e-81    Phragmatopoma lapidosa
ref|XP_003598138.1|  60S ribosomal protein L11-1                        251   1e-80    Medicago truncatula
emb|CCI45988.1|  unnamed protein product                                247   6e-80    Albugo candida
emb|CEF97266.1|  Ribosomal protein L5, conserved site                   247   8e-80    Ostreococcus tauri
gb|KDB13460.1|  60S ribosomal protein L11                               247   8e-80    Ustilaginoidea virens
emb|CCE35354.1|  probable ribosomal protein L11.e.A, cytosolic          247   8e-80    Claviceps purpurea 20.1
ref|XP_007874680.1|  hypothetical protein PNEG_02659                    246   1e-79    Pneumocystis murina B123
gb|KHN95345.1|  60S ribosomal protein L11                               246   2e-79    Metarhizium album ARSEF 1941
ref|XP_001607270.1|  PREDICTED: 60S ribosomal protein L11               247   2e-79    Nasonia vitripennis
ref|XP_004220956.1|  60S ribosomal protein L11                          246   2e-79    Plasmodium cynomolgi strain B
ref|XP_679576.1|  60S ribosomal protein L11a                            246   2e-79    Plasmodium berghei ANKA
gb|KFM71516.1|  60S ribosomal protein L11                               246   2e-79    Stegodyphus mimosarum
ref|XP_009261766.1|  hypothetical protein FPSE_10374                    246   2e-79    Fusarium pseudograminearum CS3096
emb|CCE35372.1|  probable ribosomal protein L11.e.A, cytosolic          246   3e-79    Claviceps purpurea 20.1
gb|EGU80777.1|  hypothetical protein FOXB_08644                         245   3e-79    Fusarium oxysporum Fo5176
gb|AGM32143.1|  60S ribosomal protein L11                               246   4e-79    Coptotermes formosanus
ref|XP_007811586.1|  60S ribosomal protein L11                          245   4e-79    Metarhizium acridum CQMa 102
ref|XP_965640.2|  60S ribosomal protein L11                             245   4e-79    Neurospora crassa OR74A
gb|KIL95260.1|  hypothetical protein FAVG1_02195                        244   6e-79    Fusarium avenaceum
ref|XP_008625536.1|  60S ribosomal protein L11                          244   6e-79    Plasmodium vinckei vinckei
gb|EQL04255.1|  Ribosomal protein L5                                    244   6e-79    Ophiocordyceps sinensis CO18
ref|XP_001612822.1|  60S ribosomal protein L11                          244   7e-79    Plasmodium vivax
gb|ELW68491.1|  60S ribosomal protein L11                               246   7e-79    Tupaia chinensis
emb|CCF73368.1|  unnamed protein product                                244   9e-79    Babesia microti strain RI
ref|XP_005988804.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    244   1e-78    Latimeria chalumnae
gb|KFA66324.1|  hypothetical protein S40285_01884                       244   1e-78    Stachybotrys chlorohalonata IBT 40285
ref|XP_003054198.1|  60S ribosomal protein L11                          244   1e-78    [Nectria] haematococca mpVI 77-13-4
gb|KID77365.1|  Ribosomal protein L5                                    244   1e-78    Metarhizium brunneum ARSEF 3297
gb|EHK17585.1|  hypothetical protein TRIVIDRAFT_76021                   244   1e-78    Trichoderma virens Gv29-8
ref|XP_004678660.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    244   1e-78    
gb|KFA73465.1|  hypothetical protein S40288_08466                       244   1e-78    Stachybotrys chartarum IBT 40288
ref|XP_006963013.1|  60S ribosomal protein L11, L5 family               244   2e-78    Trichoderma reesei QM6a
ref|XP_007785480.1|  60S ribosomal protein L11                          244   2e-78    Endocarpon pusillum Z07020
ref|XP_004603489.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    244   2e-78    Sorex araneus [Eurasian shrew]
gb|EPX72141.1|  60S ribosomal protein L11                               243   2e-78    Schizosaccharomyces octosporus yFS286
ref|XP_002261116.1|  60S ribosomal protein L11a                         243   2e-78    Plasmodium knowlesi strain H
gb|AAX42399.1|  ribosomal protein L11                                   243   2e-78    synthetic construct
ref|XP_003351085.1|  60S ribosomal protein L11                          243   2e-78    Sordaria macrospora k-hell
ref|XP_006179217.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    243   3e-78    
ref|XP_007511979.1|  60S ribosomal protein L11                          243   3e-78    Bathycoccus prasinos
ref|NP_001186731.1|  60S ribosomal protein L11 isoform 2                243   3e-78    Homo sapiens [man]
gb|AAX29834.1|  ribosomal protein L11                                   243   3e-78    synthetic construct
gb|ABR27976.1|  ribosomal protein L11                                   244   3e-78    Triatoma infestans
gb|KEY71076.1|  hypothetical protein S7711_00899                        243   4e-78    Stachybotrys chartarum IBT 7711
ref|XP_008593474.1|  60S ribosomal protein L11                          243   4e-78    Beauveria bassiana ARSEF 2860
ref|XP_006862372.1|  PREDICTED: 60S ribosomal protein L11               243   4e-78    Chrysochloris asiatica
ref|XP_005955884.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    243   5e-78    Pantholops hodgsonii [Tibetan antelope]
ref|XP_006697554.1|  putative ribosomal protein                         242   5e-78    Chaetomium thermophilum var. thermophilum DSM 1495
gb|KFD51459.1|  hypothetical protein M513_07672                         243   5e-78    Trichuris suis
ref|XP_003652525.1|  60S ribosomal protein L11                          242   5e-78    Thielavia terrestris NRRL 8126
ref|NP_477054.1|  ribosomal protein L11, isoform A                      243   6e-78    Drosophila melanogaster
ref|NP_001002139.1|  60S ribosomal protein L11                          242   7e-78    Danio rerio [leopard danio]
gb|EHK50062.1|  hypothetical protein TRIATDRAFT_297405                  242   7e-78    Trichoderma atroviride IMI 206040
ref|XP_008912007.1|  60S ribosomal protein L11                          242   7e-78    Phytophthora parasitica INRA-310
gb|KHJ43623.1|  ribosomal protein L5                                    242   8e-78    Trichuris suis
ref|NP_001016640.1|  ribosomal protein L11                              242   9e-78    Xenopus tropicalis [western clawed frog]
ref|XP_001349097.1|  60S ribosomal protein L11a, putative               242   9e-78    Plasmodium falciparum 3D7
ref|XP_007406729.1|  hypothetical protein MELLADRAFT_103715             242   9e-78    Melampsora larici-populina 98AG31
ref|XP_003293531.1|  ribosomal protein L11                              242   9e-78    Dictyostelium purpureum
ref|XP_007400955.1|  hypothetical protein PHACADRAFT_264100             242   1e-77    Phanerochaete carnosa HHB-10118-sp
ref|XP_002741821.1|  PREDICTED: 60S ribosomal protein L11-like          242   1e-77    Saccoglossus kowalevskii
gb|EPY49528.1|  60S ribosomal protein L11                               241   1e-77    Schizosaccharomyces cryophilus OY26
gb|KDR12481.1|  60S ribosomal protein L11                               242   1e-77    Zootermopsis nevadensis
gb|KIW72643.1|  60S ribosomal protein L11                               241   1e-77    Phialophora americana
gb|EPY52057.1|  60S ribosomal protein L11                               241   1e-77    Schizosaccharomyces cryophilus OY26
ref|XP_002063810.1|  GK15870                                            242   1e-77    Drosophila willistoni
gb|AAX11430.1|  cell growth-inhibiting protein 34                       241   1e-77    Homo sapiens [man]
gb|KHJ31708.1|  putative 60s ribosomal protein l11                      241   1e-77    Erysiphe necator
ref|NP_001087287.1|  ribosomal protein L11                              241   1e-77    Xenopus laevis [clawed frog]
ref|XP_002005901.1|  GI18837                                            242   1e-77    Drosophila mojavensis
gb|KIN04023.1|  hypothetical protein OIDMADRAFT_51953                   241   1e-77    Oidiodendron maius Zn
ref|XP_003227609.1|  PREDICTED: 60S ribosomal protein L11               241   1e-77    Anolis carolinensis [Carolina anole]
ref|NP_595899.1|  60S ribosomal protein L11                             241   2e-77    Schizosaccharomyces pombe
ref|XP_002364229.1|  ribosomal protein L11, putative                    241   2e-77    Toxoplasma gondii ME49
ref|XP_002049941.1|  GJ21865                                            241   2e-77    Drosophila virilis
ref|XP_005905227.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    241   2e-77    Bos mutus
ref|XP_007175169.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    241   2e-77    Balaenoptera acutorostrata scammoni
ref|XP_003833556.1|  similar to 60s ribosomal protein l11               241   2e-77    Leptosphaeria maculans JN3
ref|XP_001939101.1|  60S ribosomal protein L11                          241   2e-77    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_001892371.1|  60S ribosomal protein L11                          241   2e-77    Brugia malayi [agent of lymphatic filariasis]
ref|XP_007720703.1|  60S ribosomal protein L11                          241   2e-77    Capronia coronata CBS 617.96
gb|AAV90722.1|  60S ribosomal protein L11                               241   2e-77    Aedes albopictus [forest day mosquito]
emb|CDS05445.1|  Putative 60S ribosomal protein L11                     241   2e-77    Lichtheimia ramosa
ref|XP_003302643.1|  60S ribosomal protein L11                          241   2e-77    
ref|XP_005203175.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    241   2e-77    Bos taurus [bovine]
ref|XP_011330111.1|  PREDICTED: 60S ribosomal protein L11               241   2e-77    Ooceraea biroi
gb|EJW85444.1|  60S ribosomal protein L11                               241   2e-77    Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_004678659.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    241   2e-77    Condylura cristata
ref|XP_001794114.1|  hypothetical protein SNOG_03556                    241   2e-77    Parastagonospora nodorum SN15
emb|CDH52194.1|  60s ribosomal protein l11                              241   2e-77    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005875279.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    241   2e-77    
ref|XP_003138893.1|  60S ribosomal protein L11                          241   2e-77    
gb|EXX73498.1|  ribosomal 60S subunit protein L11B                      241   2e-77    
ref|XP_007828704.1|  60S ribosomal protein L11                          241   2e-77    
gb|ABV44749.1|  60S ribosomal protein L11-like protein                  242   2e-77    
ref|XP_006268033.1|  PREDICTED: 60S ribosomal protein L11               241   3e-77    
ref|XP_005988803.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    241   3e-77    
ref|XP_004603488.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    241   3e-77    
ref|XP_005107086.1|  PREDICTED: 60S ribosomal protein L11-like          241   3e-77    
ref|XP_002184288.1|  predicted protein                                  240   3e-77    
gb|KIJ20995.1|  hypothetical protein PAXINDRAFT_165800                  240   3e-77    
ref|XP_003884996.1|  hypothetical protein NCLIV_053950                  240   3e-77    
ref|XP_002171744.1|  60S ribosomal protein L11                          240   3e-77    
ref|NP_001001638.1|  60S ribosomal protein L11                          240   3e-77    
ref|XP_010898594.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   3e-77    
ref|XP_008722843.1|  60S ribosomal protein L11                          240   3e-77    
ref|XP_005353082.1|  PREDICTED: 60S ribosomal protein L11               240   4e-77    
gb|ACI69075.1|  60S ribosomal protein L11                               240   4e-77    
gb|KFW09507.1|  60S ribosomal protein L11                               240   4e-77    
ref|XP_005802897.1|  PREDICTED: 60S ribosomal protein L11-like          240   4e-77    
gb|AAL99919.1|AF432212_1  CLL-associated antigen KW-12                  240   4e-77    
ref|XP_006179216.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   4e-77    
gb|KFP68695.1|  60S ribosomal protein L11                               240   4e-77    
gb|ACH85327.1|  ribosomal protein L11                                   240   4e-77    
ref|XP_010362433.1|  PREDICTED: 60S ribosomal protein L11-like          240   4e-77    
ref|XP_008329249.1|  PREDICTED: 60S ribosomal protein L11               240   4e-77    
gb|AAL09706.1|AF420431_1  ribosomal protein L11                         240   4e-77    
ref|XP_006078004.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   4e-77    
ref|XP_006980890.1|  PREDICTED: 60S ribosomal protein L11               240   4e-77    
ref|NP_080195.1|  60S ribosomal protein L11                             240   4e-77    
gb|KFV54375.1|  60S ribosomal protein L11                               240   4e-77    
ref|NP_001125385.1|  60S ribosomal protein L11                          240   4e-77    
ref|XP_005941012.1|  PREDICTED: 60S ribosomal protein L11-like is...    240   4e-77    
gb|EFB27138.1|  hypothetical protein PANDA_001098                       240   4e-77    
ref|XP_006539175.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   4e-77    
ref|XP_006924507.1|  PREDICTED: 60S ribosomal protein L11               240   4e-77    
ref|XP_003968865.1|  PREDICTED: 60S ribosomal protein L11-like          240   4e-77    
gb|AGH15796.1|  Rpl11 protein                                           240   5e-77    
gb|KFO60189.1|  60S ribosomal protein L11                               240   5e-77    
ref|XP_010743989.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   5e-77    
ref|XP_008291103.1|  PREDICTED: 60S ribosomal protein L11               240   5e-77    
gb|KIK82563.1|  hypothetical protein PAXRUDRAFT_710603                  240   5e-77    
gb|ABW06869.1|  ribosomal protein L11                                   240   5e-77    
gb|EMC79466.1|  60S ribosomal protein L11                               240   5e-77    
gb|AFW65989.1|  hypothetical protein ZEAMMB73_747842                    238   5e-77    
ref|XP_009152279.1|  60S ribosomal protein L11                          240   5e-77    
ref|XP_010347552.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   5e-77    
gb|KIW01718.1|  60S ribosomal protein L11                               240   5e-77    
ref|XP_006019455.1|  PREDICTED: 60S ribosomal protein L11               240   5e-77    
gb|KFU91853.1|  60S ribosomal protein L11                               239   5e-77    
gb|ABF18126.1|  60S ribosomal protein L11                               240   5e-77    
ref|XP_008518978.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   6e-77    
ref|XP_007864974.1|  ribosomal protein L5                               239   6e-77    
ref|XP_003382768.1|  PREDICTED: 60S ribosomal protein L11-like is...    240   6e-77    
ref|XP_007083757.1|  PREDICTED: 60S ribosomal protein L11               241   6e-77    
ref|XP_001663129.1|  AAEL012944-PB                                      240   6e-77    
ref|XP_011403972.1|  PREDICTED: 60S ribosomal protein L11-like is...    240   6e-77    
ref|XP_005302146.1|  PREDICTED: 60S ribosomal protein L11               239   6e-77    
ref|XP_004425775.1|  PREDICTED: 60S ribosomal protein L11 isoform 1     240   7e-77    
ref|XP_009560105.1|  PREDICTED: 60S ribosomal protein L11               239   7e-77    
ref|XP_007753389.1|  60S ribosomal protein L11                          239   7e-77    
ref|XP_006671375.1|  60S ribosomal protein L11                          239   7e-77    
ref|XP_005955883.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    239   7e-77    
emb|CDS03126.1|  Putative 60S ribosomal protein L11                     239   7e-77    
ref|XP_001913063.1|  hypothetical protein                               239   7e-77    
ref|XP_007068087.1|  PREDICTED: 60S ribosomal protein L11               239   7e-77    
ref|XP_006446821.1|  hypothetical protein CICLE_v10016875mg             239   7e-77    
emb|CEJ90763.1|  Putative 60S ribosomal protein L11                     239   8e-77    
ref|XP_006130554.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   8e-77    
gb|KEZ44553.1|  hypothetical protein SAPIO_CDS3581                      239   8e-77    
ref|XP_003458587.1|  PREDICTED: 60S ribosomal protein L11-like          239   8e-77    
ref|XP_004074127.1|  PREDICTED: 60S ribosomal protein L11               239   8e-77    
gb|KFQ51368.1|  60S ribosomal protein L11                               239   8e-77    
gb|KIX00150.1|  60S ribosomal protein L11                               239   8e-77    
gb|KDQ61798.1|  hypothetical protein JAAARDRAFT_150757                  239   8e-77    
ref|XP_002507327.1|  ribosomal protein L11                              239   8e-77    
gb|KFV16259.1|  60S ribosomal protein L11                               239   8e-77    
ref|XP_008421109.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    239   9e-77    
emb|CAL00699.1|  unnamed protein product                                239   9e-77    
ref|XP_005617268.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   9e-77    
emb|CDH51840.1|  60s ribosomal protein l11                              239   9e-77    
gb|KFV77896.1|  60S ribosomal protein L11                               239   9e-77    
ref|XP_001401580.2|  60S ribosomal protein L11                          239   9e-77    
ref|XP_007702064.1|  hypothetical protein COCSADRAFT_28532              239   9e-77    
gb|EMF09861.1|  60S ribosomal protein L11                               239   9e-77    
ref|NP_001292117.1|  60S ribosomal protein L11                          239   9e-77    
ref|XP_001553621.1|  60S ribosomal protein L11                          239   9e-77    
gb|KFO04838.1|  60S ribosomal protein L11                               239   9e-77    
ref|XP_004783520.1|  PREDICTED: 60S ribosomal protein L11               239   9e-77    
gb|KFO76848.1|  60S ribosomal protein L11                               239   9e-77    
ref|XP_006882367.1|  PREDICTED: 60S ribosomal protein L11-like          239   1e-76    
gb|EPS69669.1|  hypothetical protein M569_05096                         238   1e-76    
ref|XP_006737644.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    240   1e-76    
ref|XP_004893894.1|  PREDICTED: 60S ribosomal protein L11 isoform X3    239   1e-76    
ref|XP_003628238.1|  60S ribosomal protein L11                          237   1e-76    
gb|KFM05522.1|  60S ribosomal protein L11                               239   1e-76    
ref|XP_004893893.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    239   1e-76    
ref|XP_007245775.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    239   1e-76    
ref|XP_007688169.1|  hypothetical protein COCMIDRAFT_5484               239   1e-76    
ref|XP_007854285.1|  60s ribosomal protein l11                          239   1e-76    
gb|KIW96569.1|  60S ribosomal protein L11                               239   1e-76    
gb|EFX82862.1|  hypothetical protein DAPPUDRAFT_302274                  239   1e-76    
ref|XP_007750616.1|  60S ribosomal protein L11                          239   1e-76    
gb|AFM86389.1|  ribosomal protein L11                                   239   1e-76    
gb|KFZ56809.1|  60S ribosomal protein L11                               239   1e-76    
ref|XP_003659072.1|  hypothetical protein MYCTH_2075489                 239   1e-76    
gb|EDL11957.1|  mCG11809                                                239   1e-76    
emb|CDW52299.1|  60S ribosomal protein L11                              239   1e-76    
ref|XP_008692837.1|  PREDICTED: 60S ribosomal protein L11               239   1e-76    
gb|ESA11406.1|  hypothetical protein GLOINDRAFT_190897                  238   1e-76    
ref|XP_001863416.1|  ribosomal protein L11                              239   1e-76    
ref|XP_007430577.1|  PREDICTED: 60S ribosomal protein L11               239   1e-76    
ref|XP_001512081.1|  PREDICTED: 60S ribosomal protein L11               239   1e-76    
ref|XP_003764935.1|  PREDICTED: 60S ribosomal protein L11               239   1e-76    
gb|AFK10889.1|  ribosomal protein L11                                   239   1e-76    
gb|KIX93314.1|  60S ribosomal protein L11                               239   2e-76    
ref|XP_002173490.1|  60S ribosomal protein L11                          238   2e-76    
ref|XP_008031258.1|  hypothetical protein SETTUDRAFT_35885              238   2e-76    
ref|XP_765879.1|  60S ribosomal protein L11a                            238   2e-76    
emb|CEG66561.1|  Putative 60S ribosomal protein L11                     239   2e-76    
ref|XP_007290432.1|  60S ribosomal protein L11                          238   2e-76    
ref|XP_954382.1|  60S ribosomal protein l11a                            238   2e-76    
ref|XP_004517673.1|  PREDICTED: 60S ribosomal protein L11-like          239   2e-76    
emb|CAH57695.1|  60S ribosomal protein L11                              238   2e-76    
ref|XP_003033464.1|  60S ribosomal protein L11                          238   2e-76    
ref|XP_009689157.1|  60S ribosomal protein L11a                         238   2e-76    
gb|ABM55572.1|  putative ribosomal protein L11                          239   2e-76    
ref|XP_005187420.1|  PREDICTED: 60S ribosomal protein L11               239   2e-76    
ref|NP_001158637.1|  60S ribosomal protein L11                          238   2e-76    
ref|XP_001958882.1|  GF12342                                            239   2e-76    
ref|XP_004893892.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    239   2e-76    
gb|ADV03047.1|  ribosomal protein L11                                   238   2e-76    
ref|XP_002018508.1|  GL17744                                            239   2e-76    
emb|CDS14192.1|  Putative 60S ribosomal protein L11                     238   2e-76    
gb|EYB99416.1|  hypothetical protein Y032_0122g1039                     239   2e-76    
ref|XP_011506111.1|  PREDICTED: 60S ribosomal protein L11               239   2e-76    
ref|XP_005905226.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    238   3e-76    
ref|XP_003712966.1|  60S ribosomal protein L11                          238   3e-76    
gb|EHL03348.1|  putative 60S ribosomal protein L11                      238   3e-76    
ref|NP_001279972.1|  ribosomal protein L11                              238   3e-76    
emb|CEI93245.1|  Putative 60S ribosomal protein L11                     238   3e-76    
ref|XP_010779161.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    238   3e-76    
gb|AAN73370.1|  ribosomal protein L11                                   238   3e-76    
ref|XP_007736757.1|  60S ribosomal protein L11                          238   3e-76    
ref|XP_500914.2|  60S ribosomal protein L11                             238   3e-76    
emb|CCJ29398.1|  unnamed protein product                                238   3e-76    
ref|XP_008868808.1|  60S ribosomal protein L11                          238   3e-76    
ref|XP_004357945.1|  S60 ribosomal protein L11                          238   3e-76    
gb|ELR49451.1|  60S ribosomal protein L11                               238   3e-76    
ref|XP_011251155.1|  PREDICTED: 60S ribosomal protein L11               239   3e-76    
gb|KFP31127.1|  60S ribosomal protein L11                               238   3e-76    
gb|KEQ63433.1|  ribosomal protein L5                                    238   3e-76    
ref|XP_006882778.1|  PREDICTED: 60S ribosomal protein L11-like          238   4e-76    
ref|XP_009840198.1|  60S ribosomal protein L11                          238   4e-76    
ref|XP_004572770.1|  PREDICTED: 60S ribosomal protein L11-like is...    238   4e-76    
ref|NP_001187040.1|  60S ribosomal protein L11                          238   4e-76    
gb|ACN26136.1|  unknown                                                 237   4e-76    
ref|XP_003320143.2|  60S ribosomal protein L11                          238   4e-76    
gb|ABR23487.1|  60S ribosomal protein L11                               238   4e-76    
ref|XP_009549021.1|  hypothetical protein HETIRDRAFT_477978             238   4e-76    
dbj|BAN20276.1|  ribosomal protein L11                                  239   4e-76    
ref|XP_008083348.1|  Ribosomal protein L5                               238   4e-76    
gb|ACI12869.1|  60S ribosomal protein L11                               238   4e-76    
ref|XP_003702353.1|  PREDICTED: 60S ribosomal protein L11-like          238   4e-76    
gb|EPQ65884.1|  Protein component of the large (60S) ribosomal su...    238   4e-76    
ref|XP_001586298.1|  60S ribosomal protein L11                          238   4e-76    
ref|XP_003697123.1|  PREDICTED: 60S ribosomal protein L11-like          238   4e-76    
gb|AAO31779.1|  ribosomal protein L11                                   238   5e-76    
ref|XP_007917396.1|  putative 60s ribosomal protein l11 protein         237   5e-76    
ref|XP_004829904.1|  60S ribosomal protein L11, putative                237   5e-76    
ref|XP_011065690.1|  PREDICTED: 60S ribosomal protein L11               238   5e-76    
ref|XP_008718904.1|  60S ribosomal protein L11                          237   5e-76    
ref|XP_007593026.1|  ribosomal L5P family protein                       237   5e-76    
gb|ACO57590.1|  60S ribosomal protein L11                               237   5e-76    
emb|CDR95780.1|  60S ribosomal protein L11, putative                    237   5e-76    
ref|XP_010779152.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    238   5e-76    
ref|XP_009039589.1|  hypothetical protein AURANDRAFT_38382              237   5e-76    
ref|XP_003393637.1|  PREDICTED: 60S ribosomal protein L11-like          238   5e-76    
dbj|BAB29059.1|  unnamed protein product                                237   5e-76    
gb|ADO28174.1|  60S ribosomal protein l11                               237   5e-76    
ref|XP_011140348.1|  PREDICTED: 60S ribosomal protein L11 isoform X3    238   5e-76    
gb|KIM90306.1|  hypothetical protein PILCRDRAFT_812047                  237   5e-76    
ref|XP_004572769.1|  PREDICTED: 60S ribosomal protein L11-like is...    239   6e-76    
gb|AFM88490.1|  ribosomal protein L11                                   237   6e-76    
gb|ABW90392.1|  putative ribosomal protein L11                          237   6e-76    
gb|AGH70158.1|  60S ribosomal protein L11                               237   6e-76    
ref|XP_011140346.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    238   6e-76    
gb|EKG14783.1|  Ribosomal protein L5                                    237   6e-76    
gb|EGI69931.1|  60S ribosomal protein L11                               238   6e-76    
gb|KIW42380.1|  60S ribosomal protein L11                               237   6e-76    
emb|CEG73597.1|  Putative 60S ribosomal protein L11                     237   6e-76    
ref|XP_011140347.1|  PREDICTED: 60S ribosomal protein L11 isoform X2    238   7e-76    
gb|KIV78464.1|  60S ribosomal protein L11                               237   7e-76    
ref|XP_001610475.1|  60S ribosomal protein L11                          237   7e-76    
ref|XP_010955668.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    241   7e-76    
ref|XP_662079.1|  hypothetical protein AN4475.2                         237   7e-76    
ref|XP_007780322.1|  60S ribosomal protein L11                          237   7e-76    
ref|XP_010387110.1|  PREDICTED: 60S ribosomal protein L11-like          237   7e-76    
ref|XP_005349545.1|  PREDICTED: 60S ribosomal protein L11-like          237   8e-76    
ref|XP_003054830.1|  predicted protein                                  237   8e-76    
dbj|GAA95328.1|  hypothetical protein E5Q_01985                         237   9e-76    
gb|KIW50748.1|  60S ribosomal protein L11                               237   9e-76    
gb|ADV17698.1|  60S ribosomal protein L11                               237   9e-76    
ref|XP_002485190.1|  60S ribosomal protein L11                          236   9e-76    
gb|KIH42491.1|  ribosomal protein L5                                    236   9e-76    
emb|CEI94092.1|  Putative 60S ribosomal protein L11                     237   9e-76    
ref|XP_008614451.1|  60S ribosomal protein L11                          236   1e-75    
ref|XP_006056934.1|  PREDICTED: 60S ribosomal protein L11-like          236   1e-75    
ref|XP_004227163.1|  PREDICTED: 60S ribosomal protein L11-like          236   1e-75    
emb|CEJ04024.1|  Putative 60S ribosomal protein L11                     236   1e-75    
ref|XP_004347799.1|  60S ribosomal protein L11                          237   1e-75    
ref|XP_309477.3|  AGAP011173-PA                                         237   1e-75    
gb|ELU08984.1|  hypothetical protein CAPTEDRAFT_228073                  237   1e-75    
gb|KIP07125.1|  hypothetical protein PHLGIDRAFT_89957                   236   1e-75    
gb|KIJ65511.1|  hypothetical protein HYDPIDRAFT_174943                  237   1e-75    
ref|XP_008547261.1|  PREDICTED: 60S ribosomal protein L11               237   1e-75    
ref|XP_011306148.1|  PREDICTED: 60S ribosomal protein L11 isoform X1    237   1e-75    
ref|XP_003850717.1|  60S ribosomal protein L11                          236   1e-75    
gb|ACD65164.1|  putative 60S ribosomal protein RPL11                    236   1e-75    
ref|XP_011347628.1|  PREDICTED: 60S ribosomal protein L11-like          237   1e-75    
gb|ADV03013.1|  ribosomal protein L11                                   236   1e-75    
gb|KIW30639.1|  60S ribosomal protein L11                               236   1e-75    



>ref|XP_009138940.1| PREDICTED: 60S ribosomal protein L11-1-like [Brassica rapa]
 emb|CDX88999.1| BnaA04g01870D [Brassica napus]
Length=217

 Score =   314 bits (804),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 176/194 (91%), Gaps = 8/194 (4%)
 Frame = +2

Query  5    YQFTSRFPSLPAVSPSPR-------QPKA-MASEKKLNNPMREIKVQKLVLNISVGESGD  160
            Y F  RF +L   S   R       QP++ MASEKKL+NPMR+IKVQKLVLNISVGESGD
Sbjct  6    YIFCCRFFALSFASSFNRSSAGVFSQPESQMASEKKLSNPMRDIKVQKLVLNISVGESGD  65

Query  161  RLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKE  340
            RLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKE
Sbjct  66   RLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKE  125

Query  341  YELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarv  520
            YELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARV
Sbjct  126  YELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARV  185

Query  521  GIQHRVTKDDAMKW  562
            GIQHRVTKDDAMKW
Sbjct  186  GIQHRVTKDDAMKW  199



>ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arietinum]
 ref|XP_004510433.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
 ref|XP_004511177.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
 emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum]
Length=181

 Score =   310 bits (795),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/164 (99%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus communis]
 gb|EEF52578.1| 60S ribosomal protein L11, putative [Ricinus communis]
Length=182

 Score =   310 bits (795),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>emb|CDX71934.1| BnaC08g29400D [Brassica napus]
Length=255

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +2

Query  11   FTSRFPSLPAVSPSPRQPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLE  190
            F S FP    V   P     MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLE
Sbjct  56   FDSSFPFPAGVFSQPESQ--MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLE  113

Query  191  QLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSD  370
            QLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSD
Sbjct  114  QLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSD  173

Query  371  TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDD  550
            TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDD
Sbjct  174  TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDD  233

Query  551  AMKW  562
            AMKW
Sbjct  234  AMKW  237



>gb|KDP21119.1| hypothetical protein JCGZ_21590 [Jatropha curcas]
Length=182

 Score =   309 bits (792),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK++VGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSKVGIQHRVTKEDAMKW  164



>ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum]
Length=181

 Score =   309 bits (792),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus communis]
 gb|EEF40092.1| 60S ribosomal protein L11, putative [Ricinus communis]
Length=182

 Score =   309 bits (791),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; AltName: Full=L5 [Medicago 
sativa]
 emb|CAA55090.1| RL5 ribosomal protein [Medicago sativa]
Length=181

 Score =   309 bits (791),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_007215050.1| hypothetical protein PRUPE_ppa012119mg [Prunus persica]
 ref|XP_008228942.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Prunus mume]
 gb|EMJ16249.1| hypothetical protein PRUPE_ppa012119mg [Prunus persica]
Length=183

 Score =   309 bits (791),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>ref|XP_006850965.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda]
 gb|ERN12546.1| hypothetical protein AMTR_s00025p00203150 [Amborella trichopoda]
Length=183

 Score =   309 bits (791),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>ref|XP_010246451.1| PREDICTED: 60S ribosomal protein L11-like [Nelumbo nucifera]
Length=183

 Score =   309 bits (791),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_010274422.1| PREDICTED: 60S ribosomal protein L11 [Nelumbo nucifera]
Length=182

 Score =   308 bits (790),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_009628928.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana tomentosiformis]
 ref|XP_009796075.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana sylvestris]
Length=181

 Score =   308 bits (790),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/164 (98%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_008381196.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Malus domestica]
Length=183

 Score =   308 bits (790),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>ref|XP_009132192.1| PREDICTED: 60S ribosomal protein L11-2 isoform X2 [Brassica rapa]
 ref|XP_009136955.1| PREDICTED: 60S ribosomal protein L11-2 isoform X2 [Brassica rapa]
 ref|XP_009101572.1| PREDICTED: 60S ribosomal protein L11-2 [Brassica rapa]
Length=182

 Score =   308 bits (790),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKW  164



>ref|XP_006398262.1| hypothetical protein EUTSA_v10001041mg [Eutrema salsugineum]
 ref|XP_006402758.1| hypothetical protein EUTSA_v10006260mg [Eutrema salsugineum]
 ref|XP_006414066.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 ref|XP_006414067.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 ref|XP_009128823.1| PREDICTED: 60S ribosomal protein L11-1 [Brassica rapa]
 gb|ESQ39715.1| hypothetical protein EUTSA_v10001041mg [Eutrema salsugineum]
 gb|ESQ44211.1| hypothetical protein EUTSA_v10006260mg [Eutrema salsugineum]
 gb|ESQ55519.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 gb|ESQ55520.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
Length=182

 Score =   308 bits (790),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/164 (98%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>gb|AFK48866.1| unknown [Lotus japonicus]
Length=181

 Score =   308 bits (790),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>ref|XP_009383242.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   308 bits (789),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_009404521.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   308 bits (789),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLER GYRVARRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFFVVLERAGYRVARRRRCKSRVGIQHRVTKDDAMKW  164



>ref|XP_009378940.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pyrus x bretschneideri]
Length=182

 Score =   308 bits (789),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycine max]
 ref|XP_003527577.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 ref|XP_006582268.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 ref|XP_006598073.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
 gb|ACU13960.1| unknown [Glycine max]
 gb|ACU24606.1| unknown [Glycine max]
 gb|KHN27795.1| 60S ribosomal protein L11 [Glycine soja]
Length=181

 Score =   308 bits (788),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>emb|CDY49245.1| BnaA09g55240D [Brassica napus]
Length=259

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = +2

Query  2    LYQFTSRFPSLPAVSPSPRQPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAK  181
            L  F S FP    V   P     MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+K
Sbjct  57   LSLFDSSFPFPAGVLSQPES--QMASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASK  114

Query  182  VLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRN  361
            VLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRN
Sbjct  115  VLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRN  174

Query  362  FSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVT  541
            FSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVT
Sbjct  175  FSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVT  234

Query  542  KDDAMKW  562
            KDDAMKW
Sbjct  235  KDDAMKW  241



>gb|EYU21905.1| hypothetical protein MIMGU_mgv1a014651mg [Erythranthe guttata]
Length=182

 Score =   308 bits (788),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA+EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>gb|EYU29260.1| hypothetical protein MIMGU_mgv1a014673mg [Erythranthe guttata]
 gb|EYU41114.1| hypothetical protein MIMGU_mgv1a014638mg [Erythranthe guttata]
Length=182

 Score =   308 bits (788),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKW  164



>emb|CDY26360.1| BnaA02g24100D [Brassica napus]
Length=227

 Score =   309 bits (792),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/164 (98%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  46   MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  105

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  106  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  165

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  166  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  209



>ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
Length=181

 Score =   307 bits (787),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_011082984.1| PREDICTED: 60S ribosomal protein L11 [Sesamum indicum]
Length=183

 Score =   307 bits (787),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>ref|XP_006446820.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
 ref|XP_006468988.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis]
 gb|ESR60060.1| hypothetical protein CICLE_v10016875mg [Citrus clementina]
 gb|KDO63410.1| hypothetical protein CISIN_1g030128mg [Citrus sinensis]
Length=182

 Score =   307 bits (787),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_010525185.1| PREDICTED: 60S ribosomal protein L11-1 [Tarenaya hassleriana]
Length=182

 Score =   307 bits (787),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_009629723.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum]
Length=181

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_010915478.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
 ref|XP_010925608.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
Length=182

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK++NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKMSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_004293968.1| PREDICTED: 60S ribosomal protein L11 [Fragaria vesca subsp. vesca]
Length=181

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_006843688.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda]
 gb|ERN05363.1| hypothetical protein AMTR_s00007p00200160 [Amborella trichopoda]
Length=183

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_008225318.1| PREDICTED: 60S ribosomal protein L11 [Prunus mume]
Length=182

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|NP_191429.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 ref|NP_567563.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 ref|NP_568649.2| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 sp|P42794.2|RL112_ARATH RecName: Full=60S ribosomal protein L11-2; AltName: Full=L16 
[Arabidopsis thaliana]
 gb|AAG41458.1|AF326876_1 putative ribosomal protein L11 [Arabidopsis thaliana]
 gb|AAK00379.1|AF339697_1 putative ribosomal protein L11 [Arabidopsis thaliana]
 gb|AAK60313.1|AF385722_1 AT4g18730/F28A21_140 [Arabidopsis thaliana]
 emb|CAB88287.1| ribosomal protein L11-like [Arabidopsis thaliana]
 dbj|BAB09220.1| ribosomal protein L11-like [Arabidopsis thaliana]
 gb|AAK62625.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AAL77722.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AAM62465.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AAM64372.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AAM91073.1| AT4g18730/F28A21_140 [Arabidopsis thaliana]
 gb|AED95297.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AEE79819.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AEE84082.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
Length=182

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKW  164



>gb|AFK35020.1| unknown [Lotus japonicus]
Length=181

 Score =   306 bits (785),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>ref|XP_008228941.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Prunus mume]
Length=184

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  123  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  165



>ref|XP_010529208.1| PREDICTED: 60S ribosomal protein L11-1-like [Tarenaya hassleriana]
 ref|XP_010538573.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010518817.1| PREDICTED: 60S ribosomal protein L11-1-like [Tarenaya hassleriana]
Length=182

 Score =   306 bits (785),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKEDAMKW  164



>ref|XP_009365286.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pyrus x bretschneideri]
Length=183

 Score =   306 bits (785),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA E KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  164



>ref|NP_850376.2| 60S ribosomal protein L16A [Arabidopsis thaliana]
 ref|XP_002863455.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002870025.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006281176.1| hypothetical protein CARUB_v10027211mg [Capsella rubella]
 ref|XP_006291911.1| hypothetical protein CARUB_v10018095mg [Capsella rubella]
 ref|XP_010504827.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010439816.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 ref|XP_010441671.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010449473.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 ref|XP_010481534.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010494724.1| PREDICTED: 60S ribosomal protein L11-1 [Camelina sativa]
 ref|XP_010496881.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Camelina sativa]
 sp|P42795.2|RL111_ARATH RecName: Full=60S ribosomal protein L11-1; AltName: Full=L16A 
[Arabidopsis thaliana]
 dbj|BAF00458.1| 60S ribosomal protein L11B [Arabidopsis thaliana]
 gb|EFH39714.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46284.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|AEC10163.1| 60S ribosomal protein L11-1/L16A [Arabidopsis thaliana]
 gb|EOA14074.1| hypothetical protein CARUB_v10027211mg [Capsella rubella]
 gb|EOA24809.1| hypothetical protein CARUB_v10018095mg [Capsella rubella]
Length=182

 Score =   306 bits (785),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>gb|KHN42782.1| 60S ribosomal protein L11 [Glycine soja]
Length=181

 Score =   306 bits (785),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_008786958.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=181

 Score =   306 bits (785),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK++NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKMSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+ VGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSGVGIQHRVTKEDAMKW  164



>ref|XP_003628237.1| 60S ribosomal protein L11 [Medicago truncatula]
 gb|AET02713.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK39602.1| unknown [Medicago truncatula]
Length=181

 Score =   306 bits (785),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDD+MKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDSMKW  164



>ref|XP_007132813.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris]
 gb|ESW04807.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris]
Length=181

 Score =   306 bits (785),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKW  164



>ref|XP_009408897.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   306 bits (785),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRV+RRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFYVVLERAGYRVSRRRRCKSRVGIQHRVTKEDSMKW  164



>gb|ABK22492.1| unknown [Picea sitchensis]
 gb|ABK26358.1| unknown [Picea sitchensis]
Length=180

 Score =   306 bits (785),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA+EKKLNNPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLNNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KA+QLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKALQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYR+ RR+R ++RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRIGRRKRAQSRVGIQHRVTKDDAMKW  164



>ref|XP_010936718.1| PREDICTED: 60S ribosomal protein L11 [Elaeis guineensis]
Length=182

 Score =   306 bits (785),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>gb|AFK37822.1| unknown [Medicago truncatula]
Length=181

 Score =   306 bits (785),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDD+MKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDSMKW  164



>ref|XP_009405599.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=182

 Score =   306 bits (785),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_009403504.1| PREDICTED: 60S ribosomal protein L11 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   306 bits (784),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLER GYRV+RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_006414065.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
 gb|ESQ55518.1| hypothetical protein EUTSA_v10026344mg [Eutrema salsugineum]
Length=183

 Score =   306 bits (784),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  165



>ref|XP_009132184.1| PREDICTED: 60S ribosomal protein L11-2 isoform X1 [Brassica rapa]
 ref|XP_009136954.1| PREDICTED: 60S ribosomal protein L11-2 isoform X1 [Brassica rapa]
 emb|CDY64920.1| BnaC07g50200D [Brassica napus]
Length=183

 Score =   306 bits (784),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKW  165



>emb|CDX99436.1| BnaC01g11160D [Brassica napus]
Length=184

 Score =   306 bits (784),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  63

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKW
Sbjct  124  TGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKW  166



>ref|XP_004134655.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis sativus]
 ref|XP_004163354.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis sativus]
 ref|XP_008439725.1| PREDICTED: 60S ribosomal protein L11-1-like [Cucumis melo]
 gb|KGN49316.1| hypothetical protein Csa_6G519680 [Cucumis sativus]
Length=181

 Score =   306 bits (784),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+ VGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSTVGIQHRVTKEDAMKW  164



>ref|XP_008381195.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Malus domestica]
Length=184

 Score =   306 bits (784),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  165



>ref|XP_008343092.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Malus domestica]
Length=182

 Score =   306 bits (784),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI+HRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIRHRVTKDDAMKW  164



>gb|AFP44117.1| 60S ribosomal protein [Lycoris longituba]
Length=182

 Score =   306 bits (784),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_009378939.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   306 bits (784),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  165



>emb|CDX87764.1| BnaC02g31850D [Brassica napus]
Length=228

 Score =   308 bits (788),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  47   MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  106

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  107  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  166

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  167  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  210



>ref|XP_011081868.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum]
Length=183

 Score =   306 bits (783),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_006449533.1| hypothetical protein CICLE_v10016873mg [Citrus clementina]
 ref|XP_006467622.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis]
 gb|ESR62773.1| hypothetical protein CICLE_v10016873mg [Citrus clementina]
 gb|KDO77895.1| hypothetical protein CISIN_1g029665mg [Citrus sinensis]
Length=182

 Score =   306 bits (783),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MAS+KKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycine max]
 gb|ACU13823.1| unknown [Glycine max]
Length=181

 Score =   306 bits (783),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>gb|KHG23956.1| 60S ribosomal L11-2 -like protein [Gossypium arboreum]
Length=182

 Score =   305 bits (782),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRV RRRRCK+ VGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSSVGIQHRVTKEDAMKW  164



>ref|XP_002309361.1| 60S ribosomal protein L11 [Populus trichocarpa]
 ref|XP_002309362.1| 60S ribosomal protein L11-2 [Populus trichocarpa]
 ref|XP_002317400.1| ribosomal protein RL5 [Populus trichocarpa]
 ref|XP_002317401.1| ribosomal protein RL5 [Populus trichocarpa]
 gb|ABK93699.1| unknown [Populus trichocarpa]
 gb|EEE92884.1| 60S ribosomal protein L11 [Populus trichocarpa]
 gb|EEE92885.1| 60S ribosomal protein L11-2 [Populus trichocarpa]
 gb|EEE98012.1| ribosomal protein RL5 [Populus trichocarpa]
 gb|EEE98013.1| ribosomal protein RL5 [Populus trichocarpa]
Length=180

 Score =   305 bits (782),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKW  164



>ref|XP_009790976.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana sylvestris]
Length=181

 Score =   305 bits (782),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_007148755.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris]
 gb|ESW20749.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris]
Length=181

 Score =   305 bits (782),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA+EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKW  164



>emb|CAA57395.1| ribosomal protein L16 [Arabidopsis thaliana]
Length=182

 Score =   305 bits (782),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI+YDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIRYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_009626014.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 ref|XP_009593767.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
 ref|XP_009799522.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana sylvestris]
 ref|XP_009766474.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana sylvestris]
Length=181

 Score =   305 bits (782),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_010052848.1| PREDICTED: 60S ribosomal protein L11-1 [Eucalyptus grandis]
 gb|KCW89658.1| hypothetical protein EUGRSUZ_A01929 [Eucalyptus grandis]
Length=182

 Score =   305 bits (782),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFY+VLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYIVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_003598139.1| 60S ribosomal protein L11 [Medicago truncatula]
 gb|AES68390.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK34937.1| unknown [Medicago truncatula]
Length=182

 Score =   305 bits (782),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +2

Query  77   SEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  256
            SEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR
Sbjct  4    SEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR  63

Query  257  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  436
            RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST
Sbjct  64   RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST  123

Query  437  GIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            GIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDDAMKW
Sbjct  124  GIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKW  165



>gb|AFK38385.1| unknown [Lotus japonicus]
Length=181

 Score =   305 bits (782),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVT+DDAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTEDDAMKW  164



>gb|EYU41113.1| hypothetical protein MIMGU_mgv1a014638mg [Erythranthe guttata]
Length=183

 Score =   305 bits (782),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKW
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKW  165



>ref|XP_011033383.1| PREDICTED: 60S ribosomal protein L11-like [Populus euphratica]
 ref|XP_011015073.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Populus 
euphratica]
 ref|XP_011015074.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Populus 
euphratica]
Length=182

 Score =   305 bits (782),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKW  164



>ref|XP_011039398.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
 ref|XP_011039399.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
 ref|XP_011039400.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica]
Length=182

 Score =   305 bits (781),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKW  164



>emb|CAA57394.1| ribosomal protein L16 [Arabidopsis thaliana]
Length=182

 Score =   305 bits (781),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGM+FYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMEFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKW  164



>gb|KFK28544.1| hypothetical protein AALP_AA7G010400 [Arabis alpina]
 gb|KFK31523.1| hypothetical protein AALP_AA6G123700 [Arabis alpina]
Length=182

 Score =   305 bits (781),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLR+NFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRKNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>gb|KJB57391.1| hypothetical protein B456_009G161300 [Gossypium raimondii]
 gb|KJB66842.1| hypothetical protein B456_010G160100 [Gossypium raimondii]
 gb|KJB66843.1| hypothetical protein B456_010G160100 [Gossypium raimondii]
 gb|KJB68369.1| hypothetical protein B456_010G241400 [Gossypium raimondii]
 gb|KJB69699.1| hypothetical protein B456_011G038200 [Gossypium raimondii]
Length=182

 Score =   305 bits (781),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_002880003.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56262.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   305 bits (781),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
             RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   TRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_011088013.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum]
Length=183

 Score =   305 bits (781),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKW  164



>ref|XP_008345917.1| PREDICTED: 60S ribosomal protein L11 [Malus domestica]
Length=182

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASE KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKEDAMKW  164



>ref|XP_009116550.1| PREDICTED: 60S ribosomal protein L11-1 [Brassica rapa]
Length=182

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHI LGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIYLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_010052835.1| PREDICTED: 60S ribosomal protein L11-1-like [Eucalyptus grandis]
Length=182

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA+EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_010427776.1| PREDICTED: 60S ribosomal protein L11-1-like [Camelina sativa]
Length=182

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLE GLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLEGGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_002281886.1| PREDICTED: 60S ribosomal protein L11 [Vitis vinifera]
Length=183

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTKDD+MKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKDDSMKW  164



>ref|XP_006285819.1| hypothetical protein CARUB_v10007309mg [Capsella rubella]
 ref|XP_010439815.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 ref|XP_010449472.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 ref|XP_010496880.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Camelina sativa]
 gb|EOA18717.1| hypothetical protein CARUB_v10007309mg [Capsella rubella]
Length=183

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  165



>gb|KHN01495.1| 60S ribosomal protein L11 [Glycine soja]
Length=224

 Score =   306 bits (784),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  45   ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  104

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  105  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  164

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  165  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  207



>ref|XP_009351472.1| PREDICTED: 60S ribosomal protein L11 [Pyrus x bretschneideri]
Length=182

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASE KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASESKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_002876475.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52734.1| 60S ribosomal protein L11 [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSK RYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKGRYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>ref|NP_001132260.1| hypothetical protein [Zea mays]
 gb|ACF81036.1| unknown [Zea mays]
 gb|AFW65988.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=182

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDSMKW  164



>gb|ACJ86159.1| unknown [Medicago truncatula]
Length=181

 Score =   304 bits (779),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRN SDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNLSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDD+MKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDSMKW  164



>ref|XP_008443441.1| PREDICTED: 60S ribosomal protein L11-1 [Cucumis melo]
 gb|KGN65615.1| hypothetical protein Csa_1G470310 [Cucumis sativus]
Length=182

 Score =   305 bits (780),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+ VGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSSVGIQHRVTKEDAMKW  164



>ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobroma cacao]
 gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma cacao]
Length=257

 Score =   307 bits (787),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = +2

Query  68   AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  247
            AMASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF
Sbjct  75   AMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSF  134

Query  248  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  427
            GIRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD
Sbjct  135  GIRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  194

Query  428  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            PSTGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  195  PSTGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKW  239



>ref|XP_003607648.1| 60S ribosomal protein L11-1 [Medicago truncatula]
 gb|ACJ86168.1| unknown [Medicago truncatula]
 gb|AES89845.1| 50S ribosomal protein L5P [Medicago truncatula]
 gb|AFK48476.1| unknown [Medicago truncatula]
Length=181

 Score =   304 bits (779),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MAS+KKL NPMR++KVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASDKKLANPMRDMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKW  164



>ref|XP_010538572.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X1 [Tarenaya 
hassleriana]
Length=183

 Score =   305 bits (780),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 163/163 (100%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTK+DAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKEDAMKW  165



>gb|KHN27796.1| 60S ribosomal protein L11, partial [Glycine soja]
Length=182

 Score =   304 bits (779),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  123  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  165



>ref|XP_009365285.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Pyrus x bretschneideri]
Length=184

 Score =   305 bits (780),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            A E KL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEENKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMKW  165



>pir||T04865 ribosomal protein L11, cytosolic - Arabidopsis thaliana
 emb|CAA57396.1| ribosomal protein L16 [Arabidopsis thaliana]
 emb|CAB37458.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 emb|CAB78875.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
Length=184

 Score =   304 bits (779),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  4    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  63

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  64   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  123

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRVARRRRCK RVGIQHRVTKDDAMKW
Sbjct  124  TGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKW  166



>ref|XP_010538574.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X3 [Tarenaya 
hassleriana]
Length=183

 Score =   304 bits (779),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    ASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRVARRRR KARVGIQHRVTK+DAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRGKARVGIQHRVTKEDAMKW  165



>ref|XP_008362518.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Malus domestica]
Length=182

 Score =   304 bits (779),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFY VLERPGYRV RRRRCK+RVGI+HRVTKDDAMKW
Sbjct  121  STGIYGMDFYXVLERPGYRVGRRRRCKSRVGIRHRVTKDDAMKW  164



>ref|XP_009405598.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   304 bits (779),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  5    ASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  64

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  65   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  124

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDF+VVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  125  TGIYGMDFFVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  167



>ref|XP_008343091.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Malus domestica]
Length=183

 Score =   304 bits (779),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRV RRRRCK+RVGI+HRVTKDDAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVGRRRRCKSRVGIRHRVTKDDAMKW  165



>ref|XP_010052179.1| PREDICTED: 60S ribosomal protein L11-1 [Eucalyptus grandis]
 gb|KCW76098.1| hypothetical protein EUGRSUZ_D00478 [Eucalyptus grandis]
Length=182

 Score =   304 bits (778),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI+HRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIRHRVTKEDAMKW  164



>gb|AAR83867.1| ribosomal protein L11-like protein [Capsicum annuum]
Length=181

 Score =   304 bits (778),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASE KLNNPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASENKLNNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>gb|KHG08920.1| 60S ribosomal L11-1 -like protein [Gossypium arboreum]
 gb|KJB34907.1| hypothetical protein B456_006G089700 [Gossypium raimondii]
Length=182

 Score =   304 bits (778),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDSMKW  164



>ref|XP_007048733.1| Ribosomal L5P family protein isoform 1 [Theobroma cacao]
 gb|EOX92890.1| Ribosomal L5P family protein isoform 1 [Theobroma cacao]
Length=182

 Score =   304 bits (778),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASE+KL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEQKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_010689742.1| PREDICTED: 60S ribosomal protein L11-1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=182

 Score =   304 bits (778),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA EKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFG
Sbjct  1    MAPEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>ref|NP_001149684.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACF85974.1| unknown [Zea mays]
 gb|ACG36357.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACR34870.1| unknown [Zea mays]
 gb|AFW71163.1| 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   303 bits (776),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA EKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAHEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDSMKW  164



>ref|XP_008782472.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Phoenix dactylifera]
Length=180

 Score =   303 bits (775),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRGIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>gb|KDO77896.1| hypothetical protein CISIN_1g029665mg [Citrus sinensis]
Length=190

 Score =   303 bits (776),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            AS+KKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  10   ASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  69

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  70   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  129

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  130  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  172



>ref|XP_002451841.1| hypothetical protein SORBIDRAFT_04g008530 [Sorghum bicolor]
 ref|XP_002451842.1| hypothetical protein SORBIDRAFT_04g008540 [Sorghum bicolor]
 gb|EES04817.1| hypothetical protein SORBIDRAFT_04g008530 [Sorghum bicolor]
 gb|EES04818.1| hypothetical protein SORBIDRAFT_04g008540 [Sorghum bicolor]
Length=182

 Score =   303 bits (775),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCKARVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKARVGIQHRVTKEDSMKW  164



>ref|XP_004133952.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004164745.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_008438244.1| PREDICTED: 60S ribosomal protein L11-1-like isoform X2 [Cucumis 
melo]
 gb|KGN56659.1| hypothetical protein Csa_3G127210 [Cucumis sativus]
Length=182

 Score =   303 bits (775),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  164



>ref|NP_001046386.1| Os02g0235600 [Oryza sativa Japonica Group]
 dbj|BAF08300.1| Os02g0235600 [Oryza sativa Japonica Group]
 dbj|BAH00003.1| unnamed protein product [Oryza sativa Japonica Group]
Length=182

 Score =   303 bits (775),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>gb|ABK93207.1| unknown [Populus trichocarpa]
Length=180

 Score =   303 bits (775),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/164 (96%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQL ESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLQESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGI  RVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKW  164



>ref|NP_001132427.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|ACF81262.1| unknown [Zea mays]
 gb|AFW81631.1| 60S ribosomal protein L11-1 [Zea mays]
Length=181

 Score =   303 bits (775),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_008366039.1| PREDICTED: 60S ribosomal protein L11-1 [Malus domestica]
 ref|XP_009352738.1| PREDICTED: 60S ribosomal protein L11-1 [Pyrus x bretschneideri]
Length=182

 Score =   303 bits (775),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASE K+ NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASESKMANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKEDSMKW  164



>ref|XP_004133951.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004164744.1| PREDICTED: 60S ribosomal protein L11-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_008438243.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Cucumis 
melo]
Length=184

 Score =   303 bits (775),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = +2

Query  68   AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  247
            A ASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF
Sbjct  2    AQASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSF  61

Query  248  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  427
            GIRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD
Sbjct  62   GIRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  121

Query  428  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            PSTGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  122  PSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  166



>ref|NP_001274979.1| 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_004232337.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004243273.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004248195.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_004251809.1| PREDICTED: 60S ribosomal protein L11-1 [Solanum lycopersicum]
 ref|XP_006348888.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_006350023.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 ref|XP_006357834.1| PREDICTED: 60S ribosomal protein L11-2-like [Solanum tuberosum]
 gb|ABB29943.1| ribosomal protein L11-like protein [Solanum tuberosum]
Length=181

 Score =   302 bits (774),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 164/164 (100%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKSRVGIQHRVTKEDSMKW  164



>ref|NP_001148395.1| LOC100282010 [Zea mays]
 gb|ACG31313.1| 60S ribosomal protein L11-1 [Zea mays]
 gb|AFW86972.1| 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   302 bits (774),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_004976770.1| PREDICTED: 60S ribosomal protein L11-like [Setaria italica]
Length=180

 Score =   302 bits (774),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|NP_001242757.1| uncharacterized protein LOC100778713 [Glycine max]
 gb|ACU13845.1| unknown [Glycine max]
Length=181

 Score =   302 bits (774),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHR TK+DA KW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRATKEDATKW  164



>ref|XP_008362517.1| PREDICTED: 60S ribosomal protein L11 isoform X1 [Malus domestica]
Length=183

 Score =   302 bits (774),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            A EKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  3    AEEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFY VLERPGYRV RRRRCK+RVGI+HRVTKDDAMKW
Sbjct  123  TGIYGMDFYXVLERPGYRVGRRRRCKSRVGIRHRVTKDDAMKW  165



>gb|ADE77225.1| unknown [Picea sitchensis]
Length=180

 Score =   302 bits (773),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA+EKKLNNPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MAAEKKLNNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KA+QLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKALQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RR+R ++RVGIQHRVTK+D+MKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRKRAQSRVGIQHRVTKEDSMKW  164



>ref|XP_006578416.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max]
Length=181

 Score =   302 bits (773),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIAC+VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACHVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RR RCKARV IQHRVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERPGYRVGRRCRCKARVRIQHRVTKEDAMKW  164



>ref|NP_001131414.1| uncharacterized protein LOC100192743 [Zea mays]
 gb|ACF79812.1| unknown [Zea mays]
 gb|ACG39381.1| 60S ribosomal protein L11-1 [Zea mays]
 tpg|DAA52966.1| TPA: 60S ribosomal protein L11-1 [Zea mays]
Length=182

 Score =   301 bits (772),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_010689741.1| PREDICTED: 60S ribosomal protein L11-1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score =   301 bits (772),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            A EKKL+NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFGI
Sbjct  3    APEKKLSNPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFGI  62

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  63   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  122

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  123  TGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  165



>ref|XP_006654147.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=182

 Score =   301 bits (772),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_002454974.1| hypothetical protein SORBIDRAFT_03g002420 [Sorghum bicolor]
 gb|EES00094.1| hypothetical protein SORBIDRAFT_03g002420 [Sorghum bicolor]
Length=182

 Score =   301 bits (772),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>gb|ACG31637.1| 60S ribosomal protein L11-1 [Zea mays]
Length=181

 Score =   301 bits (771),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTV+G+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVKGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>gb|AFW65990.1| hypothetical protein ZEAMMB73_747842 [Zea mays]
Length=187

 Score =   301 bits (771),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  7    ASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  66

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  67   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  126

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+D+MKW
Sbjct  127  TGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDSMKW  169



>ref|XP_007214493.1| hypothetical protein PRUPE_ppa020372mg [Prunus persica]
 gb|EMJ15692.1| hypothetical protein PRUPE_ppa020372mg [Prunus persica]
Length=276

 Score =   304 bits (779),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  96   ASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  155

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  156  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  215

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  216  TGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  258



>ref|XP_004968572.1| PREDICTED: 60S ribosomal protein L11-like [Setaria italica]
Length=181

 Score =   300 bits (769),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK  NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQANPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_010102117.1| 60S ribosomal protein L11-2 [Morus notabilis]
 gb|EXB92367.1| 60S ribosomal protein L11-2 [Morus notabilis]
Length=207

 Score =   301 bits (771),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  27   ASEKKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGI  86

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  87   RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  146

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  147  TGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKW  189



>ref|XP_006643887.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=182

 Score =   300 bits (768),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCKARVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKARVGIQHRVTKEDAMKW  164



>ref|NP_001054899.1| Os05g0207300 [Oryza sativa Japonica Group]
 ref|NP_001057834.2| Os06g0550000 [Oryza sativa Japonica Group]
 sp|Q0DK10.1|RL11_ORYSJ RecName: Full=60S ribosomal protein L11 [Oryza sativa Japonica 
Group]
 sp|A2YDY2.2|RL11_ORYSI RecName: Full=60S ribosomal protein L11 [Oryza sativa Indica 
Group]
 gb|AAU90185.1| putative 60S ribosomal protein L11 [Oryza sativa Japonica Group]
 dbj|BAF16813.1| Os05g0207300 [Oryza sativa Japonica Group]
 dbj|BAG92054.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78695.1| hypothetical protein OsI_18846 [Oryza sativa Indica Group]
 gb|EEC80790.1| hypothetical protein OsI_23322 [Oryza sativa Indica Group]
 gb|EEE62702.1| hypothetical protein OsJ_17505 [Oryza sativa Japonica Group]
 gb|EEE65858.1| hypothetical protein OsJ_21642 [Oryza sativa Japonica Group]
 dbj|BAF19748.2| Os06g0550000 [Oryza sativa Japonica Group]
Length=182

 Score =   300 bits (768),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>gb|KHG13747.1| 60S ribosomal L11-1 -like protein [Gossypium arboreum]
Length=188

 Score =   300 bits (769),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ASEKKL+NPMREIKVQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  8    ASEKKLSNPMREIKVQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  67

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS
Sbjct  68   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  127

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  128  TGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKW  170



>ref|XP_001759707.1| predicted protein [Physcomitrella patens]
 ref|XP_001778446.1| predicted protein [Physcomitrella patens]
 ref|XP_001779787.1| predicted protein [Physcomitrella patens]
 gb|EDQ55388.1| predicted protein [Physcomitrella patens]
 gb|EDQ56721.1| predicted protein [Physcomitrella patens]
 gb|EDQ75619.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   300 bits (767),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK+ N MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKMQNSMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRR K+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRAKSRVGIQHRVTKEDAMKW  164



>gb|ADY38658.1| putative 60S ribosomal protein L11 [Wolffia arrhiza]
Length=182

 Score =   300 bits (767),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNI VGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRV RRRRCKARVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVGRRRRCKARVGIQHRVTKEDAMKW  164



>ref|NP_001042339.1| Os01g0205500 [Oryza sativa Japonica Group]
 dbj|BAA92964.1| putative 60S ribosomal protein L11-1 [Oryza sativa Japonica Group]
 dbj|BAF04253.1| Os01g0205500 [Oryza sativa Japonica Group]
 gb|EAY72954.1| hypothetical protein OsI_00826 [Oryza sativa Indica Group]
 gb|EAZ10965.1| hypothetical protein OsJ_00808 [Oryza sativa Japonica Group]
 dbj|BAG90584.1| unnamed protein product [Oryza sativa Japonica Group]
Length=182

 Score =   299 bits (766),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK  NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>ref|XP_010940061.1| PREDICTED: 60S ribosomal protein L11-like [Elaeis guineensis]
Length=181

 Score =   299 bits (766),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 162/164 (99%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK+ +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKQ-SNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVG+QHRVTK+DAMKW
Sbjct  120  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGLQHRVTKEDAMKW  163



>ref|XP_008790022.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=182

 Score =   299 bits (766),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL NPMR+I VQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLLNPMRDINVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCK+RVGIQH VTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHGVTKEDAMKW  164



>ref|XP_001762314.1| predicted protein [Physcomitrella patens]
 gb|EDQ72781.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   298 bits (763),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK  N MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQQNSMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRR K+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRAKSRVGIQHRVTKEDAMKW  164



>gb|AAT08727.1| 60S ribosomal protein L11 [Hyacinthus orientalis]
Length=189

 Score =   298 bits (763),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = +2

Query  53   PRQPK-AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKAR  229
            PR P       KKL NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKAR
Sbjct  1    PRIPNPKWLQHKKLANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKAR  60

Query  230  YTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHID  409
            YTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHID
Sbjct  61   YTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHID  120

Query  410  LGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            LGIKYDPSTGIYGMDFYVVLERPGYRV RRRRCK+RVGIQHRVTKDDAM W
Sbjct  121  LGIKYDPSTGIYGMDFYVVLERPGYRVGRRRRCKSRVGIQHRVTKDDAMNW  171



>ref|XP_008795915.1| PREDICTED: 60S ribosomal protein L11-like [Phoenix dactylifera]
Length=179

 Score =   298 bits (762),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 162/164 (99%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK+ +NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKQ-SNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVG+QHRVTK+DAMKW
Sbjct  120  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGLQHRVTKEDAMKW  163



>ref|XP_001760204.1| predicted protein [Physcomitrella patens]
 gb|EDQ74960.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   297 bits (760),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK  N MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQQNLMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRR K+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRAKSRVGIQHRVTKEDAMKW  164



>ref|XP_002270266.1| PREDICTED: 60S ribosomal protein L11-1-like [Vitis vinifera]
Length=183

 Score =   297 bits (760),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASE+KL NPMR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF 
Sbjct  1    MASERKLANPMRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFA  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV RRRRCKARVG  HRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVGRRRRCKARVGPHHRVTKDDAMKW  164



>ref|XP_006648487.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=189

 Score =   297 bits (760),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            A EKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGI
Sbjct  9    ALEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI  68

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPS
Sbjct  69   RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPS  128

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  129  TGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  171



>gb|KHG21292.1| 60S ribosomal protein L11-1 [Gossypium arboreum]
Length=228

 Score =   296 bits (759),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 163/182 (90%), Gaps = 17/182 (9%)
 Frame = +2

Query  68   AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  247
            AMASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF
Sbjct  29   AMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  88

Query  248  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI---  418
            GIRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI   
Sbjct  89   GIRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGINSH  148

Query  419  --------------KYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAM  556
                          +YDPSTGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAM
Sbjct  149  LTRLSNRTRFGIINRYDPSTGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAM  208

Query  557  KW  562
            KW
Sbjct  209  KW  210



>gb|KHG21293.1| 60S ribosomal protein L11-1 [Gossypium arboreum]
Length=199

 Score =   294 bits (752),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 162/181 (90%), Gaps = 17/181 (9%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI----  418
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI    
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGINSHL  120

Query  419  -------------KYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMK  559
                         +YDPSTGIYGMDFYVVLER GYRV RRRRCK+RVGIQHRVTK+DAMK
Sbjct  121  TRLSNRTRFGIINRYDPSTGIYGMDFYVVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMK  180

Query  560  W  562
            W
Sbjct  181  W  181



>ref|XP_003565263.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
 ref|XP_003568752.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
 ref|XP_003571886.1| PREDICTED: 60S ribosomal protein L11 [Brachypodium distachyon]
Length=180

 Score =   291 bits (745),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M++EKK  NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRV+RRRRCKARVGI  RVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKW  164



>gb|EMS61347.1| 60S ribosomal protein L11 [Triticum urartu]
Length=180

 Score =   290 bits (743),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M++EKK  NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKW  164



>emb|CDY60533.1| BnaAnng16950D [Brassica napus]
 emb|CDY23103.1| BnaC09g18570D [Brassica napus]
 emb|CDY00582.1| BnaC04g23430D [Brassica napus]
 emb|CDX77611.1| BnaC07g18650D [Brassica napus]
Length=172

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/154 (99%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  VVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  154



>emb|CDY62552.1| BnaA03g58370D [Brassica napus]
 emb|CDY39447.1| BnaAnng05780D [Brassica napus]
 emb|CDX78887.1| BnaA01g09540D [Brassica napus]
Length=172

 Score =   290 bits (741),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/154 (98%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRVARRRRCK RVGIQHRVTKDDAMKW
Sbjct  121  VVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKW  154



>gb|KHN20558.1| Endoglucanase 9 [Glycine soja]
Length=677

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/164 (97%), Positives = 163/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  497  MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  556

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  557  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  616

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  617  STGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  660



>gb|KHN11195.1| 60S ribosomal protein L11 [Glycine soja]
Length=171

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  VVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  154



>ref|XP_010516520.1| PREDICTED: 60S ribosomal protein L11-1-like [Camelina sativa]
 gb|AAL69452.1| At2g42740/F7D19.26 [Arabidopsis thaliana]
Length=172

 Score =   288 bits (737),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/154 (98%), Positives = 154/154 (100%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  VVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  154



>ref|NP_851137.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
 gb|AAM64289.1| ribosomal protein L11, cytosolic [Arabidopsis thaliana]
 gb|AED95296.1| 60S ribosomal protein L11-2 [Arabidopsis thaliana]
Length=172

 Score =   288 bits (737),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/154 (97%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRVARRRRCK RVGIQHRVTKDDAMKW
Sbjct  121  VVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKW  154



>dbj|BAJ85332.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95551.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT17477.1| 60S ribosomal protein L11 [Aegilops tauschii]
Length=180

 Score =   288 bits (737),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M++EKK  N MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNTMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKW  164



>pdb|3J61|J Chain J, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50983.1| ribosomal protein L11 [Triticum aestivum]
 gb|EMT22063.1| 60S ribosomal protein L11 [Aegilops tauschii]
Length=180

 Score =   287 bits (735),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M++EKK  NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MSTEKKQLNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDP
Sbjct  61   IRRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK+DAMKW
Sbjct  121  STGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKW  164



>gb|ACD56663.1| putative ribosomal protein [Gossypium arboreum]
Length=172

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/154 (96%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLER GYRV RRRRCK+ VGIQHRVTK+DAMKW
Sbjct  121  VVLERAGYRVGRRRRCKSSVGIQHRVTKEDAMKW  154



>ref|XP_007048734.1| Ribosomal L5P family protein isoform 2 [Theobroma cacao]
 gb|EOX92891.1| Ribosomal L5P family protein isoform 2 [Theobroma cacao]
Length=172

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/154 (97%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLER GYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  VVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKW  154



>gb|AAT64021.1| putative ribosomal protein [Gossypium hirsutum]
 gb|AAT64031.1| putative ribosomal protein [Gossypium hirsutum]
 gb|ACD56649.1| putative ribosomal protein [Gossypioides kirkii]
 gb|KJB68370.1| hypothetical protein B456_010G241400 [Gossypium raimondii]
 gb|KJB69700.1| hypothetical protein B456_011G038200 [Gossypium raimondii]
Length=172

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/154 (97%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLER GYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  VVLERAGYRVGRRRRCKSRVGIQHRVTKEDAMKW  154



>gb|ACN35575.1| unknown [Zea mays]
 gb|AFW71161.1| hypothetical protein ZEAMMB73_877153 [Zea mays]
 gb|AFW71162.1| hypothetical protein ZEAMMB73_877153 [Zea mays]
Length=172

 Score =   286 bits (732),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/154 (97%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLER GYRVARRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  VVLERAGYRVARRRRCKSRVGIQHRVTKEDSMKW  154



>emb|CBI22012.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   286 bits (732),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/154 (96%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRV RRRRCK+RVGIQHRVTKDD+MKW
Sbjct  121  VVLERPGYRVGRRRRCKSRVGIQHRVTKDDSMKW  154



>gb|KJB34908.1| hypothetical protein B456_006G089700 [Gossypium raimondii]
Length=172

 Score =   285 bits (729),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 148/154 (96%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLER GYRV RRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  VVLERAGYRVGRRRRCKSRVGIQHRVTKEDSMKW  154



>ref|XP_001751962.1| predicted protein [Physcomitrella patens]
 gb|EDQ83397.1| predicted protein [Physcomitrella patens]
Length=171

 Score =   284 bits (727),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFS++GCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSESGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRV RRRR K+RVGIQHRVTK+DAMKW
Sbjct  121  VVLERPGYRVGRRRRAKSRVGIQHRVTKEDAMKW  154



>ref|XP_002981065.1| hypothetical protein SELMODRAFT_444767 [Selaginella moellendorffii]
 ref|XP_002982539.1| hypothetical protein SELMODRAFT_271568 [Selaginella moellendorffii]
 gb|EFJ16292.1| hypothetical protein SELMODRAFT_271568 [Selaginella moellendorffii]
 gb|EFJ17766.1| hypothetical protein SELMODRAFT_444767 [Selaginella moellendorffii]
Length=177

 Score =   284 bits (727),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/157 (94%), Positives = 153/157 (97%), Gaps = 0/157 (0%)
 Frame = +2

Query  92   NNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKI  271
             NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSKAR+TVRSFGIRRNEKI
Sbjct  5    QNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQQPVFSKARFTVRSFGIRRNEKI  64

Query  272  ACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM  451
            ACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM
Sbjct  65   ACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM  124

Query  452  DFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            DF+VVLERPGYRVARRRRCK++VG + RVTK+DAMKW
Sbjct  125  DFFVVLERPGYRVARRRRCKSKVGHKQRVTKEDAMKW  161



>ref|XP_006656151.1| PREDICTED: 60S ribosomal protein L11-like [Oryza brachyantha]
Length=172

 Score =   284 bits (726),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  VVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  154



>gb|EMS66091.1| 60S ribosomal protein L11 [Triticum urartu]
Length=225

 Score =   285 bits (728),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   ASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGI  253
            ++EKK  NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFGI
Sbjct  47   STEKKQLNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGI  106

Query  254  RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPS  433
            RRNEKIACYVT+RG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG+KYDPS
Sbjct  107  RRNEKIACYVTIRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGMKYDPS  166

Query  434  TGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            TGIYGMDF+VVLER GYRV+RRRRCKARVGI  RVTK+DAMKW
Sbjct  167  TGIYGMDFFVVLERAGYRVSRRRRCKARVGIHQRVTKEDAMKW  209



>gb|ADR71243.1| 60S ribosomal protein L11A [Hevea brasiliensis]
Length=172

 Score =   282 bits (722),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/154 (96%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQK VLNISVGESGDRLTRAAKVLEQLSGQ PVFSKARYTVRSFGIR NEKIACY
Sbjct  1    MREIKVQKRVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKARYTVRSFGIRCNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  VVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  154



>emb|CDP15952.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   282 bits (721),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRGDKAMQLLESGLKVKEYELL+RNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGDKAMQLLESGLKVKEYELLKRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRVARRRRCK+RVGI  RVTK+DAMKW
Sbjct  121  VVLERPGYRVARRRRCKSRVGIHQRVTKEDAMKW  154



>tpg|DAA52967.1| TPA: hypothetical protein ZEAMMB73_694767 [Zea mays]
Length=831

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMRE+KVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>gb|AAB82139.1| ribosomal protein [Oryza sativa Indica Group]
Length=182

 Score =   281 bits (719),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMR+IKVQKLVLNISVGESGDRLTRA+KVLEQL GQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLIGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKE ELLRR+ S+TGCFGFGIQEHIDLGI+ DP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKECELLRRSCSETGCFGFGIQEHIDLGIQCDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STG YGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGFYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>emb|CBI30709.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   280 bits (715),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MR+IKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSF IRRNEKIACY
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFAIRRNEKIACY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY
Sbjct  61   VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRV RRRRCKARVG  HRVTKDDAMKW
Sbjct  121  VVLERPGYRVGRRRRCKARVGPHHRVTKDDAMKW  154



>ref|XP_002438544.1| hypothetical protein SORBIDRAFT_10g021710 [Sorghum bicolor]
 gb|EER89911.1| hypothetical protein SORBIDRAFT_10g021710 [Sorghum bicolor]
Length=183

 Score =   280 bits (716),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLE-QLSGQTPVFSKARYTVRSF  247
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRAAK++     GQ+PVFSKARYTVRSF
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRAAKLMHLSWRGQSPVFSKARYTVRSF  60

Query  248  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  427
            GIRRNEKI CYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYD
Sbjct  61   GIRRNEKIVCYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYD  120

Query  428  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            PSTGIYGMDFYVVLER GYRVARR RCK+RVGIQH VTK+DAMKW
Sbjct  121  PSTGIYGMDFYVVLERAGYRVARRCRCKSRVGIQHIVTKEDAMKW  165



>gb|AAD21733.1| 60S ribosomal protein L11B [Arabidopsis thaliana]
Length=182

 Score =   278 bits (712),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 154/164 (94%), Gaps = 10/164 (6%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKV----------LEQLSGQTPVFSKARYTVRSFG  250
            MR+IKVQKLVLNISVGESGDRLTRA+KV          LEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MRDIKVQKLVLNISVGESGDRLTRASKVPPVFYPFSVVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKW  164



>dbj|BAD53703.1| putative 60S ribosomal protein L11-1 [Oryza sativa Japonica Group]
Length=182

 Score =   274 bits (701),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 153/164 (93%), Gaps = 10/164 (6%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKV----------LEQLSGQTPVFSKARYTVRSFG  250
            MREIKVQKLVLNISVGESGDRLTRA+KV          LEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRASKVWPIFSMYFQVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRRRCK+RVGIQHRVTK+DAMKW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKW  164



>gb|ABR25412.1| 60S ribosomal protein l11 [Oryza sativa Indica Group]
Length=152

 Score =   273 bits (698),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 136/138 (99%), Gaps = 0/138 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK +NPMREIKVQKLVLNISVGESGDRLTRA+KVLEQLSGQ+PVFSKARYTVRSFG
Sbjct  1    MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGY  484
            STGIYGMDFYVVLER GY
Sbjct  121  STGIYGMDFYVVLERAGY  138



>gb|KHN28096.1| 60S ribosomal protein L11 [Glycine soja]
Length=170

 Score =   272 bits (696),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 148/154 (96%), Gaps = 1/154 (1%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ PVFSK    +RSFGIRRNEKIACY
Sbjct  1    MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQAPVFSKG-TLIRSFGIRRNEKIACY  59

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF+
Sbjct  60   VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFF  119

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLERPGYRV RRRRCK+RVGIQHRVTK+DAMKW
Sbjct  120  VVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKW  153



>gb|AAQ96376.1| ribosomal protein L11-like protein [Solanum palustre]
Length=163

 Score =   271 bits (693),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 147/147 (100%), Gaps = 0/147 (0%)
 Frame = +2

Query  122  KLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDK  301
            KLVLNISVGESGDRLTRAAKVLEQLSGQ+PVFSKARYTVRSFGIRRNEKIACYVTVRG+K
Sbjct  1    KLVLNISVGESGDRLTRAAKVLEQLSGQSPVFSKARYTVRSFGIRRNEKIACYVTVRGEK  60

Query  302  AMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG  481
            AMQLLESGLKVKEYELLRRNFS+TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG
Sbjct  61   AMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPG  120

Query  482  YrvarrrrckarvGIQHRVTKDDAMKW  562
            YRVARRRRCK+RVGIQHRVTK+D+MKW
Sbjct  121  YRVARRRRCKSRVGIQHRVTKEDSMKW  147



>ref|XP_011397124.1| 60S ribosomal protein L11-1 [Auxenochlorella protothecoides]
 gb|KFM24237.1| 60S ribosomal protein L11-1 [Auxenochlorella protothecoides]
Length=180

 Score =   267 bits (682),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M ++KK +NPMREI+V KLVLN  VGESGDRL +AAKVLEQL+GQ PVF KARYTVR + 
Sbjct  1    MVADKKASNPMREIRVAKLVLNCCVGESGDRLQKAAKVLEQLTGQQPVFGKARYTVRQWS  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            +RRNEKI+C+VTVRG+KA+QLLE+GLKVKEYELLRRNFSD+G FGFGI EHIDLGIKYDP
Sbjct  61   VRRNEKISCHVTVRGEKALQLLEAGLKVKEYELLRRNFSDSGNFGFGITEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRVA+RR+  ARVG+QHRVTKDDAMKW
Sbjct  121  STGIYGMDFYVVLERPGYRVAKRRKQLARVGVQHRVTKDDAMKW  164



>ref|XP_009617442.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis]
Length=171

 Score =   265 bits (677),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            MREIKV KL LNIS+ ESGDRLTRAAKVLEQLSGQ+P+FSKARYTVRSFGIRRNEKI  Y
Sbjct  1    MREIKVHKLFLNISISESGDRLTRAAKVLEQLSGQSPIFSKARYTVRSFGIRRNEKIPYY  60

Query  281  VTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY  460
            VTVRGDKAMQL ESGLKVKEYELLRRNFS+T CFGFGIQEHIDLGIKYDPSTGIYG++FY
Sbjct  61   VTVRGDKAMQLFESGLKVKEYELLRRNFSETSCFGFGIQEHIDLGIKYDPSTGIYGINFY  120

Query  461  VVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            VVLE PGYRVAR RRCK+RVGIQHRVTK+DAMKW
Sbjct  121  VVLEHPGYRVARHRRCKSRVGIQHRVTKEDAMKW  154



>gb|KDD76069.1| hypothetical protein H632_c370p1 [Helicosporidium sp. ATCC 50920]
Length=179

 Score =   264 bits (674),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKK  NPMR+I+V KLVLN  VGESGDRL +AAKVLEQL+GQ PVF +ARYTVR + 
Sbjct  1    MASEKKKQNPMRDIRVAKLVLNCEVGESGDRLQKAAKVLEQLTGQQPVFGRARYTVRQWS  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRR EKI+C+VTVRGDKA+QLLE+GLKVKEYELLRRNFSDTG FGFGI EHIDLGIKYDP
Sbjct  61   IRRGEKISCFVTVRGDKALQLLEAGLKVKEYELLRRNFSDTGNFGFGISEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLERPGYRV++R+R  +RVG+QHRVTK DAM W
Sbjct  121  STGIYGMDFYVVLERPGYRVSKRKRAPSRVGVQHRVTKGDAMNW  164



>ref|XP_005647682.1| ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
 gb|EIE23138.1| ribosomal protein L5 [Coccomyxa subellipsoidea C-169]
Length=180

 Score =   259 bits (662),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M ++KK  NPMREI+V KLVLNI VGESGDRL +AAKVLEQL+GQ PVF KARYTVR+F 
Sbjct  1    MVNDKKTTNPMREIRVAKLVLNICVGESGDRLQKAAKVLEQLTGQQPVFGKARYTVRTFA  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+  VTVRG+KA+QL+E+GLKVKEYELLRRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISTSVTVRGEKALQLIEAGLKVKEYELLRRNFSETGNFGFGINEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYVVLER GYRVARRR+  A+VG+QHRV KDDA+KW
Sbjct  121  STGIYGMDFYVVLERAGYRVARRRQRLAKVGVQHRVGKDDAIKW  164



>emb|CBJ30107.1| conserved unknown protein [Ectocarpus siliculosus]
Length=173

 Score =   258 bits (659),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +2

Query  92   NNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKI  271
             NPMR++KV KLVLN SVGESGDRLTRAAKVLEQL+GQ+PV+SKARYTVRSFGIRRNEKI
Sbjct  6    TNPMRDLKVDKLVLNCSVGESGDRLTRAAKVLEQLTGQSPVYSKARYTVRSFGIRRNEKI  65

Query  272  ACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGM  451
            AC+VTVRGDKA+++LE GLKVKEYEL R+NFS+TG FGFGIQEHIDLG+KYDPSTGIYGM
Sbjct  66   ACHVTVRGDKALEILERGLKVKEYELKRKNFSNTGSFGFGIQEHIDLGLKYDPSTGIYGM  125

Query  452  DFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            DF+VVL RPGYRVA+R+   A++G QH+VTK DA+KW
Sbjct  126  DFFVVLNRPGYRVAKRKAKCAKIGYQHKVTKTDAVKW  162



>gb|KIY97763.1| 60S ribosomal protein L11, partial [Monoraphidium neglectum]
 gb|KIZ07647.1| 60S ribosomal protein L11 [Monoraphidium neglectum]
Length=180

 Score =   256 bits (655),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M ++ K  NPMREI+V KLVLNI VGESGDRL +AAKVLEQL+GQ PV+ KARYTVRSF 
Sbjct  1    MVNDAKAGNPMREIRVSKLVLNICVGESGDRLQKAAKVLEQLTGQQPVYGKARYTVRSFS  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+C VTVRG+KAMQLL++GLKVKEYEL+R+NFS++G FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISCSVTVRGEKAMQLLDAGLKVKEYELIRKNFSESGNFGFGISEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDFYV LERPGYRVARRRR  +RVG+QHRVTK+DA +W
Sbjct  121  STGIYGMDFYVCLERPGYRVARRRRVHSRVGVQHRVTKEDATRW  164



>tpe|CAL69062.1| TPA: putative 60S ribosomal protein L11 [Spadella cephaloptera]
Length=207

 Score =   256 bits (653),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = +2

Query  41   VSPSPRQPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFS  220
            ++ + +  K  A  KK NNPMR+IK+ KL LNI VGESGDRLTRAAKVLEQLSGQ PVFS
Sbjct  1    MAATTQAAKTKAVTKKANNPMRDIKIMKLCLNICVGESGDRLTRAAKVLEQLSGQQPVFS  60

Query  221  KARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQE  400
            KARYTVRSFGIRRNEKIAC+ TVRG KA ++LE GLKV EYEL R  FSDTG FGFG+QE
Sbjct  61   KARYTVRSFGIRRNEKIACHCTVRGPKAEEILEKGLKVVEYELRRDCFSDTGSFGFGLQE  120

Query  401  HIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            HIDLGIKYDPS GIYG+DFYVVL R GY V +RR  K+ +G+QHRVTKD+AMKW
Sbjct  121  HIDLGIKYDPSIGIYGLDFYVVLGRAGYNVNQRRARKSTIGVQHRVTKDEAMKW  174



>ref|XP_010244733.1| PREDICTED: 60S ribosomal protein L11-1-like [Nelumbo nucifera]
Length=173

 Score =   252 bits (644),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVG+SGD LTR AKVLEQLSGQTP+F KAR  V SFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGKSGDCLTRVAKVLEQLSGQTPIFLKARSIVWSFG  60

Query  251  I--RRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKY  424
            I  R NEKI CY T+RG+KA QLLESGLKVKEYELLRRNFSDTGCF F IQEHIDLGI Y
Sbjct  61   ISIRCNEKITCYATLRGEKAKQLLESGLKVKEYELLRRNFSDTGCFSFSIQEHIDLGINY  120

Query  425  DPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            DPS GIYGMDFYV+ ERP YRVARRRRCK+ +GIQHRVTK+DAMKW
Sbjct  121  DPSIGIYGMDFYVIHERPRYRVARRRRCKSHIGIQHRVTKEDAMKW  166



>gb|KJB57390.1| hypothetical protein B456_009G161300 [Gossypium raimondii]
Length=154

 Score =   251 bits (641),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 131/164 (80%), Gaps = 28/164 (17%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG
Sbjct  1    MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIACYVTVRG+KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK   
Sbjct  61   IRRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKCKS  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
                                          GIQHRVTK+DAMKW
Sbjct  121  RV----------------------------GIQHRVTKEDAMKW  136



>gb|AIU94837.1| 60S ribosomal protein [Phragmatopoma lapidosa]
Length=179

 Score =   250 bits (638),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA +KK NN MRE+++ KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFG
Sbjct  1    MAEDKKKNNAMRELRILKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRRNNFSGTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFYVVL RPG+ V++RR+ K+ +G QHRVTKD++MKW
Sbjct  121  SIGIYGMDFYVVLGRPGFNVSKRRKRKSVIGFQHRVTKDESMKW  164



>ref|XP_003598138.1| 60S ribosomal protein L11-1 [Medicago truncatula]
 gb|AES68389.1| 50S ribosomal protein L5P [Medicago truncatula]
Length=241

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 146/169 (86%), Gaps = 2/169 (1%)
 Frame = +2

Query  62   PKAMASEKKL-NNPMREIKVQKLVLNISVG-ESGDRLTRAAKVLEQLSGQTPVFSKARYT  235
            P   A EKKL NNP+R+IKVQKLVLNISVG ES  RLTRAA VL  LSGQTPV SKA++T
Sbjct  57   PPHQAYEKKLLNNPLRDIKVQKLVLNISVGGESRHRLTRAAMVLHHLSGQTPVLSKAKHT  116

Query  236  VRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLG  415
            VRSFG RRNEKI+CYVTVRGDKAMQLLES LKVKEY+LL RNFSDTGCF F IQ+HI+LG
Sbjct  117  VRSFGNRRNEKISCYVTVRGDKAMQLLESSLKVKEYKLLSRNFSDTGCFCFSIQDHIELG  176

Query  416  IKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
             KYDPS GIYGM+F+VVLERPG RV RR R KAR+GIQHRVTKDDAMKW
Sbjct  177  FKYDPSIGIYGMNFFVVLERPGNRVGRRPRGKARLGIQHRVTKDDAMKW  225



>emb|CCI45988.1| unnamed protein product [Albugo candida]
Length=176

 Score =   247 bits (631),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA +KK NN MREIKV KLV+N  VGESGD+LTRAA+VLEQL+GQ PV+SKARYTVRSFG
Sbjct  1    MAGDKKSNNAMREIKVDKLVINCCVGESGDKLTRAARVLEQLTGQKPVYSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+C+VTVRG+ A ++L+ GLKVKEYEL R+NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKISCHVTVRGEMASEILDRGLKVKEYELKRKNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVL RPG RV+ R+  ++R+G  HR+ KDDA+ W
Sbjct  121  STGIYGMDFFVVLSRPGARVSHRKIQQSRIGAPHRLRKDDAINW  164



>emb|CEF97266.1| Ribosomal protein L5, conserved site [Ostreococcus tauri]
Length=179

 Score =   247 bits (631),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA +K   NPMR I++ KLVLNI VGESGDRLT+AAKVLEQL+GQ P+FSKARYTVR+FG
Sbjct  1    MAGDKS-ENPMRAIRIHKLVLNICVGESGDRLTKAAKVLEQLTGQQPIFSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRG-DKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  427
            IRRNEKI+ +VT+   DKAMQ+LESGLKVKE+ELL+RNFS TG FGFGI EHIDLGIKYD
Sbjct  60   IRRNEKISAHVTIGNRDKAMQILESGLKVKEFELLKRNFSATGNFGFGISEHIDLGIKYD  119

Query  428  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            PSTGIYGMDFYVVLERPGYRV RRR+ + ++G QH++TK DAM+W
Sbjct  120  PSTGIYGMDFYVVLERPGYRVHRRRKQQKKIGKQHKLTKADAMRW  164



>gb|KDB13460.1| 60S ribosomal protein L11 [Ustilaginoidea virens]
Length=173

 Score =   247 bits (630),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K  +G  HR+ +D+ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKTTIGASHRIKRDETVKW  163



>emb|CCE35354.1| probable ribosomal protein L11.e.A, cytosolic [Claviceps purpurea 
20.1]
Length=173

 Score =   247 bits (630),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV+RRRR K  +G  HR+ +D+ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVSRRRRMKNTIGASHRIKRDETVKW  163



>ref|XP_007874680.1| hypothetical protein PNEG_02659 [Pneumocystis murina B123]
 gb|EMR08874.1| hypothetical protein PNEG_02659 [Pneumocystis murina B123]
Length=175

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  83   KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  262
            +K +NPMREIK+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYT+R+FGIRRN
Sbjct  4    EKGSNPMREIKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTIRAFGIRRN  63

Query  263  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  442
            EKI+ YVTVRG KA ++LE GLKVKEYEL R NFSDTG FGFGI EHIDL IKYDPS GI
Sbjct  64   EKISVYVTVRGAKAEEILERGLKVKEYELKRSNFSDTGNFGFGIHEHIDLNIKYDPSIGI  123

Query  443  YGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            +GM+FYVVL RPG+RV++RRRC++ VG  H+VTK+DA++W
Sbjct  124  FGMNFYVVLGRPGFRVSKRRRCRSSVGSNHKVTKEDAIRW  163



>gb|KHN95345.1| 60S ribosomal protein L11 [Metarhizium album ARSEF 1941]
Length=173

 Score =   246 bits (628),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M+SEK LNNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSSEK-LNNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+ +G  HR+ +++ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSTIGASHRIKREETVKW  163



>ref|XP_001607270.1| PREDICTED: 60S ribosomal protein L11 [Nasonia vitripennis]
Length=195

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 146/179 (82%), Gaps = 5/179 (3%)
 Frame = +2

Query  26   PSLPAVSPSPRQPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQ  205
            P+ PAV  + ++PK  +      N MRE++++KL LNI VGESGDRLTRAAKVLEQL+GQ
Sbjct  8    PAKPAVKKTRKEPKDASK-----NVMREVRIRKLCLNICVGESGDRLTRAAKVLEQLTGQ  62

Query  206  TPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFG  385
             PVFSKARYTVRSFGIRRNEKIA + TVRG KA ++LE GLKV+EYEL R NFS TG FG
Sbjct  63   QPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRRENFSCTGNFG  122

Query  386  FGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            FGIQEHIDLGIKYDPS GIYG+DFYVVL RPG+ VA RRR   +VG QHR+TK+DAMKW
Sbjct  123  FGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFNVAHRRRKIGKVGFQHRLTKEDAMKW  181



>ref|XP_004220956.1| 60S ribosomal protein L11 [Plasmodium cynomolgi strain B]
 dbj|GAB64825.1| 60S ribosomal protein L11 [Plasmodium cynomolgi strain B]
Length=173

 Score =   246 bits (628),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  80   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  259
            EKK +N MREIKV KLVLNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  260  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  439
            NEKI+C+VTVRG KA+++LE GLKVKEYEL R+NFS+TG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSETGNFGFGIQEHIDLGIKYDPSTG  121

Query  440  IYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            IYGMDFYV L RPGYRV +RRR ++ +   H+VTKD+AMKW
Sbjct  122  IYGMDFYVHLSRPGYRVTKRRRKRSTISKTHKVTKDEAMKW  162



>ref|XP_679576.1| 60S ribosomal protein L11a [Plasmodium berghei strain ANKA]
 ref|XP_741752.1| 60S ribosomal protein L11a [Plasmodium chabaudi chabaudi]
 ref|XP_730342.1| ribosomal protein L11 [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21907.1| ribosomal protein L11-like [Plasmodium yoelii yoelii]
 emb|CAH98826.1| 60S ribosomal protein L11a, putative [Plasmodium berghei]
 emb|CAH89249.1| 60S ribosomal protein L11a, putative [Plasmodium chabaudi chabaudi]
 emb|CDR11742.1| 60S ribosomal protein L11a, putative [Plasmodium chabaudi chabaudi]
 emb|CDS45545.1| 60S ribosomal protein L11a, putative [Plasmodium berghei ANKA]
 emb|CDU17049.1| 60S ribosomal protein L11a, putative [Plasmodium yoelii]
 emb|CDZ14859.1| 60S ribosomal protein L11a, putative [Plasmodium yoelii]
Length=173

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  80   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  259
            EKK +N MREIKV KL+LNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLILNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  260  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  439
            NEKI+C+VTVRG KA+++LE GLKVKEYEL R+NFSDTG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSDTGNFGFGIQEHIDLGIKYDPSTG  121

Query  440  IYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            IYGMDFYV L RPGYRV RRRR ++ +   H+VTK+DAMKW
Sbjct  122  IYGMDFYVHLSRPGYRVTRRRRKRSTISKTHKVTKEDAMKW  162



>gb|KFM71516.1| 60S ribosomal protein L11, partial [Stegodyphus mimosarum]
Length=187

 Score =   246 bits (628),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  59   QPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTV  238
            +PKA A ++K NN MRE++++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTV
Sbjct  13   KPKANAGKEKENNRMREVRIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTV  72

Query  239  RSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGI  418
            RSFGIRRNEKIA + TVRG KA ++LE GLKV+EYEL R NFSDTG FGFGIQEHIDLGI
Sbjct  73   RSFGIRRNEKIAVHCTVRGPKAEEILEKGLKVREYELKRENFSDTGNFGFGIQEHIDLGI  132

Query  419  KYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            KYDP+ GIYG+DFYVVL RPG+ VA RRR K  VG +HR++K++AMKW
Sbjct  133  KYDPTIGIYGLDFYVVLGRPGFNVAYRRRRKGVVGSKHRLSKEEAMKW  180



>ref|XP_009261766.1| hypothetical protein FPSE_10374 [Fusarium pseudograminearum CS3096]
 ref|XP_011316841.1| 60S ribosomal protein L11 [Fusarium graminearum PH-1]
 gb|EKJ69441.1| hypothetical protein FPSE_10374 [Fusarium pseudograminearum CS3096]
 gb|ESU06356.1| 60S ribosomal protein L11 [Fusarium graminearum PH-1]
 gb|EYB33769.1| hypothetical protein FG05_01081 [Fusarium graminearum]
 emb|CEF73150.1| unnamed protein product [Fusarium graminearum]
Length=173

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+++G  HR+ +++ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRTKSKIGASHRIKREETVKW  163



>emb|CCE35372.1| probable ribosomal protein L11.e.A, cytosolic [Claviceps purpurea 
20.1]
Length=173

 Score =   246 bits (627),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M+SEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSSEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV+RRRR K  +G  HR+ +D+ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVSRRRRMKNTIGASHRIKRDETVKW  163



>gb|EGU80777.1| hypothetical protein FOXB_08644 [Fusarium oxysporum Fo5176]
 gb|EMT62178.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|ENH60794.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense 
race 1]
 emb|CCT62200.1| probable ribosomal protein L11.e.A, cytosolic [Fusarium fujikuroi 
IMI 58289]
 gb|EWG37687.1| 60S ribosomal protein L11 [Fusarium verticillioides 7600]
 gb|EWG37688.1| 60S ribosomal protein L11 [Fusarium verticillioides 7600]
 gb|EWY94221.1| 60S ribosomal protein L11 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ50488.1| 60S ribosomal protein L11 [Fusarium oxysporum Fo47]
 gb|EWZ92049.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA53310.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK47721.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK89881.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL49418.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL83529.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM10892.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM28225.1| 60S ribosomal protein L11 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=173

 Score =   245 bits (626),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +++ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRTKSRIGASHRIKREETVKW  163



>gb|AGM32143.1| 60S ribosomal protein L11 [Coptotermes formosanus]
Length=201

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 144/177 (81%), Gaps = 6/177 (3%)
 Frame = +2

Query  35   PAVSPSPR-QPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTP  211
            PA +  PR +PK      K  NPMRE++++KL LNI VGESGDRLTRAAKVLE L+GQ P
Sbjct  15   PAKAKKPRKEPK-----DKSKNPMREVRIRKLCLNICVGESGDRLTRAAKVLESLTGQQP  69

Query  212  VFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFG  391
            VFSKARYTVRSFGIRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFG
Sbjct  70   VFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRKDNFSDTGNFGFG  129

Query  392  IQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            IQEHIDLGIKYDPS GIYG+DFYVVL RPG+ VA RRR    VG QHR+TK+DAMKW
Sbjct  130  IQEHIDLGIKYDPSVGIYGLDFYVVLGRPGFNVAHRRRKTGMVGFQHRLTKEDAMKW  186



>ref|XP_007811586.1| 60S ribosomal protein L11 [Metarhizium acridum CQMa 102]
 ref|XP_007820170.1| Ribosomal protein L5 [Metarhizium robertsii ARSEF 23]
 gb|EFY88628.1| 60S ribosomal protein L11 [Metarhizium acridum CQMa 102]
 gb|EFZ00204.1| Ribosomal protein L5 [Metarhizium robertsii ARSEF 23]
 gb|EXV02661.1| 60S ribosomal protein L11 [Metarhizium robertsii]
 gb|KFG86990.1| 60S ribosomal protein L11 [Metarhizium anisopliae]
 gb|KID60088.1| Ribosomal protein L5, partial [Metarhizium anisopliae ARSEF 549]
 gb|KID88047.1| Ribosomal protein L5 [Metarhizium guizhouense ARSEF 977]
 gb|KIE01988.1| Ribosomal protein L5, partial [Metarhizium majus ARSEF 297]
Length=173

 Score =   245 bits (626),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +++ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSRIGASHRIKREETVKW  163



>ref|XP_965640.2| 60S ribosomal protein L11 [Neurospora crassa OR74A]
 ref|XP_009856785.1| 60S ribosomal protein L11 [Neurospora tetrasperma FGSC 2508]
 sp|Q7RVN0.2|RL11_NEUCR RecName: Full=60S ribosomal protein L11 [Neurospora crassa OR74A]
 gb|EAA36404.2| 60S ribosomal protein L11 [Neurospora crassa OR74A]
 gb|EGO53163.1| 60S ribosomal protein L11 [Neurospora tetrasperma FGSC 2508]
 gb|EGZ78005.1| 60S ribosomal protein L11 [Neurospora tetrasperma FGSC 2509]
 gb|KHE89934.1| 60S ribosomal protein L11 [Neurospora crassa]
Length=174

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M++E+K  NPMRE+++QKLVLNI VGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSTEQKAQNPMRELRIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
              GIYGMDFY  + RPG RV+RRRR K+RVG  HR+T+DD +KW
Sbjct  121  GIGIYGMDFYCCMTRPGERVSRRRRAKSRVGATHRITRDDTVKW  164



>gb|KIL95260.1| hypothetical protein FAVG1_02195 [Fusarium avenaceum]
Length=173

 Score =   244 bits (624),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA+EK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MATEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +D+ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRTKSRIGASHRIKRDETVKW  163



>ref|XP_008625536.1| 60S ribosomal protein L11 [Plasmodium vinckei vinckei]
 gb|EUD71030.1| 60S ribosomal protein L11 [Plasmodium vinckei petteri]
 gb|KEG01569.1| 60S ribosomal protein L11 [Plasmodium vinckei vinckei]
Length=173

 Score =   244 bits (624),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  80   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  259
            EKK +N MREIKV KL+LNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLILNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  260  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  439
            NEKI+C+VTVRG KA+++LE GLKVKEYEL ++NFSDTG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRKKNFSDTGNFGFGIQEHIDLGIKYDPSTG  121

Query  440  IYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            IYGMDFYV L RPGYRV RRRR ++ +   H+VTK+DAMKW
Sbjct  122  IYGMDFYVHLSRPGYRVTRRRRKRSTISKTHKVTKEDAMKW  162



>gb|EQL04255.1| Ribosomal protein L5 [Ophiocordyceps sinensis CO18]
Length=173

 Score =   244 bits (624),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+++G  HR+ +++  KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKIGASHRIKREETTKW  163



>ref|XP_001612822.1| 60S ribosomal protein L11 [Plasmodium vivax Sal-1]
 ref|XP_008818163.1| 60S ribosomal protein L11 [Plasmodium inui San Antonio 1]
 gb|EDL43095.1| 60S ribosomal protein L11, putative [Plasmodium vivax]
 gb|EUD65229.1| 60S ribosomal protein L11 [Plasmodium inui San Antonio 1]
Length=173

 Score =   244 bits (624),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  80   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  259
            EKK +N MREIKV KLVLNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  260  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  439
            NEKI+C+VTVRG KA+++LE GLKVKEYEL R+NFS+TG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSETGNFGFGIQEHIDLGIKYDPSTG  121

Query  440  IYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            IYGMDFYV L RPGYRV RRRR ++ +   H+VTKD+AMKW
Sbjct  122  IYGMDFYVHLSRPGYRVTRRRRKRSTISKTHKVTKDEAMKW  162



>gb|ELW68491.1| 60S ribosomal protein L11 [Tupaia chinensis]
Length=206

 Score =   246 bits (627),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 9/187 (5%)
 Frame = +2

Query  29   SLPAVSPSPRQPKAMASEKKL---------NNPMREIKVQKLVLNISVGESGDRLTRAAK  181
            ++P  +P  R P A  ++ +           NPMRE++++KL LNI VGESGDRLTRAAK
Sbjct  7    AVPVATPESRAPPASCADCRFPVQQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAK  66

Query  182  VLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRN  361
            VLEQL+GQTPVFSKARYTVRSFGIRRNEKIA + TVRG KA ++LE GLKV+EYEL + N
Sbjct  67   VLEQLTGQTPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNN  126

Query  362  FSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVT  541
            FSDTG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL RPG+ +A ++R    +G +HR++
Sbjct  127  FSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRIS  186

Query  542  KDDAMKW  562
            K++AM+W
Sbjct  187  KEEAMRW  193



>emb|CCF73368.1| unnamed protein product [Babesia microti strain RI]
Length=174

 Score =   244 bits (623),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  86   KLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  265
            K  NPMR+I+V+KLVLNI VGESGDRLTRA KVLEQL+ Q PVFSK R T+RSFG+RRNE
Sbjct  4    KEENPMRDIRVKKLVLNIGVGESGDRLTRAGKVLEQLTDQRPVFSKCRLTIRSFGVRRNE  63

Query  266  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  445
            KIAC+VTVRG KAM +LE GLKVKEYEL R+NFSDTG FGFGIQEHIDLG+KYDPSTGIY
Sbjct  64   KIACHVTVRGKKAMDILERGLKVKEYELKRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIY  123

Query  446  GMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            GMDFYV L RPGYRV +RR+CK+++G  H++TK+DAM+W
Sbjct  124  GMDFYVQLARPGYRVCKRRKCKSKIGASHKITKEDAMEW  162



>ref|XP_005988804.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Latimeria chalumnae]
Length=177

 Score =   244 bits (623),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MAEKSEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R   R+G +HR++K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRKTGRIGAKHRISKEEAMRW  164



>gb|KFA66324.1| hypothetical protein S40285_01884 [Stachybotrys chlorohalonata 
IBT 40285]
Length=173

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL RRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K++VG  H++ +++ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKVGSNHKIKREETVKW  163



>ref|XP_003054198.1| 60S ribosomal protein L11 [Nectria haematococca mpVI 77-13-4]
 gb|EEU48485.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=173

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-TSNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +D+ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRTKSRIGAGHRIKRDETVKW  163



>gb|KID77365.1| Ribosomal protein L5, partial [Metarhizium brunneum ARSEF 3297]
Length=173

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +++ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSRIGASHRIKREETVKW  163



>gb|EHK17585.1| hypothetical protein TRIVIDRAFT_76021 [Trichoderma virens Gv29-8]
Length=173

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-TSNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +D+ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSRIGSSHRIKRDETVKW  163



>ref|XP_004678660.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Condylura cristata]
Length=177

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQSEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRW  164



>gb|KFA73465.1| hypothetical protein S40288_08466 [Stachybotrys chartarum IBT 
40288]
Length=173

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK +NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-VNNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K++VG  H++ +++ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKVGSNHKIKREETVKW  163



>ref|XP_006963013.1| 60S ribosomal protein L11, L5 family [Trichoderma reesei QM6a]
 gb|EGR51550.1| 60S ribosomal protein L11, L5 family [Trichoderma reesei QM6a]
 gb|ETS04354.1| 60S ribosomal protein L11 [Trichoderma reesei RUT C-30]
Length=173

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ASNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+R+G  HR+ +D+ ++W
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSRIGASHRIKRDETVRW  163



>ref|XP_007785480.1| 60S ribosomal protein L11 [Endocarpon pusillum Z07020]
 gb|ERF77185.1| 60S ribosomal protein L11 [Endocarpon pusillum Z07020]
Length=175

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  86   KLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  265
            K +NPMRE+++ KLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVRSFGIRRNE
Sbjct  7    KSSNPMRELRIDKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRSFGIRRNE  66

Query  266  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  445
            KIA +VTVRG KA ++LE GLKVKEYEL ++NFSDTG FGFGI EHIDLGIKYDP+ GIY
Sbjct  67   KIAVHVTVRGPKAEEILERGLKVKEYELRKKNFSDTGNFGFGISEHIDLGIKYDPAIGIY  126

Query  446  GMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            GMDFY  + RPG RVARRRRCK+++G QH+VTKDD +KW
Sbjct  127  GMDFYCCMSRPGARVARRRRCKSKIGKQHKVTKDDTVKW  165



>ref|XP_004603489.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Sorex araneus]
Length=177

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQAEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRW  164



>gb|EPX72141.1| 60S ribosomal protein L11 [Schizosaccharomyces octosporus yFS286]
 gb|EPX75112.1| 60S ribosomal protein L11 [Schizosaccharomyces octosporus yFS286]
Length=174

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  83   KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  262
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  263  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  442
            EKI+C+VTVRG KA ++LE GLKVKEYEL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKISCHVTVRGPKAEEILERGLKVKEYELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  443  YGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            YGMDFYVV++RPG RV RR+  ++R+G  H++T +D + W
Sbjct  123  YGMDFYVVMDRPGMRVTRRKAQRSRIGFTHKITPEDTINW  162



>ref|XP_002261116.1| 60S ribosomal protein L11a [Plasmodium knowlesi strain H]
 emb|CAQ38304.1| 60S ribosomal protein L11a, putative [Plasmodium knowlesi strain 
H]
Length=173

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  80   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  259
            EKK +N MREIKV KLVLNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    EKKEDNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  260  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  439
            NEKI+C+VTVRG KA+++LE GLKVKEYEL ++NFS+TG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRKKNFSETGNFGFGIQEHIDLGIKYDPSTG  121

Query  440  IYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            IYGMDFYV L RPGYRV RRRR ++ +   H+VTKD+AMKW
Sbjct  122  IYGMDFYVHLSRPGYRVTRRRRKRSTISKTHKVTKDEAMKW  162



>gb|AAX42399.1| ribosomal protein L11 [synthetic construct]
Length=177

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIANKKRRTGCIGAKHRISKEEAMRW  164



>ref|XP_003351085.1| 60S ribosomal protein L11 [Sordaria macrospora k-hell]
 emb|CCC08608.1| unnamed protein product [Sordaria macrospora k-hell]
Length=174

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M++E+K  NPMRE+++QKLVLNI VGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MSTEQKAQNPMRELRIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  61   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
              GIYGMDFY  + RPG RV+RRRR K+RVG  HR+ +DD +KW
Sbjct  121  GIGIYGMDFYCCMTRPGERVSRRRRAKSRVGATHRINRDDTVKW  164



>ref|XP_006179217.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Camelus ferus]
 ref|XP_006196822.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Vicugna pacos]
Length=177

 Score =   243 bits (620),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRKTGCIGAKHRISKEEAMRW  164



>ref|XP_007511979.1| 60S ribosomal protein L11 [Bathycoccus prasinos]
 emb|CCO66067.1| 60S ribosomal protein L11 [Bathycoccus prasinos]
Length=169

 Score =   243 bits (620),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  101  MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY  280
            M++I++ KL+LNISVGESGDRLT+AAKVLEQL+GQ PVFSKARYTVR+FGIRRNEKIAC+
Sbjct  1    MKDIRIHKLILNISVGESGDRLTKAAKVLEQLTGQQPVFSKARYTVRTFGIRRNEKIACH  60

Query  281  VTVRG-DKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDF  457
            VTV   DKA+Q+LESGLKVKE+ELL++NFS TG FGFGIQEHIDLGIKYDPSTGIYGMDF
Sbjct  61   VTVGNRDKALQILESGLKVKEFELLKKNFSSTGNFGFGIQEHIDLGIKYDPSTGIYGMDF  120

Query  458  YVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            +VVLERPG+RV+RRR+C+ +VG  H++TK DAMKW
Sbjct  121  FVVLERPGFRVSRRRKCQKKVGKSHKLTKTDAMKW  155



>ref|NP_001186731.1| 60S ribosomal protein L11 isoform 2 [Homo sapiens]
 ref|NP_001240836.1| 60S ribosomal protein L11 isoform 2 [Canis lupus familiaris]
 ref|XP_004592319.1| PREDICTED: 60S ribosomal protein L11 [Ochotona princeps]
 ref|XP_004637664.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Octodon degus]
 ref|XP_005394827.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Chinchilla lanigera]
 ref|XP_006094109.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Myotis lucifugus]
 ref|XP_006145208.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Tupaia chinensis]
 ref|XP_006777626.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Myotis davidii]
 ref|XP_006737646.1| PREDICTED: 60S ribosomal protein L11 isoform X3 [Leptonychotes 
weddellii]
 ref|XP_006883589.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Elephantulus 
edwardii]
 ref|XP_007459240.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Lipotes vexillifer]
 ref|XP_008059999.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Tarsius syrichta]
 ref|XP_008146325.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Eptesicus fuscus]
 ref|XP_008571168.1| PREDICTED: 60S ribosomal protein L11 isoform X3 [Galeopterus 
variegatus]
 gb|AAD20460.3| ribosomal protein L11 [Homo sapiens]
 gb|AAH18970.1| Ribosomal protein L11 [Homo sapiens]
 gb|ABM87711.1| ribosomal protein L11 [synthetic construct]
 gb|ABW03860.1| ribosomal protein L11 [synthetic construct]
 gb|AIC49613.1| RPL11, partial [synthetic construct]
Length=177

 Score =   243 bits (620),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRW  164



>gb|AAX29834.1| ribosomal protein L11 [synthetic construct]
Length=178

 Score =   243 bits (620),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRW  164



>gb|ABR27976.1| ribosomal protein L11 [Triatoma infestans]
Length=195

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 143/175 (82%), Gaps = 5/175 (3%)
 Frame = +2

Query  38   AVSPSPRQPKAMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVF  217
            A  PS ++PK      K  N MR+++++KL LNI VGESGDRLTRAAKVLEQL+GQ PVF
Sbjct  12   AKKPSKKEPK-----DKSKNIMRDVRIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVF  66

Query  218  SKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQ  397
            SKARYTVRSFGIRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQ
Sbjct  67   SKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRKDNFSDTGNFGFGIQ  126

Query  398  EHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            EHIDLGIKYDPS GIYG+DFYVVL RPG+ VA RRR    VG QHR+TK+DAMKW
Sbjct  127  EHIDLGIKYDPSIGIYGLDFYVVLGRPGFNVAHRRRKTGVVGFQHRLTKEDAMKW  181



>gb|KEY71076.1| hypothetical protein S7711_00899 [Stachybotrys chartarum IBT 
7711]
 gb|KFA50220.1| hypothetical protein S40293_03699 [Stachybotrys chartarum IBT 
40293]
Length=173

 Score =   243 bits (619),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K++VG  H++ +++ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKVGSNHKIKREETVKW  163



>ref|XP_008593474.1| 60S ribosomal protein L11 [Beauveria bassiana ARSEF 2860]
 gb|EJP70525.1| 60S ribosomal protein L11 [Beauveria bassiana ARSEF 2860]
 gb|KGQ11909.1| 60S ribosomal protein L11 [Beauveria bassiana D1-5]
Length=173

 Score =   243 bits (619),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MASEK  NNPMRE+K+QKLVLNI VGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MASEK-ANNPMRELKIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+ +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+ +G  HR+ +D+ ++W
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSTIGASHRIKRDETVRW  163



>ref|XP_006862372.1| PREDICTED: 60S ribosomal protein L11 [Chrysochloris asiatica]
Length=177

 Score =   243 bits (620),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILERGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRW  164



>ref|XP_005955884.1| PREDICTED: 60S ribosomal protein L11 isoform X2 [Pantholops hodgsonii]
Length=177

 Score =   243 bits (619),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA + +  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGPKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R    +G +HR++K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRW  164



>ref|XP_006697554.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
 gb|EGS16972.1| putative ribosomal protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
Length=173

 Score =   242 bits (618),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            M+SEK   NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR FG
Sbjct  1    MSSEK-AQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRQFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL RRNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RVA+RRRCK+R+G  HR+T+++ ++W
Sbjct  120  SIGIYGMDFYCCMTRPGERVAKRRRCKSRIGASHRITREETIRW  163



>gb|KFD51459.1| hypothetical protein M513_07672 [Trichuris suis]
 gb|KFD60267.1| hypothetical protein M514_07672 [Trichuris suis]
Length=191

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  86   KLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  265
            KLNNPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRRNE
Sbjct  16   KLNNPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNE  75

Query  266  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  445
            KIA + TVRG KA ++LE GLKVKEYEL    FS+ G FGFGIQEHIDLGIKYDP+ GIY
Sbjct  76   KIAVHCTVRGLKAEEILEKGLKVKEYELRSSCFSECGNFGFGIQEHIDLGIKYDPTIGIY  135

Query  446  GMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            GMDFYVVL RPG+ V+ RRRCK ++G QHRVT+D+A+KW
Sbjct  136  GMDFYVVLGRPGFSVSERRRCKNKIGAQHRVTRDEAIKW  174



>ref|XP_003652525.1| 60S ribosomal protein L11 [Thielavia terrestris NRRL 8126]
 gb|AEO66189.1| hypothetical protein THITE_67248 [Thielavia terrestris NRRL 8126]
Length=172

 Score =   242 bits (618),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  83   KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  262
            +K  NPMRE+++QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FGIRRN
Sbjct  3    EKAQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRN  62

Query  263  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  442
            EKIA +VTVRG KA ++LE GLKVKEYEL RRNFS+TG FGFGI EHIDLGIKYDP  GI
Sbjct  63   EKIAVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGFGISEHIDLGIKYDPGIGI  122

Query  443  YGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            YGMDFY  + RPG RVARRRRCK+R+G  HR+T++D +KW
Sbjct  123  YGMDFYCCMTRPGERVARRRRCKSRIGASHRITREDTIKW  162



>ref|NP_477054.1| ribosomal protein L11, isoform A [Drosophila melanogaster]
 ref|NP_001286614.1| ribosomal protein L11, isoform B [Drosophila melanogaster]
 ref|XP_001974810.1| GG21971 [Drosophila erecta]
 ref|XP_002091784.1| GE12050 [Drosophila yakuba]
 ref|XP_002082231.1| GD11455 [Drosophila simulans]
 sp|P46222.2|RL11_DROME RecName: Full=60S ribosomal protein L11 [Drosophila melanogaster]
 pdb|3J39|J Chain J, Structure Of The D. Melanogaster 60s Ribosomal Proteins
 gb|AAF57560.1| ribosomal protein L11, isoform A [Drosophila melanogaster]
 gb|AAM11143.1| LD17235p [Drosophila melanogaster]
 gb|EDV55210.1| GG21971 [Drosophila erecta]
 gb|EDW91496.1| GE12050 [Drosophila yakuba]
 gb|EDX07816.1| GD11455 [Drosophila simulans]
 gb|ACL83948.1| RpL11-PA, partial [synthetic construct]
 gb|ACL89050.1| RpL11-PA [synthetic construct]
 gb|AHN56409.1| ribosomal protein L11, isoform B [Drosophila melanogaster]
Length=184

 Score =   243 bits (619),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  95   NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIA  274
            NPMR++ ++KL LNI VGESGDRLTRAAKVLEQL+GQ PVFSKARYTVRSFGIRRNEKIA
Sbjct  15   NPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIA  74

Query  275  CYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMD  454
             + TVRG KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+D
Sbjct  75   VHCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLD  134

Query  455  FYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            FYVVL RPGY V  R+R    VG QHR+TK+DAMKW
Sbjct  135  FYVVLGRPGYNVNHRKRKSGTVGFQHRLTKEDAMKW  170



>ref|NP_001002139.1| 60S ribosomal protein L11 [Danio rerio]
 gb|AAH71420.1| Ribosomal protein L11 [Danio rerio]
 gb|AAT68159.1| 60S ribosomal protein L11 [Danio rerio]
Length=178

 Score =   242 bits (618),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +2

Query  68   AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  247
            A  SEKK  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSF
Sbjct  2    ADQSEKK-ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSF  60

Query  248  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  427
            GIRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYD
Sbjct  61   GIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYD  120

Query  428  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            PS GIYG+DFYVVL RPG+ +A ++R   R+G +HR+ K++AM+W
Sbjct  121  PSIGIYGLDFYVVLGRPGFSIADKKRKTGRIGAKHRIRKEEAMRW  165



>gb|EHK50062.1| hypothetical protein TRIATDRAFT_297405 [Trichoderma atroviride 
IMI 206040]
Length=173

 Score =   242 bits (617),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA+EK  +NPMRE+K+QKLVLNISVGESGDRLTRAAKVLEQLSGQTPV+SKARYTVR+FG
Sbjct  1    MATEKS-SNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA +VTVRG KA ++LE GLKVKEYEL +RNFS+TG FGFGI EHIDLGIKYDP
Sbjct  60   IRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYGMDFY  + RPG RV RRRR K+++G  HR+ +++ +KW
Sbjct  120  SIGIYGMDFYCCMTRPGERVTRRRRMKSKIGASHRIKREETVKW  163



>ref|XP_008912007.1| 60S ribosomal protein L11 [Phytophthora parasitica INRA-310]
 gb|ETI37223.1| 60S ribosomal protein L11 [Phytophthora parasitica P1569]
 gb|ETK77445.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETL30892.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETL84131.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETM37312.1| 60S ribosomal protein L11 [Phytophthora parasitica]
 gb|ETN02792.1| 60S ribosomal protein L11 [Phytophthora parasitica INRA-310]
 gb|ETO65966.1| 60S ribosomal protein L11 [Phytophthora parasitica P1976]
 gb|ETP07076.1| 60S ribosomal protein L11 [Phytophthora parasitica CJ01A1]
 gb|ETP35169.1| 60S ribosomal protein L11 [Phytophthora parasitica P10297]
Length=178

 Score =   242 bits (618),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA +K  NNPMR+I V KLV+N  VGESGD+LTRAA+VLEQL+GQ PV+SKARYTVR+FG
Sbjct  1    MAGDKS-NNPMRDIHVDKLVINCCVGESGDKLTRAARVLEQLTGQKPVYSKARYTVRTFG  59

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKI+C+VT+RG+ A ++L+ GLKVKEYELLR+NFS+TG FGFGIQEHIDLGIKYDP
Sbjct  60   IRRNEKISCHVTIRGELAQEILDRGLKVKEYELLRKNFSETGNFGFGIQEHIDLGIKYDP  119

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            STGIYGMDF+VVL+RPG RVARR+  ++RVG  HR+TKDDA+ W
Sbjct  120  STGIYGMDFFVVLKRPGARVARRKMQQSRVGHPHRLTKDDAINW  163



>gb|KHJ43623.1| ribosomal protein L5 [Trichuris suis]
Length=191

 Score =   242 bits (618),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  86   KLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNE  265
            KLNNPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRRNE
Sbjct  16   KLNNPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNE  75

Query  266  KIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIY  445
            KIA + TVRG KA ++LE GLKVKEYEL    FS+ G FGFGIQEHIDLGIKYDP+ GIY
Sbjct  76   KIAVHCTVRGLKAEEILEKGLKVKEYELRSSCFSECGNFGFGIQEHIDLGIKYDPTIGIY  135

Query  446  GMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            GMDFYVVL RPG+ V+ RRRCK ++G QHRVT+D+A+KW
Sbjct  136  GMDFYVVLGRPGFSVSERRRCKNKIGAQHRVTRDEAIKW  174



>ref|NP_001016640.1| ribosomal protein L11 [Xenopus (Silurana) tropicalis]
 gb|AAI35523.1| hypothetical protein LOC549394 [Xenopus (Silurana) tropicalis]
Length=177

 Score =   242 bits (617),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   MASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFG  250
            MA +    NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFG
Sbjct  1    MADKSDKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFG  60

Query  251  IRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDP  430
            IRRNEKIA + TVRG KA ++LE GLKV+EYEL + NFSDTG FGFGIQEHIDLGIKYDP
Sbjct  61   IRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDP  120

Query  431  STGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            S GIYG+DFYVVL RPG+ +A ++R +  +G +HR+ K++AM+W
Sbjct  121  SIGIYGLDFYVVLGRPGFSIADKKRKRGTIGAKHRIGKEEAMRW  164



>ref|XP_001349097.1| 60S ribosomal protein L11a, putative [Plasmodium falciparum 3D7]
 pdb|1VX7|G Chain G, Cryo-em Structure Of The Plasmodium Falciparum 80s Ribosome 
Bound To The Anti-protozoan Drug Emetine, Large Subunit 
(protein Only)
 emb|CAD50943.1| 60S ribosomal protein L11a, putative [Plasmodium falciparum 3D7]
 gb|ETW19201.1| 60S ribosomal protein L11 [Plasmodium falciparum Vietnam Oak-Knoll 
(FVO)]
 gb|ETW43784.1| 60S ribosomal protein L11 [Plasmodium falciparum NF135/5.C10]
 gb|ETW50121.1| 60S ribosomal protein L11 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW57124.1| 60S ribosomal protein L11 [Plasmodium falciparum Palo Alto/Uganda]
 gb|ETW60096.1| 60S ribosomal protein L11 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR73748.1| 60S ribosomal protein L11 [Plasmodium falciparum 7G8]
 gb|EUT88273.1| 60S ribosomal protein L11 [Plasmodium falciparum Santa Lucia]
 emb|CDO63653.1| 60S ribosomal protein L11a, putative [Plasmodium reichenowi]
Length=173

 Score =   242 bits (617),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  80   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  259
            E K  N MREIKV KLVLNI VGESGDRLTRAA+VLEQL+ Q P+F K R+T+RSFG+RR
Sbjct  2    ENKEQNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLTEQKPIFGKCRFTIRSFGVRR  61

Query  260  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  439
            NEKI+C+VTVRG KA+++LE GLKVKEYEL R+NFSDTG FGFGIQEHIDLGIKYDPSTG
Sbjct  62   NEKISCFVTVRGKKALEILEKGLKVKEYELRRKNFSDTGNFGFGIQEHIDLGIKYDPSTG  121

Query  440  IYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            IYGMDFYV L R GYRV RR R ++++   H+VTK+DAMKW
Sbjct  122  IYGMDFYVHLSRSGYRVTRRTRRRSKISKTHKVTKEDAMKW  162



>ref|XP_007406729.1| hypothetical protein MELLADRAFT_103715 [Melampsora larici-populina 
98AG31]
 gb|EGG09675.1| hypothetical protein MELLADRAFT_103715 [Melampsora larici-populina 
98AG31]
Length=195

 Score =   242 bits (618),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = +2

Query  32   LPAVSP-SPRQPKAMASEKKLN---NPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLS  199
            LPA  P SP  P   A   + +   NPMRE+K++KLV+NISVGESGDRLTRA+KVLEQL+
Sbjct  4    LPAKRPISPTCPPNNAQHFQADTKTNPMRELKIEKLVINISVGESGDRLTRASKVLEQLT  63

Query  200  GQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGC  379
            GQTPV SKARYTVRSFGIRRNEKIAC+VT+RG KA ++LE GLKVKEYEL +RNFS+TG 
Sbjct  64   GQTPVTSKARYTVRSFGIRRNEKIACHVTIRGPKAEEILERGLKVKEYELRKRNFSETGN  123

Query  380  FGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMK  559
            FGFGI EHIDLGIKYDP  GI+GMDFYVV+ RPG+RVARR+   ARVG +H+V K+D M 
Sbjct  124  FGFGITEHIDLGIKYDPGIGIFGMDFYVVMGRPGFRVARRKHATARVGYKHKVKKEDTMT  183

Query  560  W  562
            W
Sbjct  184  W  184



>ref|XP_003293531.1| ribosomal protein L11 [Dictyostelium purpureum]
 gb|EGC29950.1| ribosomal protein L11 [Dictyostelium purpureum]
Length=187

 Score =   242 bits (618),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  68   AMASEKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  247
            A A  +K +NPMR +K++KLVLNI VGESGDRL RAAKVLEQL+GQTPV+SKARYTVRSF
Sbjct  9    ASAEVQKKDNPMRGLKIEKLVLNICVGESGDRLVRAAKVLEQLTGQTPVYSKARYTVRSF  68

Query  248  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  427
             IRRNE+IA +VTVRG+KA ++LE GLKV+E+EL  +NFS TG FGFGI EHIDLG+KYD
Sbjct  69   NIRRNEQIATHVTVRGEKAAEILEKGLKVREFELRAKNFSTTGSFGFGIAEHIDLGLKYD  128

Query  428  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            PS GIYGMDF+VVL RPG+RV+R++R  A+VG QHR+TKDDA+ W
Sbjct  129  PSIGIYGMDFFVVLARPGFRVSRKKRAVAKVGFQHRITKDDAVNW  173



>ref|XP_007400955.1| hypothetical protein PHACADRAFT_264100 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM50691.1| hypothetical protein PHACADRAFT_264100 [Phanerochaete carnosa 
HHB-10118-sp]
Length=176

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = +2

Query  71   MASEKKL-NNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSF  247
            MA +K    NPM+EIK+ KLVLNISVGESGDRLTRA+KVLEQL+GQTPV SKARYTVR+F
Sbjct  1    MAEQKTAPTNPMKEIKIDKLVLNISVGESGDRLTRASKVLEQLTGQTPVTSKARYTVRTF  60

Query  248  GIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYD  427
            GIRRNEKIAC+VT+RG KA ++LE GLKVKEYEL R+NFS+TG FGFGIQEHIDLG +YD
Sbjct  61   GIRRNEKIACHVTIRGPKAEEILERGLKVKEYELRRKNFSETGNFGFGIQEHIDLGARYD  120

Query  428  PSTGIYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            P  GI+GMDFYVV+ RPG RVARR++ KARVG QHRV K+D M W
Sbjct  121  PGIGIFGMDFYVVMTRPGARVARRKQKKARVGSQHRVKKEDTMAW  165



>ref|XP_002741821.1| PREDICTED: 60S ribosomal protein L11-like [Saccoglossus kowalevskii]
Length=180

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  80   EKKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRR  259
            EKK  NPMRE++++KL LNI VGESGDRLTRAAKVLEQL+GQTPVFSKARYTVRSFGIRR
Sbjct  5    EKKKINPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR  64

Query  260  NEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTG  439
            NEKIA + TVRG+KA ++LE GL+V+EYEL + NFS++G FGFGIQEHIDLGIKYDP  G
Sbjct  65   NEKIAVHCTVRGEKAEEILERGLRVREYELRKNNFSESGNFGFGIQEHIDLGIKYDPGIG  124

Query  440  IYGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            IYGMDFY+VL RPG+ V  RR  K  +G  HRVTKD++MKW
Sbjct  125  IYGMDFYIVLGRPGFNVKDRRNKKGTIGRNHRVTKDESMKW  165



>gb|EPY49528.1| 60S ribosomal protein L11 [Schizosaccharomyces cryophilus OY26]
Length=174

 Score =   241 bits (616),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  83   KKLNNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRN  262
            +K  NPM+E+++ KLVLNIS+GESGDRLTRAAKVLEQLSGQTPVFSKARYT+R FGIRRN
Sbjct  3    EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRN  62

Query  263  EKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGI  442
            EKI+C+VTVRG KA ++LE GLKVKEYEL RRNFS TG FGFGIQEHIDLGIKYDPS GI
Sbjct  63   EKISCHVTVRGPKAEEILERGLKVKEYELKRRNFSATGNFGFGIQEHIDLGIKYDPSIGI  122

Query  443  YGMDFYVVLERPGYrvarrrrckarvGIQHRVTKDDAMKW  562
            YGMDFYVV++RPG RV RR+  ++R+G  H++T  D + W
Sbjct  123  YGMDFYVVMDRPGMRVTRRKAQRSRIGFPHKITPGDTINW  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920