BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF003H01

Length=495
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO78340.1|  hypothetical protein CISIN_1g004125mg                 74.7    1e-12   Citrus sinensis [apfelsine]
ref|XP_006449786.1|  hypothetical protein CICLE_v10014589mg           75.1    2e-12   
gb|KDO78339.1|  hypothetical protein CISIN_1g004125mg                 75.1    2e-12   Citrus sinensis [apfelsine]
ref|XP_006449787.1|  hypothetical protein CICLE_v10014589mg           75.1    2e-12   
ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...  75.1    2e-12   Sesamum indicum [beniseed]
gb|EPS60017.1|  hypothetical protein M569_14787                       74.7    2e-12   Genlisea aurea
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...  74.7    2e-12   Citrus sinensis [apfelsine]
ref|XP_010921304.1|  PREDICTED: calcium permeable stress-gated ca...  73.9    4e-12   Elaeis guineensis
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...  73.9    5e-12   Elaeis guineensis
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...  73.2    8e-12   Solanum lycopersicum
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...  73.2    8e-12   Nicotiana tomentosiformis
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...  72.8    1e-11   Nicotiana sylvestris
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg           72.0    2e-11   Prunus persica
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...  72.4    2e-11   Populus euphratica
ref|XP_006843810.1|  hypothetical protein AMTR_s00007p00254340        71.6    3e-11   Amborella trichopoda
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620           71.6    3e-11   Nicotiana sylvestris
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...  71.6    3e-11   Phoenix dactylifera
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900           71.2    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...  70.9    5e-11   Prunus mume [ume]
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...  70.9    6e-11   Populus euphratica
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...  70.5    6e-11   
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...  70.5    6e-11   Prunus mume [ume]
emb|CDP04437.1|  unnamed protein product                              70.5    7e-11   Coffea canephora [robusta coffee]
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960           70.5    7e-11   Tarenaya hassleriana [spider flower]
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like        70.1    8e-11   
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620           70.1    8e-11   Nicotiana tomentosiformis
gb|EMS56195.1|  hypothetical protein TRIUR3_24213                     66.6    8e-11   Triticum urartu
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...  70.1    9e-11   Solanum tuberosum [potatoes]
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960           70.1    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010924082.1|  PREDICTED: calcium permeable stress-gated ca...  69.7    1e-10   Elaeis guineensis
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...  70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172660.5|  putative ERD4 protein                               70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg           70.1    1e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...  69.7    1e-10   Elaeis guineensis
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...  69.7    1e-10   
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226           69.7    1e-10   
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...  69.7    1e-10   
ref|XP_009404922.1|  PREDICTED: calcium permeable stress-gated ca...  69.7    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...  69.7    1e-10   Elaeis guineensis
ref|XP_009404947.1|  PREDICTED: calcium permeable stress-gated ca...  69.7    1e-10   
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...  69.7    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_010493595.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...  69.7    1e-10   
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960           69.7    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010090368.1|  Uncharacterized membrane protein                 69.7    1e-10   
ref|XP_010924083.1|  PREDICTED: protein OSCA1-like isoform X6         69.3    1e-10   
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg           69.3    1e-10   Capsella rubella
ref|XP_011014901.1|  PREDICTED: calcium permeable stress-gated ca...  69.3    2e-10   Populus euphratica
ref|XP_011046977.1|  PREDICTED: calcium permeable stress-gated ca...  69.3    2e-10   Populus euphratica
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620           69.3    2e-10   Solanum lycopersicum
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...  69.3    2e-10   Populus euphratica
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...  69.3    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...  69.3    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg           68.9    2e-10   Prunus persica
ref|XP_006383869.1|  hypothetical protein POPTR_0004s00750g           68.9    2e-10   
emb|CDY30043.1|  BnaC05g09770D                                        68.9    2e-10   Brassica napus [oilseed rape]
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960           68.9    2e-10   Brassica rapa
ref|XP_006850790.1|  hypothetical protein AMTR_s00025p00102970        68.9    2e-10   Amborella trichopoda
emb|CDX98089.1|  BnaA06g08400D                                        68.9    2e-10   
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg           68.9    2e-10   Prunus persica
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900           68.9    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...  68.6    2e-10   
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg              68.6    3e-10   Erythranthe guttata [common monkey flower]
gb|KDO54267.1|  hypothetical protein CISIN_1g018945mg                 66.2    3e-10   Citrus sinensis [apfelsine]
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...  68.2    4e-10   Cicer arietinum [garbanzo]
ref|XP_003610472.1|  Membrane protein, putative                       68.2    4e-10   Medicago truncatula
ref|XP_002518432.1|  conserved hypothetical protein                   68.2    4e-10   
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...  68.2    4e-10   Sesamum indicum [beniseed]
ref|XP_009395092.1|  PREDICTED: calcium permeable stress-gated ca...  67.8    5e-10   
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg              67.8    5e-10   Erythranthe guttata [common monkey flower]
ref|NP_001043256.1|  Os01g0534900                                     67.8    5e-10   
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900           67.8    5e-10   Eucalyptus grandis [rose gum]
ref|XP_010099166.1|  Uncharacterized membrane protein                 67.8    6e-10   Morus notabilis
ref|XP_007026163.1|  ERD (early-responsive to dehydration stress)...  67.4    6e-10   
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...  67.4    6e-10   Glycine max [soybeans]
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...  67.4    6e-10   Glycine max [soybeans]
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...  67.4    6e-10   Solanum tuberosum [potatoes]
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...  67.4    6e-10   
ref|XP_007026162.1|  ERD (early-responsive to dehydration stress)...  67.0    7e-10   
ref|XP_002533077.1|  conserved hypothetical protein                   67.4    7e-10   Ricinus communis
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...  67.0    8e-10   
gb|KDO54265.1|  hypothetical protein CISIN_1g018945mg                 65.5    8e-10   Citrus sinensis [apfelsine]
emb|CBI32349.3|  unnamed protein product                              67.0    8e-10   Vitis vinifera
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900           67.0    8e-10   Vitis vinifera
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...  67.0    9e-10   
dbj|BAD94445.1|  hypothetical protein                                 67.0    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...  67.0    9e-10   
dbj|BAK03311.1|  predicted protein                                    67.0    9e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g           67.0    9e-10   Phaseolus vulgaris [French bean]
gb|KJB69237.1|  hypothetical protein B456_011G012200                  66.6    1e-09   Gossypium raimondii
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...  67.0    1e-09   
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...  67.0    1e-09   Fragaria vesca subsp. vesca
gb|KDO54266.1|  hypothetical protein CISIN_1g018945mg                 65.9    1e-09   Citrus sinensis [apfelsine]
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...  66.6    1e-09   Brachypodium distachyon [annual false brome]
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1          66.6    1e-09   Malus domestica [apple tree]
gb|KJB69236.1|  hypothetical protein B456_011G012200                  66.6    1e-09   Gossypium raimondii
gb|KJB69239.1|  hypothetical protein B456_011G012200                  66.6    1e-09   Gossypium raimondii
gb|KJB57786.1|  hypothetical protein B456_009G181100                  66.6    1e-09   Gossypium raimondii
gb|EMT27455.1|  Putative membrane protein                             66.6    1e-09   
gb|KHG01808.1|  putative membrane C2G11.09                            66.6    1e-09   Gossypium arboreum [tree cotton]
ref|XP_002317144.2|  early-responsive to dehydration family protein   66.2    1e-09   
ref|XP_010278611.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  65.9    2e-09   
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  65.9    2e-09   
gb|KHG30770.1|  putative membrane C2G11.09                            65.9    2e-09   Gossypium arboreum [tree cotton]
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg           65.9    2e-09   Citrus clementina [clementine]
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  65.9    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_004145433.1|  PREDICTED: uncharacterized membrane protein ...  65.9    2e-09   Cucumis sativus [cucumbers]
ref|NP_001056508.1|  Os05g0594700                                     65.9    2e-09   
gb|EEE64912.1|  hypothetical protein OsJ_19772                        65.9    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004166876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.9    2e-09   
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...  65.9    2e-09   Setaria italica
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990        65.5    2e-09   Sorghum bicolor [broomcorn]
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...  65.5    2e-09   Cucumis melo [Oriental melon]
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...  65.5    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...  65.5    3e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO68802.1|  hypothetical protein CISIN_1g015063mg                 64.7    3e-09   Citrus sinensis [apfelsine]
ref|XP_004968885.1|  PREDICTED: uncharacterized membrane protein ...  65.5    3e-09   Setaria italica
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  65.1    3e-09   Nicotiana tomentosiformis
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...  65.1    3e-09   Nicotiana tomentosiformis
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...  65.1    3e-09   Oryza brachyantha
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...  65.1    4e-09   
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg           65.1    4e-09   Citrus clementina [clementine]
dbj|BAF98597.1|  CM0545.360.nc                                        64.7    4e-09   Lotus japonicus
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620           64.7    5e-09   Populus euphratica
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620           64.7    5e-09   Populus euphratica
ref|XP_002321139.1|  early-responsive to dehydration family protein   64.7    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010905258.1|  PREDICTED: protein OSCA1-like                    64.3    6e-09   Elaeis guineensis
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...  64.3    6e-09   Medicago truncatula
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like     64.3    7e-09   Cicer arietinum [garbanzo]
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900           64.3    7e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1          64.3    7e-09   
gb|KHN28986.1|  Putative membrane protein C2G11.09                    64.3    7e-09   Glycine soja [wild soybean]
ref|XP_003616997.1|  Transmembrane protein                            64.3    8e-09   Medicago truncatula
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...  64.3    8e-09   Glycine max [soybeans]
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900           63.9    8e-09   Fragaria vesca subsp. vesca
gb|AAM74515.1|  hv711N16.16                                           61.6    8e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010449935.1|  PREDICTED: CSC1-like protein At4g15430           61.2    8e-09   
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...  63.9    8e-09   Populus euphratica
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...  63.9    9e-09   Nicotiana sylvestris
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg              63.9    9e-09   Erythranthe guttata [common monkey flower]
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...  63.9    9e-09   
ref|XP_006383870.1|  early-responsive to dehydration family protein   63.9    9e-09   
gb|KJB69243.1|  hypothetical protein B456_011G012200                  63.5    1e-08   Gossypium raimondii
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...  63.5    1e-08   Cucumis melo [Oriental melon]
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770        63.5    1e-08   Sorghum bicolor [broomcorn]
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...  63.2    1e-08   Glycine max [soybeans]
ref|XP_006414511.1|  hypothetical protein EUTSA_v10024504mg           63.2    1e-08   
ref|XP_004158583.1|  PREDICTED: uncharacterized protein RSN1-like     63.2    1e-08   
ref|XP_004151944.1|  PREDICTED: uncharacterized protein RSN1-like     63.2    1e-08   Cucumis sativus [cucumbers]
gb|KHN38468.1|  Putative membrane protein C2G11.09                    63.2    1e-08   Glycine soja [wild soybean]
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                  63.2    1e-08   
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...  63.2    1e-08   Cicer arietinum [garbanzo]
ref|NP_001147493.1|  LOC100281102                                     63.2    2e-08   Zea mays [maize]
gb|KDP21496.1|  hypothetical protein JCGZ_21967                       63.2    2e-08   Jatropha curcas
gb|AFW81357.1|  HYP1 isoform 1                                        63.2    2e-08   
emb|CDY27443.1|  BnaC03g64830D                                        63.2    2e-08   Brassica napus [oilseed rape]
gb|EMT22148.1|  Putative membrane protein                             62.8    2e-08   
dbj|BAK05559.1|  predicted protein                                    62.8    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...  62.8    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g           62.8    2e-08   Phaseolus vulgaris [French bean]
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...  62.8    2e-08   Cucumis melo [Oriental melon]
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...  62.8    2e-08   Solanum tuberosum [potatoes]
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...  62.8    2e-08   
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...  62.8    2e-08   Cucumis melo [Oriental melon]
gb|EMS66710.1|  Uncharacterized membrane protein C2G11.09             62.8    2e-08   Triticum urartu
ref|XP_004164564.1|  PREDICTED: uncharacterized membrane protein ...  62.8    2e-08   
ref|XP_004136187.1|  PREDICTED: uncharacterized membrane protein ...  62.8    2e-08   Cucumis sativus [cucumbers]
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...  62.8    2e-08   Solanum tuberosum [potatoes]
gb|EPS71707.1|  hypothetical protein M569_03051                       62.4    2e-08   Genlisea aurea
emb|CDP11354.1|  unnamed protein product                              62.4    3e-08   Coffea canephora [robusta coffee]
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  62.4    3e-08   
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  62.4    3e-08   Solanum lycopersicum
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  62.4    3e-08   Brachypodium distachyon [annual false brome]
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  62.0    3e-08   
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900           62.0    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...  62.0    4e-08   Glycine max [soybeans]
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...  62.0    4e-08   Phoenix dactylifera
gb|KJB42871.1|  hypothetical protein B456_007G171500                  61.6    4e-08   Gossypium raimondii
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1  61.6    5e-08   Populus euphratica
gb|KJB42870.1|  hypothetical protein B456_007G171500                  61.6    5e-08   Gossypium raimondii
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...  61.6    5e-08   Populus euphratica
emb|CAB10322.1|  hypothetical protein                                 61.6    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  61.6    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  61.6    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  61.6    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  61.6    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346           61.6    6e-08   
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  61.6    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...  61.6    6e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  61.6    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  61.2    6e-08   Camelina sativa [gold-of-pleasure]
emb|CDX79125.1|  BnaA01g11920D                                        61.2    6e-08   
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...  61.2    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...  61.2    6e-08   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ96091.1|  predicted protein                                    61.2    6e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX82907.1|  BnaC01g13570D                                        61.2    7e-08   
gb|KHN19872.1|  Putative membrane protein C2G11.09                    61.2    7e-08   Glycine soja [wild soybean]
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430           61.2    7e-08   Brassica rapa
emb|CDY09064.1|  BnaC08g10180D                                        61.2    7e-08   Brassica napus [oilseed rape]
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...  61.2    7e-08   Brassica rapa
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...  61.2    7e-08   Glycine max [soybeans]
gb|KHG10946.1|  putative membrane C2G11.09                            60.8    9e-08   Gossypium arboreum [tree cotton]
gb|EMT11783.1|  Putative membrane protein                             60.8    9e-08   
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  60.8    1e-07   Brassica rapa
gb|EPS71959.1|  hypothetical protein M569_02795                       60.8    1e-07   Genlisea aurea
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...  60.8    1e-07   Oryza brachyantha
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09             60.8    1e-07   Triticum urartu
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  60.8    1e-07   Brassica rapa
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  60.8    1e-07   Brassica rapa
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...  60.5    1e-07   Solanum tuberosum [potatoes]
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620           60.5    1e-07   Eucalyptus grandis [rose gum]
ref|XP_009771290.1|  PREDICTED: CSC1-like protein At4g02900           60.5    1e-07   Nicotiana sylvestris
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900           60.5    1e-07   Nicotiana tomentosiformis
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg           60.5    1e-07   Capsella rubella
emb|CDY49293.1|  BnaC01g22480D                                        60.5    1e-07   Brassica napus [oilseed rape]
ref|XP_006854105.1|  hypothetical protein AMTR_s00048p00143150        60.5    1e-07   Amborella trichopoda
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...  60.5    1e-07   
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900           60.1    1e-07   Solanum lycopersicum
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658           60.1    2e-07   
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...  60.1    2e-07   Fragaria vesca subsp. vesca
emb|CDY22920.1|  BnaA01g18580D                                        60.1    2e-07   Brassica napus [oilseed rape]
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430           60.1    2e-07   Camelina sativa [gold-of-pleasure]
gb|KHG17938.1|  putative membrane C2G11.09                            60.1    2e-07   Gossypium arboreum [tree cotton]
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg           59.7    2e-07   Capsella rubella
emb|CAA18115.1|  putative protein                                     59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93792.1|  hypothetical protein                                 59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...  59.7    2e-07   
ref|NP_193943.2|  early-responsive to dehydration stress-related ...  59.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48898.1|  BnaA03g36370D                                        59.3    3e-07   Brassica napus [oilseed rape]
gb|EPS74192.1|  hypothetical protein M569_00556                       59.3    3e-07   Genlisea aurea
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900           59.3    3e-07   Brachypodium distachyon [annual false brome]
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620           59.3    3e-07   Brassica rapa
emb|CDY32438.1|  BnaC03g42220D                                        59.3    3e-07   Brassica napus [oilseed rape]
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg           59.3    3e-07   Capsella rubella
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090           58.9    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090           58.9    3e-07   Camelina sativa [gold-of-pleasure]
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                  58.9    3e-07   Arabis alpina [alpine rockcress]
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090           58.9    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...  58.5    5e-07   Camelina sativa [gold-of-pleasure]
gb|KJB10673.1|  hypothetical protein B456_001G215500                  58.5    5e-07   Gossypium raimondii
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340           58.5    5e-07   Brassica rapa
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg           58.5    5e-07   Prunus persica
emb|CDY21297.1|  BnaC03g29810D                                        58.5    5e-07   Brassica napus [oilseed rape]
emb|CDX90856.1|  BnaA03g25360D                                        58.5    5e-07   
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...  58.5    5e-07   
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g           58.5    5e-07   Phaseolus vulgaris [French bean]
ref|XP_002301612.2|  early-responsive to dehydration family protein   58.5    5e-07   
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620           58.5    6e-07   Populus euphratica
ref|XP_009765629.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  58.2    6e-07   Nicotiana sylvestris
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...  58.2    6e-07   
ref|NP_001055457.1|  Os05g0393800                                     58.2    6e-07   
gb|EAY97938.1|  hypothetical protein OsI_19855                        58.2    6e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like     58.2    6e-07   Setaria italica
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...  58.2    6e-07   
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1          58.2    6e-07   Prunus mume [ume]
ref|XP_011082546.1|  PREDICTED: CSC1-like protein At4g02900           58.2    6e-07   Sesamum indicum [beniseed]
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...  58.2    6e-07   Cicer arietinum [garbanzo]
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...  58.2    6e-07   
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620           58.2    6e-07   Camelina sativa [gold-of-pleasure]
gb|AFI41197.1|  dehydration stress protein                            58.2    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174489.1|  early-responsive to dehydration stress protein ...  58.2    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  58.2    7e-07   Camelina sativa [gold-of-pleasure]
gb|KDP30779.1|  hypothetical protein JCGZ_13722                       58.2    7e-07   Jatropha curcas
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392           58.2    7e-07   
emb|CDY19541.1|  BnaC09g13620D                                        58.2    7e-07   Brassica napus [oilseed rape]
ref|XP_002529341.1|  conserved hypothetical protein                   57.8    8e-07   
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010        57.8    8e-07   Sorghum bicolor [broomcorn]
emb|CDY12941.1|  BnaA09g13330D                                        57.8    8e-07   Brassica napus [oilseed rape]
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320           57.8    8e-07   Brassica rapa
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg           57.8    9e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg           57.8    9e-07   Eutrema salsugineum [saltwater cress]
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                  57.8    9e-07   
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...  57.8    1e-06   
ref|NP_188799.1|  early-responsive to dehydration stress-related ...  57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146108.1|  PREDICTED: uncharacterized membrane protein ...  57.4    1e-06   Cucumis sativus [cucumbers]
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620           57.0    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_010518924.1|  PREDICTED: CSC1-like protein At1g32090           57.0    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_002886475.1|  F24O1.4                                          57.0    1e-06   Arabidopsis lyrata subsp. lyrata
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320    57.0    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...  57.0    2e-06   
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg              57.0    2e-06   
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg           57.0    2e-06   
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312           56.6    2e-06   
ref|XP_006287198.1|  hypothetical protein CARUB_v10000374mg           56.6    2e-06   
emb|CDY29933.1|  BnaC05g29030D                                        56.6    2e-06   
emb|CDY35541.1|  BnaA05g16450D                                        56.6    2e-06   
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090           56.6    2e-06   
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  56.6    2e-06   
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  56.6    2e-06   
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  56.6    2e-06   
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  56.6    2e-06   
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...  56.6    2e-06   
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900           56.2    3e-06   
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900           56.2    3e-06   
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...  56.2    3e-06   
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090           56.2    3e-06   
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg           56.2    3e-06   
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1          56.2    3e-06   
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320           56.2    3e-06   
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320           56.2    3e-06   
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320           56.2    3e-06   
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg           55.8    3e-06   
gb|KHG01781.1|  putative membrane C2G11.09                            55.8    3e-06   
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900           55.8    3e-06   
emb|CDY17981.1|  BnaC03g30530D                                        55.8    3e-06   
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620           55.8    4e-06   
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...  55.5    4e-06   
ref|XP_010089460.1|  Uncharacterized membrane protein                 55.5    5e-06   
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...  55.5    5e-06   
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535           55.5    5e-06   
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg           55.1    6e-06   
emb|CDX76386.1|  BnaA08g10140D                                        55.1    7e-06   
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...  54.7    8e-06   
emb|CDX90914.1|  BnaA03g25940D                                        54.7    8e-06   
ref|XP_009409814.1|  PREDICTED: CSC1-like protein At1g32090           54.3    1e-05   
emb|CDY24365.1|  BnaA07g02900D                                        53.1    1e-05   
emb|CDY08641.1|  BnaC04g19500D                                        52.4    1e-05   
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...  53.9    2e-05   
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g           53.5    2e-05   
emb|CDP11733.1|  unnamed protein product                              53.5    2e-05   
emb|CDP11732.1|  unnamed protein product                              53.1    3e-05   
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg           53.1    3e-05   
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg           52.8    3e-05   
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09             52.8    3e-05   
ref|XP_008344855.1|  PREDICTED: uncharacterized protein LOC103407754  52.4    4e-05   
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  52.8    4e-05   
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  52.8    4e-05   
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090           52.4    4e-05   
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg              52.0    6e-05   
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...  52.0    7e-05   
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...  51.6    8e-05   
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                    51.6    8e-05   
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...  51.6    8e-05   
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090           51.6    9e-05   
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697           51.2    1e-04   
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like     51.2    1e-04   
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090           50.8    1e-04   
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090           50.8    1e-04   
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090           50.8    2e-04   
emb|CDP03600.1|  unnamed protein product                              50.4    2e-04   
ref|XP_008355138.1|  PREDICTED: uncharacterized protein LOC103418807  50.1    2e-04   
ref|XP_006396699.1|  hypothetical protein EUTSA_v10028449mg           50.4    2e-04   
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090           50.4    2e-04   
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg           50.4    2e-04   
ref|NP_192343.1|  early-responsive to dehydration stress-related ...  50.1    2e-04   
gb|AAL07154.1|  unknown protein                                       50.1    2e-04   
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like     50.1    2e-04   
gb|KHN40403.1|  Putative membrane protein C2G11.09                    50.1    2e-04   
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like     50.1    3e-04   
gb|EPS61005.1|  hypothetical protein M569_13796                       48.5    5e-04   
ref|XP_010110413.1|  Uncharacterized protein RSN1                     48.9    6e-04   
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177           48.9    6e-04   
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090           48.9    6e-04   
gb|KJB42059.1|  hypothetical protein B456_007G134700                  48.5    7e-04   
gb|KJB42062.1|  hypothetical protein B456_007G134700                  48.5    8e-04   
gb|KJB42060.1|  hypothetical protein B456_007G134700                  48.5    8e-04   
gb|KDP46674.1|  hypothetical protein JCGZ_12198                       48.5    8e-04   
gb|KHG26829.1|  putative membrane C2G11.09                            48.5    0.001   
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900           48.5    0.001   



>gb|KDO78340.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
 gb|KDO78341.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=505

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIG++AA+NIL A IFL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +
Sbjct  1    MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFV  58



>ref|XP_006449786.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63026.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=618

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIG++AA+NIL A +FL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +
Sbjct  1    MATLADIGVSAALNILGAFVFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFV  58



>gb|KDO78339.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=677

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIG++AA+NIL A IFL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +
Sbjct  1    MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFV  58



>ref|XP_006449787.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63027.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=634

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIG++AA+NIL A +FL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +
Sbjct  1    MATLADIGVSAALNILGAFVFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFV  58



>ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=775

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MATFADIG+AA INIL A+ FLVAFAI+RLQP+NDRVYFPKWYLKGLR SP HSG+ +
Sbjct  1    MATFADIGVAAGINILFAVAFLVAFAILRLQPINDRVYFPKWYLKGLRSSPMHSGSFV  58



>gb|EPS60017.1| hypothetical protein M569_14787, partial [Genlisea aurea]
Length=762

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MATF+DIG+AA +NILTAL+FL+AFAI+RLQP+NDRVYFPKWYLKGLR SP+HSGA +
Sbjct  1    MATFSDIGVAAGVNILTALVFLIAFAILRLQPLNDRVYFPKWYLKGLRGSPSHSGAFV  58



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIG++AA+NIL A IFL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +
Sbjct  1    MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFV  58



>ref|XP_010921304.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X2 [Elaeis guineensis]
Length=682

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIG+AAAINIL+A  FL+AFAI+RLQP+NDRVYFPKWYLKG+R SPTHSGA +
Sbjct  1    MATLADIGVAAAINILSAFAFLLAFAILRLQPINDRVYFPKWYLKGVRSSPTHSGAFV  58



>ref|XP_010921296.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X1 [Elaeis guineensis]
Length=760

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIG+AAAINIL+A  FL+AFAI+RLQP+NDRVYFPKWYLKG+R SPTHSGA +
Sbjct  1    MATLADIGVAAAINILSAFAFLLAFAILRLQPINDRVYFPKWYLKGVRSSPTHSGAFV  58



>ref|XP_004232686.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316569.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316570.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=767

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGLAAAINI++ALIFLVAFAI+RLQP NDRVYFPKWYLKGLR SPTHSGA +
Sbjct  1    MATLGDIGLAAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTHSGAFV  58



>ref|XP_009613689.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=767

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGL+AAINI++ALIFLVAFAI+RLQP NDRVYFPKWYLKGLR SPTHSGA +
Sbjct  1    MATLGDIGLSAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTHSGAFV  58



>ref|XP_009772257.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=767

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGL+AAINI++ALIFLVAFAI+RLQP NDRVYFPKWYLKGLR SPTHSGA +
Sbjct  1    MATLQDIGLSAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTHSGAFV  58



>ref|XP_007211353.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
 gb|EMJ12552.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
Length=773

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT AD+G+ AAINIL+A +F V FAI+RLQP NDRVYFPKWY KGLR+SPTHSGA +
Sbjct  1    MATLADLGVGAAINILSAFLFFVVFAILRLQPFNDRVYFPKWYFKGLRESPTHSGAFV  58



>ref|XP_011046984.1| PREDICTED: uncharacterized protein LOC105141455 isoform X1 [Populus 
euphratica]
Length=1759

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP+NDRVYFPKWYLKG+R SP  SGAL+
Sbjct  1    MATLADITVSGAINVLSAFIFLLAFAILRLQPLNDRVYFPKWYLKGVRGSPLRSGALV  58



>ref|XP_006843810.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AA+NIL A  FL+AFAI+RLQP+NDRVYFPKWYLKGLR SPTHSG  +
Sbjct  1    MATLRDIGVSAAVNILMAFAFLLAFAILRLQPINDRVYFPKWYLKGLRSSPTHSGVFV  58



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AAAINIL+A +FL+AFAI+R+QPVNDRVYFPKWYLKGLR SP HSG ++
Sbjct  1    MATLSDIGVAAAINILSACVFLIAFAILRIQPVNDRVYFPKWYLKGLRSSPLHSGTIV  58



>ref|XP_008799225.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Phoenix dactylifera]
Length=762

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AAAINIL+A  FL+AFAI+RLQP+NDRVYFPKWYLKG+R SPTHSG  +
Sbjct  1    MATLSDIGVAAAINILSAFTFLLAFAILRLQPINDRVYFPKWYLKGVRSSPTHSGTFV  58



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DIG++AAIN+L+A  FLVAFAI+RLQP NDRVYFPKWYL+G+R SPTHSGAL+
Sbjct  1    MASLQDIGVSAAINLLSAFAFLVAFAILRLQPFNDRVYFPKWYLRGIRSSPTHSGALV  58



>ref|XP_008224710.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Prunus 
mume]
Length=773

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  D+G+ AAINIL+A +F V FAI+RLQP NDRVYFPKWY KGLR+SPTHSGA +
Sbjct  1    MATLGDLGVGAAINILSAFLFFVVFAILRLQPFNDRVYFPKWYFKGLRESPTHSGAFV  58



>ref|XP_011046985.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=1186

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP+NDRVYFPKWYLKG+R SP  SGAL+
Sbjct  1    MATLADITVSGAINVLSAFIFLLAFAILRLQPLNDRVYFPKWYLKGVRGSPLRSGALV  58



>ref|XP_008234908.1| PREDICTED: uncharacterized protein RSN1 isoform X2 [Prunus mume]
Length=749

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI ++AAINIL+AL FLVAFA+IRLQP NDRVYFPKWYLKG+R SPT SGAL+
Sbjct  1    MATLQDIAVSAAINILSALGFLVAFALIRLQPFNDRVYFPKWYLKGIRGSPTSSGALV  58



>ref|XP_008234907.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Prunus mume]
Length=756

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI ++AAINIL+AL FLVAFA+IRLQP NDRVYFPKWYLKG+R SPT SGAL+
Sbjct  1    MATLQDIAVSAAINILSALGFLVAFALIRLQPFNDRVYFPKWYLKGIRGSPTSSGALV  58



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  D+GL+AAINIL+AL+FLVAFAI+RLQP NDRVYFPKWYLKGLR SPT SGA +
Sbjct  1    MATLGDMGLSAAINILSALVFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPTRSGAFV  58



>ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546613.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546622.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546631.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
Length=776

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AAAINIL+A IFL+AFAI+R+QP NDRVYFPKWYLKGLR SP HSGAL+
Sbjct  1    MATLGDIGVAAAINILSAFIFLLAFAILRIQPFNDRVYFPKWYLKGLRSSPLHSGALV  58



>ref|XP_008371060.1| PREDICTED: transmembrane protein 63B-like [Malus domestica]
Length=772

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  D+G+AA INIL+ALIF + FA +RLQP NDRVYFPKWYLKGLR+SPTHSGA +
Sbjct  1    MATLGDLGVAAGINILSALIFFIVFAFLRLQPFNDRVYFPKWYLKGLRESPTHSGAFV  58



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+ +DIG+AAAINIL+A IFL+AFAI+R+QPVNDRVYFPKWYLKGLR SP HSG ++
Sbjct  1    MASLSDIGVAAAINILSACIFLIAFAILRIQPVNDRVYFPKWYLKGLRSSPLHSGTIV  58



>gb|EMS56195.1| hypothetical protein TRIUR3_24213 [Triticum urartu]
Length=139

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+A+IFL+AFA +RLQP+NDRVYFPKWYLKG R SP+H GA +
Sbjct  1    MATIEDIGVSAAINILSAVIFLLAFAFLRLQPINDRVYFPKWYLKGSRQSPSHGGAFV  58



>ref|XP_006348153.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
Length=767

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGLAAAINI++ALIFLVAFAI+RLQP NDRVYFPKWYLKGLR SPT SGA +
Sbjct  1    MATLGDIGLAAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTRSGAFV  58



>ref|XP_010458617.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLGDIGVAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_010924082.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X5 [Elaeis guineensis]
Length=688

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFV  58



>gb|AAC17615.1| Similar to hypothetical protein HYP1 gb|Z97338 from A. thaliana 
[Arabidopsis thaliana]
Length=783

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AAAINILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLGDIGVAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|NP_172660.5| putative ERD4 protein [Arabidopsis thaliana]
 sp|B5TYT3.1|CSCL7_ARATH RecName: Full=CSC1-like protein At1g11960 [Arabidopsis thaliana]
 gb|ACI01072.1| putative membrane protein [Arabidopsis thaliana]
 gb|AEE28821.1| putative ERD4 protein [Arabidopsis thaliana]
 gb|AIU34615.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Arabidopsis 
thaliana]
Length=771

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AAAINILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLGDIGVAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_006417282.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
 gb|ESQ35635.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
Length=770

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLGDIGVAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_010924081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X4 [Elaeis guineensis]
Length=726

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFV  58



>ref|XP_010924080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X3 [Elaeis guineensis]
Length=732

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFV  58



>ref|XP_002892667.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68926.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLEDIGVAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_010924079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Elaeis guineensis]
Length=745

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFV  58



>ref|XP_009404922.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404937.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=768

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGLAAAINIL A+ FLVAFAI+RLQP+NDRVYFPKWYLKG+R SPT SGA +
Sbjct  1    MATLTDIGLAAAINILVAIAFLVAFAILRLQPINDRVYFPKWYLKGVRSSPTCSGAFV  58



>ref|XP_010924075.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924076.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924077.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
Length=766

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFV  58



>ref|XP_009404947.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=718

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGLAAAINIL A+ FLVAFAI+RLQP+NDRVYFPKWYLKG+R SPT SGA +
Sbjct  1    MATLTDIGLAAAINILVAIAFLVAFAILRLQPINDRVYFPKWYLKGVRSSPTCSGAFV  58



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  D+G+ A INIL+ALIF + FA +RLQP+NDRVYFPKWYLKGLR+SPTHSGA +
Sbjct  1    MATLGDLGVGAGINILSALIFFLVFAFLRLQPLNDRVYFPKWYLKGLRESPTHSGAFV  58



>ref|XP_010493595.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein At1g11960 [Camelina 
sativa]
Length=779

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGLAA INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLGDIGLAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_010476146.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGLAAAINILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLGDIGLAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_010090368.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB39338.1| Uncharacterized membrane protein [Morus notabilis]
Length=878

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  D+ ++AAINIL+A  FLVAFA++RLQP+NDRVYFPKWYLKG+R SPT SGAL+
Sbjct  1    MASLQDVSMSAAINILSAFAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPTRSGALV  58



>ref|XP_010924083.1| PREDICTED: protein OSCA1-like isoform X6 [Elaeis guineensis]
Length=684

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFV  58



>ref|XP_006306821.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
 gb|EOA39719.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
Length=771

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA+INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLEDIGVAASINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_011014901.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA +
Sbjct  1    MATLADIAVSGAINLLSAFIFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGAFV  58



>ref|XP_011046977.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046978.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP+NDRVYFPKWYLKG+R SP  SGAL+
Sbjct  1    MATLADITVSGAINVLSAFIFLLAFAILRLQPLNDRVYFPKWYLKGVRGSPLRSGALV  58



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AAAINIL+A IFL+AFA +R+QPVNDRVYFPKWYLKGLR SP HSG ++
Sbjct  1    MATLSDIGVAAAINILSACIFLIAFAFLRIQPVNDRVYFPKWYLKGLRGSPLHSGTIV  58



>ref|XP_011046975.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046976.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA +
Sbjct  1    MATLADIAVSGAINLLSAFIFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGAFV  58



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGLAAAINIL+A+ FL+AFAI+RLQP NDRVYFPKWYLKGLR SP+H GA +
Sbjct  1    MATLGDIGLAAAINILSAVAFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSHVGAFV  58



>ref|XP_009357605.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Pyrus 
x bretschneideri]
Length=771

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  D+G+ A INIL+AL+F + FA +RLQP NDRVYFPKWYLKGLR+SPTHSGA +
Sbjct  1    MATLGDLGVGAGINILSALVFFLVFAFLRLQPFNDRVYFPKWYLKGLRESPTHSGAFV  58



>ref|XP_007200309.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
 gb|EMJ01508.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
Length=756

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI ++AAINIL+AL FLVAFA+IRLQP NDRVYFPKWYLKG+R SPT SGA +
Sbjct  1    MATLQDISVSAAINILSALGFLVAFALIRLQPFNDRVYFPKWYLKGIRGSPTSSGAFV  58



>ref|XP_006383869.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
 gb|ERP61666.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
Length=802

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP NDRVYFPKWYLKG+R SP+ SGAL+
Sbjct  1    MATLADIAVSGAINLLSAFIFLLAFAILRLQPFNDRVYFPKWYLKGVRGSPSRSGALV  58



>emb|CDY30043.1| BnaC05g09770D [Brassica napus]
Length=768

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INI+TA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLGDIGVAATINIITAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_009148626.1| PREDICTED: CSC1-like protein At1g11960 [Brassica rapa]
Length=768

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INI+TA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLGDIGVAATINIITAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_006850790.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG++ +IN  TAL FL+AFAI+RLQP NDRVYFPKWYLKGLR SP HSG ++
Sbjct  1    MATTSDIGVSLSINFPTALAFLIAFAILRLQPFNDRVYFPKWYLKGLRSSPRHSGTIV  58



>emb|CDX98089.1| BnaA06g08400D [Brassica napus]
Length=768

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INI+TA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+
Sbjct  1    MATLGDIGVAATINIITAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALV  58



>ref|XP_007217157.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
 gb|EMJ18356.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
Length=769

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI +AAAINILTA  F VAFAI+R+QPVNDRVYFPKWY+KGLR SP+  GAL+
Sbjct  1    MATLNDIAVAAAINILTACAFFVAFAILRIQPVNDRVYFPKWYIKGLRSSPSSGGALV  58



>ref|XP_009393118.1| PREDICTED: CSC1-like protein At4g02900 [Musa acuminata subsp. 
malaccensis]
Length=758

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+ ADIG++AA+NIL+ALIFL+ FA++RLQP NDRVYFPKWYLKG+R SPTHSG  +
Sbjct  1    MASLADIGMSAALNILSALIFLIVFAVLRLQPYNDRVYFPKWYLKGIRSSPTHSGNFI  58



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI +AAAINILTA  F VAFAI+R+QPVNDRVYFPKWY+KGLR SP+  GAL+
Sbjct  1    MATLNDIAVAAAINILTACAFFVAFAILRIQPVNDRVYFPKWYIKGLRSSPSSGGALV  58



>gb|EYU27725.1| hypothetical protein MIMGU_mgv1a001730mg [Erythranthe guttata]
Length=768

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MA F DIGLAA +NIL+ALIFL+AFAI+RLQP NDRVYFPKWYLKGLR SPT SGA 
Sbjct  1    MADFRDIGLAAGVNILSALIFLIAFAILRLQPFNDRVYFPKWYLKGLRTSPTQSGAF  57



>gb|KDO54267.1| hypothetical protein CISIN_1g018945mg [Citrus sinensis]
Length=272

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INIL+A  FL AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G L+
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLV  58



>ref|XP_004507664.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=773

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIGLAA INIL+A IF VAFAI+RLQP+NDRVYFPKWYLKGLR  P H GA +
Sbjct  1    MATLSDIGLAAGINILSAFIFFVAFAILRLQPLNDRVYFPKWYLKGLRTDPVHGGAFV  58



>ref|XP_003610472.1| Membrane protein, putative [Medicago truncatula]
 ref|XP_003619262.1| Membrane protein, putative [Medicago truncatula]
 gb|AES92669.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=774

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA  ADI LAA INIL+A IF VAFAI+RLQP+NDRVYFPKWYLKGLR  P H GA +
Sbjct  1    MAKLADISLAAGINILSAFIFFVAFAILRLQPLNDRVYFPKWYLKGLRTDPVHGGAFM  58



>ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43819.1| conserved hypothetical protein [Ricinus communis]
Length=773

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAIN+LTA IFL+AFAI+RLQP NDRVYFPKWYLKG+R SPT SGA +
Sbjct  1    MATLGDIGVSAAINLLTAFIFLLAFAILRLQPFNDRVYFPKWYLKGIRSSPTRSGAFV  58



>ref|XP_011095994.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=769

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MATF DIGLAA +NIL+AL+FLVAFAI+RLQP NDRVYFPKWYLKGLR +P  SG  +
Sbjct  1    MATFGDIGLAAGVNILSALVFLVAFAILRLQPFNDRVYFPKWYLKGLRSNPAQSGVFV  58



>ref|XP_009395092.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395094.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395095.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGLAAAINIL+A+ FL+AFA++RLQP+NDRVYFPKWYLKG+R SPT SG  +
Sbjct  1    MATLTDIGLAAAINILSAVAFLIAFAVLRLQPINDRVYFPKWYLKGVRGSPTRSGTFV  58



>gb|EYU33878.1| hypothetical protein MIMGU_mgv1a018274mg [Erythranthe guttata]
Length=770

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MATF DIG+AA +NIL A+ FL+AFA +RLQP+NDRVYFPKWYLKGLR SP ++G+++
Sbjct  1    MATFGDIGVAAGLNILFAVAFLIAFAFLRLQPINDRVYFPKWYLKGLRSSPVNAGSVV  58



>ref|NP_001043256.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAD87679.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF05170.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAG96168.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70822.1| hypothetical protein OsI_02298 [Oryza sativa Indica Group]
 gb|EEE54743.1| hypothetical protein OsJ_02101 [Oryza sativa Japonica Group]
 gb|AIU34628.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Oryza sativa]
Length=768

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+A+ FL+AFA +RLQP+NDRVYFPKWYLKG R+SP+H GA +
Sbjct  1    MATIQDIGVSAAINILSAITFLLAFAFLRLQPINDRVYFPKWYLKGARESPSHGGAFV  58



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MA+  DI ++AAINIL+A+ FLVAFAI+RLQP+NDRVYFPKWYLKG+R SPT SG  
Sbjct  1    MASLQDISVSAAINILSAIAFLVAFAILRLQPINDRVYFPKWYLKGIRGSPTRSGGF  57



>ref|XP_010099166.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB77038.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINI TA IFL+AFA++RLQP NDRVYFPKWYLKGLR+SP+ SGA +
Sbjct  1    MATLGDIGVSAAINIFTAFIFLLAFAVLRLQPFNDRVYFPKWYLKGLRNSPSRSGAFV  58



>ref|XP_007026163.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
 gb|EOY28785.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
Length=521

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA IN+L+A++F +AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA +
Sbjct  1    MATLGDIGVAAGINLLSAVVFFLAFAILRLQPFNDRVYFPKWYLKGLRSSPSGSGAFV  58



>ref|XP_003549667.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Glycine max]
 ref|XP_006600300.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Glycine max]
 gb|KHN03500.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=775

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AA +NIL+A IF VAFAI+RLQP NDRVYFPKWYLKGLR  P H GA +
Sbjct  1    MATLSDIGVAAGLNILSAFIFFVAFAILRLQPFNDRVYFPKWYLKGLRTDPVHGGAFV  58



>ref|XP_003529649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Glycine max]
 ref|XP_006584087.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
 gb|KHN35714.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=777

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AA +NIL+A IF VAFAI+RLQP NDRVYFPKWYLKGLR  P H GA +
Sbjct  1    MATLSDIGVAAGLNILSAFIFFVAFAILRLQPFNDRVYFPKWYLKGLRTDPVHGGAFV  58



>ref|XP_006363038.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363039.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006363040.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Solanum 
tuberosum]
Length=768

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AAAINIL+A IFL+AFA +R+QPVNDRVYFPKWYL GLR SP HSG ++
Sbjct  1    MATLTDIGVAAAINILSACIFLIAFAFLRIQPVNDRVYFPKWYLNGLRSSPLHSGTIV  58



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI LAAAINIL+A IF +AFA++R+QP NDRVYFPKWYLKGLR SPT SGA +
Sbjct  1    MATLQDIALAAAINILSACIFFLAFAVLRIQPFNDRVYFPKWYLKGLRSSPTRSGAFV  58



>ref|XP_007026162.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
 gb|EOY28784.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
Length=618

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA IN+L+A++F +AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA +
Sbjct  1    MATLGDIGVAAGINLLSAVVFFLAFAILRLQPFNDRVYFPKWYLKGLRSSPSGSGAFV  58



>ref|XP_002533077.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29316.1| conserved hypothetical protein [Ricinus communis]
Length=756

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA   DIG +AA+N+L+A+ FL+AFAI+RLQP+NDRVYFPKWYLKG+R SPTHS A +
Sbjct  1    MANLQDIGYSAAVNLLSAIAFLIAFAILRLQPINDRVYFPKWYLKGIRASPTHSRAFV  58



>ref|XP_007050676.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX94833.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=751

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI ++AAIN+L+A  FLVAFAI+RLQP+NDRV+FPKWY KG+R SPT SGA +
Sbjct  1    MATLQDITVSAAINLLSAFAFLVAFAILRLQPINDRVFFPKWYRKGIRSSPTRSGAFV  58



>gb|KDO54265.1| hypothetical protein CISIN_1g018945mg [Citrus sinensis]
Length=305

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INIL+A  FL AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G L+
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLV  58



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI +AA INIL+AL FLVAFAI+RLQP NDRVYFPKWYLKG+R SP  SGA +
Sbjct  1    MATLQDISVAATINILSALAFLVAFAILRLQPFNDRVYFPKWYLKGIRGSPRRSGAFV  58



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI +AA INIL+AL FLVAFAI+RLQP NDRVYFPKWYLKG+R SP  SGA +
Sbjct  1    MATLQDISVAATINILSALAFLVAFAILRLQPFNDRVYFPKWYLKGIRGSPRRSGAFV  58



>ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
Length=771

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA IN+L+A++F +AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA +
Sbjct  1    MATLGDIGVAAGINLLSAVVFFLAFAILRLQPFNDRVYFPKWYLKGLRSSPSGSGAFV  58



>dbj|BAD94445.1| hypothetical protein [Arabidopsis thaliana]
Length=756

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AA INILT   F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G  
Sbjct  1    MATLTDIGVAATINILTVFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGF  57



>ref|XP_008673458.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
Length=768

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGL+AAINI+ A++FLVAFA +RLQP+NDRVYFPKWYLKG R+SP+H G  +
Sbjct  1    MATIQDIGLSAAINIMGAVVFLVAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFV  58



>dbj|BAK03311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+A+IFL+AFA +RLQP+NDRVYFPKWYLKG R SP+H GA +
Sbjct  1    MATIQDIGVSAAINILSAVIFLLAFAFLRLQPINDRVYFPKWYLKGTRQSPSHGGAFV  58



>ref|XP_007153987.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
 gb|ESW25981.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
Length=774

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA +NIL+A IF VAFAI+RLQP NDRVYFPKWYLKGLR  P H GA +
Sbjct  1    MATLEDIGVAAGLNILSAFIFFVAFAILRLQPFNDRVYFPKWYLKGLRTDPVHGGAFV  58



>gb|KJB69237.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=612

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AAA N+L+A +F +AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFV  58



>ref|XP_008675529.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008675530.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 tpg|DAA59084.1| TPA: hypothetical protein ZEAMMB73_475653 [Zea mays]
Length=768

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGL+AAINI+ A++FLVAFA +RLQP+NDRVYFPKWYLKG R+SP+H G  +
Sbjct  1    MATIQDIGLSAAINIMGAVLFLVAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFV  58



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+F DIG+ AAINIL+A +F + FAI+RLQP+NDRVYFPKWY KG+RDSPT SG  +
Sbjct  1    MASFRDIGVGAAINILSAFVFFIVFAILRLQPLNDRVYFPKWYFKGVRDSPTRSGTFV  58



>gb|KDO54266.1| hypothetical protein CISIN_1g018945mg [Citrus sinensis]
Length=348

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INIL+A  FL AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G L+
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLV  58



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+A+IFL+AFA +RLQP+NDRVYFPKWYLKG R SP+H GA +
Sbjct  1    MATIEDIGVSAAINILSAIIFLLAFAFLRLQPINDRVYFPKWYLKGARQSPSHGGAFV  58



>ref|XP_008386531.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=757

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA F DI ++AAINIL+A  FLVAF ++RLQP NDRVYFPKWYLKG+R SPT SGA
Sbjct  1    MANFQDIMMSAAINILSAFGFLVAFGLLRLQPFNDRVYFPKWYLKGMRGSPTSSGA  56



>gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AAA N+L+A +F +AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFV  58



>gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AAA N+L+A +F +AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFV  58



>gb|KJB57786.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
 gb|KJB57787.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
Length=770

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AA IN+L+A +FL+AFAI+RLQP NDRVYFPKWYLKGLR SP+ SG  +
Sbjct  1    MATLSDIGVAAGINLLSAFVFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGTFV  58



>gb|EMT27455.1| Putative membrane protein [Aegilops tauschii]
Length=816

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+A+IFL+AFA +RLQP+NDRVYFPKWYLKG R SP+H GA +
Sbjct  1    MATIEDIGVSAAINILSAVIFLLAFAFLRLQPINDRVYFPKWYLKGSRQSPSHGGAFV  58



>gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=772

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AAA N+L+A +F +AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFV  58



>ref|XP_002317144.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE97756.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=744

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MAT  DI ++ A+N+L A IFL+AFAI+R+QP NDRVYFPKWYLKGLR S +HSGA
Sbjct  1    MATLGDIAVSGALNLLGAFIFLLAFAILRIQPFNDRVYFPKWYLKGLRSSASHSGA  56



>ref|XP_010278611.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Nelumbo nucifera]
Length=607

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT ADI ++A IN+L+A+ FLVAFA++RLQP NDRVYFPKWYLKG+R  P  SGA 
Sbjct  1    MATLADIVVSAVINLLSAIAFLVAFALLRLQPFNDRVYFPKWYLKGMRSRPNCSGAF  57



>ref|XP_010278603.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nelumbo nucifera]
Length=709

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT ADI ++A IN+L+A+ FLVAFA++RLQP NDRVYFPKWYLKG+R  P  SGA 
Sbjct  1    MATLADIVVSAVINLLSAIAFLVAFALLRLQPFNDRVYFPKWYLKGMRSRPNCSGAF  57



>gb|KHG30770.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=770

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA IN+L+A +FL+AFAI+RLQP NDRVYFPKWYLKGLR SP+ SG  +
Sbjct  1    MATLGDIGVAAGINLLSAFVFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGTFV  58



>ref|XP_006447609.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
 ref|XP_006469643.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469644.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 gb|ESR60849.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
Length=759

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AA INIL+A  FL AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G L+
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLV  58



>ref|XP_010278586.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
 ref|XP_010278595.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
Length=756

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT ADI ++A IN+L+A+ FLVAFA++RLQP NDRVYFPKWYLKG+R  P  SGA 
Sbjct  1    MATLADIVVSAVINLLSAIAFLVAFALLRLQPFNDRVYFPKWYLKGMRSRPNCSGAF  57



>ref|XP_004145433.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN66856.1| hypothetical protein Csa_1G701320 [Cucumis sativus]
Length=773

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+ALIFL+ FA++RLQP NDRVYF KWYLKGLR SPTH+GA +
Sbjct  1    MATLQDIGVSAAINILSALIFLLVFAVLRLQPFNDRVYFSKWYLKGLRSSPTHAGAFV  58



>ref|NP_001056508.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|AAV59379.1| putative early-responsive to dehydration stress protein (ERD4) 
[Oryza sativa Japonica Group]
 dbj|BAF18422.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|EAY99267.1| hypothetical protein OsI_21231 [Oryza sativa Indica Group]
 dbj|BAG93571.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34629.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Oryza sativa]
Length=766

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MAT +DIGL+AAIN+  A+ FL+ FA +RLQP+NDRVYFPKWYL+G+RDSP  SGA
Sbjct  1    MATVSDIGLSAAINVSMAVAFLLVFAFLRLQPINDRVYFPKWYLRGMRDSPVSSGA  56



>gb|EEE64912.1| hypothetical protein OsJ_19772 [Oryza sativa Japonica Group]
Length=893

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MAT +DIGL+AAIN+  A+ FL+ FA +RLQP+NDRVYFPKWYL+G+RDSP  SGA
Sbjct  1    MATVSDIGLSAAINVSMAVAFLLVFAFLRLQPINDRVYFPKWYLRGMRDSPVSSGA  56



>ref|XP_004166876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=773

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+ALIFL+ FA++RLQP NDRVYF KWYLKGLR SPTH+GA +
Sbjct  1    MATLQDIGVSAAINILSALIFLLXFAVLRLQPFNDRVYFSKWYLKGLRSSPTHAGAFV  58



>ref|XP_004960982.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MAT +DIGL+AA N+LTA+ FL+AFA +RLQP+NDRVYFPKWYL+G+RD+P  SGA
Sbjct  1    MATISDIGLSAAFNVLTAIAFLLAFAFLRLQPINDRVYFPKWYLRGMRDNPISSGA  56



>ref|XP_002457968.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
 gb|EES03088.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
Length=768

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGL+AAINIL A++FL+AFA +RLQP+NDRVYFPKWYLKG R+SP+H G  +
Sbjct  1    MATIQDIGLSAAINILGAVVFLLAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFV  58



>ref|XP_008459005.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
 ref|XP_008459006.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
Length=773

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINILTA IFL+ FA++RLQP NDRVYF KWYLKGLR SPTH+GA +
Sbjct  1    MATLQDIGVSAAINILTAFIFLLVFAVLRLQPFNDRVYFSKWYLKGLRSSPTHAGAFV  58



>ref|XP_009396325.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGLAAAIN+L+AL+FLVAFA++RLQP+NDRVYF KWYLKG R SP HSG  +
Sbjct  1    MATITDIGLAAAINLLSALVFLVAFAVLRLQPINDRVYFSKWYLKGARSSPNHSGTFV  58



>ref|XP_010686787.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010686788.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
Length=764

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+ +DI  +A  N+L+A +FL+AFA++R+QP NDRVYFPKWYLKGLR SP H+GA +
Sbjct  1    MASLSDIAFSAGFNLLSAFVFLLAFALLRIQPFNDRVYFPKWYLKGLRSSPLHTGAFV  58



>gb|KDO68802.1| hypothetical protein CISIN_1g015063mg [Citrus sinensis]
Length=414

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MA   DIG++AAIN+L+A  FLV FAI+R+QPVNDRVYFPKWY KG+R SPTHSG  
Sbjct  1    MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTF  57



>ref|XP_004968885.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIGL+AAINIL A+IFL+AFA +RLQP+NDRVYFPKWYLKG R+SP+H G  +
Sbjct  1    MATIKDIGLSAAINILGAIIFLLAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFV  58



>ref|XP_009601331.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
tomentosiformis]
Length=755

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DI ++A IN+L+AL+FL+AFAI+RLQP+NDRVYFPKWYLKG+R SP  SGA +
Sbjct  1    MASVQDISVSAVINLLSALVFLLAFAIVRLQPINDRVYFPKWYLKGIRASPRSSGAFV  58



>ref|XP_009619499.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009619500.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=768

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+A IFL+AFAI+RLQP+NDRVYFPKWYLKGLR+S T  GA +
Sbjct  1    MATLGDIGVSAAINILSAFIFLLAFAILRLQPLNDRVYFPKWYLKGLRNSVTQPGAFV  58



>ref|XP_006644293.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006644294.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Oryza brachyantha]
Length=769

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA   DIGL+AAINIL+A+ FL+AFA +RLQP+NDRVYFPKWYLKG R+SP+H GA +
Sbjct  1    MANIQDIGLSAAINILSAITFLLAFAFLRLQPINDRVYFPKWYLKGSRESPSHGGAFV  58



>ref|XP_006479762.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
Length=760

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MA   DIG++AAIN+L+A  FLV FAI+R+QPVNDRVYFPKWY KG+R SPTHSG  
Sbjct  1    MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTF  57



>ref|XP_006444131.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
 ref|XP_006479761.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 gb|ESR57371.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
Length=760

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MA   DIG++AAIN+L+A  FLV FAI+R+QPVNDRVYFPKWY KG+R SPTHSG  
Sbjct  1    MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTF  57



>dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus]
Length=755

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DIGLAAAINILTA  FL+AFA++R+QP+NDRVYFPKWYLKGLR SP   GA +
Sbjct  1    MASLGDIGLAAAINILTAFAFLIAFAVLRIQPINDRVYFPKWYLKGLRSSPLQGGAFV  58



>ref|XP_011016279.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016280.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016281.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AAAINILTA  F + FAI+R+QPVNDRVYFPKWY+KGLR SP  +GA +
Sbjct  1    MATISDIGVAAAINILTAFAFFIVFAILRIQPVNDRVYFPKWYIKGLRSSPLGTGAFV  58



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AAAINILTA  F + FAI+R+QPVNDRVYFPKWY+KGLR SP  +GA +
Sbjct  1    MATISDIGVAAAINILTAFAFFIVFAILRIQPVNDRVYFPKWYIKGLRSSPLGTGAFV  58



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AAAINILTA  F + FAI+R+QPVNDRVYFPKWY+KGLR SP  +GA +
Sbjct  1    MATISDIGVAAAINILTAFAFFIVFAILRIQPVNDRVYFPKWYIKGLRSSPLGTGAFV  58



>ref|XP_010905258.1| PREDICTED: protein OSCA1-like [Elaeis guineensis]
Length=682

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MA+  DI L+A INIL+A +F VAFAI+RLQP NDRVYFPKW+LKG+R SP HSG
Sbjct  1    MASLQDIALSAFINILSAFVFFVAFAILRLQPFNDRVYFPKWHLKGIRSSPRHSG  55



>gb|KEH23730.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=764

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++A IN+ +A +FL+AFA++RLQP NDRVYFPKWYLKG+R SPT+S +++
Sbjct  1    MATLVDIGVSAGINLFSATMFLLAFAVLRLQPFNDRVYFPKWYLKGIRSSPTNSRSIV  58



>ref|XP_004491137.1| PREDICTED: uncharacterized protein RSN1-like [Cicer arietinum]
Length=766

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DIGLAAAINILTA  FL+AFAI+R+QP+NDRVYFPKWYLKGLR SP   GA +
Sbjct  1    MASLGDIGLAAAINILTAFAFLIAFAILRIQPINDRVYFPKWYLKGLRCSPLQGGAFV  58



>ref|XP_010684236.1| PREDICTED: CSC1-like protein At4g02900 [Beta vulgaris subsp. 
vulgaris]
Length=755

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            + FAI+RLQP+NDRVYFPKWYLKG+R +PTHS  L+
Sbjct  23   IVFAILRLQPINDRVYFPKWYLKGIRATPTHSRGLV  58



>ref|XP_008384098.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=771

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  D+G+ A INIL+ALIF + FA +RLQP+NDRVYFPKWY KGLR+SPT SGA +
Sbjct  1    MATLGDLGVGAGINILSALIFFLVFAFLRLQPLNDRVYFPKWYFKGLRESPTPSGAFV  58



>gb|KHN28986.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            M T +DIG+AAAINI TAL+F VAFAI+RLQP NDRVYFPKWYLKGLR  P H  AL+
Sbjct  1    MTTLSDIGVAAAINISTALLFFVAFAILRLQPWNDRVYFPKWYLKGLRTDPVHGRALV  58



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DIGLAAAINILTA++FL+AFAI+R+QP+NDRVYFPKWY+KGLR SP   GA +
Sbjct  1    MASLGDIGLAAAINILTAIVFLLAFAILRIQPINDRVYFPKWYMKGLRSSPLQGGAFV  58



>ref|XP_003555683.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoformX1 
[Glycine max]
 ref|XP_006605689.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
Length=774

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            M T +DIG+AAAINI TAL+F VAFAI+RLQP NDRVYFPKWYLKGLR  P H  AL+
Sbjct  1    MTTLSDIGVAAAINISTALLFFVAFAILRLQPWNDRVYFPKWYLKGLRTDPVHGRALV  58



>ref|XP_004292602.1| PREDICTED: CSC1-like protein At4g02900 [Fragaria vesca subsp. 
vesca]
Length=759

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            VAFA++RLQP NDRVYFPKWYLKG+R SPT SG ++
Sbjct  23   VAFALLRLQPFNDRVYFPKWYLKGIRGSPTSSGTVV  58



>gb|AAM74515.1| hv711N16.16 [Hordeum vulgare subsp. vulgare]
Length=234

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MAT  DIGL A  NIL A IFL+ FA +RLQP+NDR++FPKWYLKG+RDSP+ +GA
Sbjct  1    MATIYDIGLGAGFNILMATIFLLIFAFLRLQPINDRIFFPKWYLKGMRDSPSSAGA  56



>ref|XP_010449935.1| PREDICTED: CSC1-like protein At4g15430 [Camelina sativa]
Length=185

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>ref|XP_011046979.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046980.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046981.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAIN+L+ALIFL  FAI+RLQP NDRVYFPKWYLKGLR+SP+ S AL+
Sbjct  1    MATLEDIGVSAAINLLSALIFLFLFAILRLQPFNDRVYFPKWYLKGLRNSPSRSRALV  58



>ref|XP_009803475.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
 ref|XP_009803477.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=768

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+A IFL+AFAI+RLQP+NDRVYFPKWYL GLR+  T SGA++
Sbjct  1    MATLGDIGVSAAINILSAFIFLLAFAILRLQPLNDRVYFPKWYLMGLRNGVTQSGAIV  58



>gb|EYU38139.1| hypothetical protein MIMGU_mgv1a022024mg [Erythranthe guttata]
Length=761

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DI  +A IN+L+ L+FL+ FA +RLQP+NDRVYFPKWYLKG+R+SP  SG L+
Sbjct  1    MASLQDIATSAYINLLSVLMFLLGFAFLRLQPINDRVYFPKWYLKGIRESPNKSGTLV  58



>ref|XP_004231619.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010315702.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=765

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIG+AAA+NIL+ALIFL+AFAI+RLQP+NDRVYFPKWYL GLR+ P  SG  +
Sbjct  1    MATLADIGVAAALNILSALIFLLAFAILRLQPLNDRVYFPKWYLVGLRNDPLKSGGFV  58



>ref|XP_006383870.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP61667.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=775

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAIN+L+ALIFL  FAI+RLQP NDRVYFPKWYLKGLR+SP+ S AL+
Sbjct  1    MATLEDIGVSAAINLLSALIFLFLFAILRLQPFNDRVYFPKWYLKGLRNSPSRSRALV  58



>gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=764

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  391  AFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +
Sbjct  16   AFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFV  50



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DIG+ AAINIL+A  F V FA++R+QPVNDRVYFPKWY+KGLR SP  SGA++
Sbjct  1    MASIGDIGVGAAINILSAFAFFVVFALLRIQPVNDRVYFPKWYIKGLRGSPLSSGAIV  58



>ref|XP_002440380.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
 gb|EES18810.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
Length=766

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA+ +DIG+AA  N+LTA+ FL+AFA +RLQP+NDRVYFPKWYL+G+RD+P  SGA
Sbjct  1    MASLSDIGVAAGFNVLTAVAFLLAFAFLRLQPINDRVYFPKWYLRGMRDNPIVSGA  56



>ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=760

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  316  VKMATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            + MA+  DIGLAAAINIL+A  FL+AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G
Sbjct  1    MHMASLGDIGLAAAINILSAFAFLLAFAILRIQPINDRVYFPKWYLKGLRSSPLQAG  57



>ref|XP_006414511.1| hypothetical protein EUTSA_v10024504mg [Eutrema salsugineum]
 gb|ESQ55964.1| hypothetical protein EUTSA_v10024504mg [Eutrema salsugineum]
Length=743

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAIAFLIAFAILRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>ref|XP_004158583.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
Length=768

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DIG+ AAINIL+A  F + FA++R+QPVNDRVYFPKWY+KGLR SP  SGAL+
Sbjct  1    MASIGDIGVGAAINILSAFAFFLVFALLRIQPVNDRVYFPKWYIKGLRGSPMSSGALV  58



>ref|XP_004151944.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DIG+ AAINIL+A  F + FA++R+QPVNDRVYFPKWY+KGLR SP  SGAL+
Sbjct  1    MASIGDIGVGAAINILSAFAFFLVFALLRIQPVNDRVYFPKWYIKGLRGSPMSSGALV  58



>gb|KHN38468.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=758

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MA+  DIGLAAAINIL+A  FL+AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G
Sbjct  1    MASLGDIGLAAAINILSAFAFLLAFAILRIQPINDRVYFPKWYLKGLRSSPLQAG  55



>gb|AFW81356.1| hypothetical protein ZEAMMB73_379943, partial [Zea mays]
Length=731

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA+  DIGLAA +N+LTA+ FL+AFA +RLQP+NDRVYFPKWYL+G+RD+P  SGA
Sbjct  1    MASLGDIGLAAGLNVLTAVAFLLAFAFLRLQPINDRVYFPKWYLRGMRDNPIVSGA  56



>ref|XP_004493651.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004493652.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Cicer 
arietinum]
Length=759

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADIG++A IN+L+A  FL AFA++RLQP NDR+YFPKWYLKG+R SPT+S + +
Sbjct  1    MATLADIGISAGINLLSAFTFLFAFAMLRLQPFNDRIYFPKWYLKGIRSSPTNSRSFV  58



>ref|NP_001147493.1| LOC100281102 [Zea mays]
 gb|ACG27714.1| HYP1 [Zea mays]
Length=768

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA+  DIGLAA +N+LTA+ FL+AFA +RLQP+NDRVYFPKWYL+G+RD+P  SGA
Sbjct  1    MASLGDIGLAAGLNVLTAVAFLLAFAFLRLQPINDRVYFPKWYLRGMRDNPIVSGA  56



>gb|KDP21496.1| hypothetical protein JCGZ_21967 [Jatropha curcas]
Length=755

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHS  483
            MA   DI  +AA+NIL+A  FL+AFAI+RLQP+NDRVYFPKWY KG+R SPTHS
Sbjct  1    MANLQDIVYSAAVNILSAFAFLLAFAILRLQPINDRVYFPKWYRKGIRASPTHS  54



>gb|AFW81357.1| HYP1 isoform 1 [Zea mays]
 gb|AFW81358.1| HYP1 isoform 2 [Zea mays]
Length=768

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA+  DIGLAA +N+LTA+ FL+AFA +RLQP+NDRVYFPKWYL+G+RD+P  SGA
Sbjct  1    MASLGDIGLAAGLNVLTAVAFLLAFAFLRLQPINDRVYFPKWYLRGMRDNPIVSGA  56



>emb|CDY27443.1| BnaC03g64830D [Brassica napus]
Length=775

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++A INIL+A IF V FAI+RLQP NDRVYF KWYLKGLR SPT  GA +
Sbjct  1    MATLVDIGVSAGINILSAFIFFVIFAILRLQPFNDRVYFSKWYLKGLRSSPTRGGAFV  58



>gb|EMT22148.1| Putative membrane protein [Aegilops tauschii]
Length=770

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            +AFAI+R+QP+NDRVYFPKWYLKG R SP H GA
Sbjct  23   LAFAILRIQPINDRVYFPKWYLKGTRSSPRHIGA  56



>dbj|BAK05559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            +AFAI+R+QP+NDRVYFPKWYLKG R SP H GA
Sbjct  23   LAFAILRIQPINDRVYFPKWYLKGTRSSPRHIGA  56



>ref|XP_010539247.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
 ref|XP_010539248.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
Length=771

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++A INILTA IF V FAI+RLQP NDRVYF KWYLK LR SPTH GA +
Sbjct  1    MATLLDIGVSAGINILTAFIFFVVFAILRLQPFNDRVYFSKWYLKRLRSSPTHGGAFV  58



>ref|XP_007141612.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
 gb|ESW13606.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
Length=755

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MA+ +DIGLAAAINIL+A  FL+AFA++R+QP+NDRVYFPKWYLKGLR SP  +G
Sbjct  3    MASLSDIGLAAAINILSAFTFLLAFALLRIQPINDRVYFPKWYLKGLRSSPLQAG  57



>ref|XP_008451393.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X3 [Cucumis melo]
Length=745

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MA   DIG++A IN+L+AL FLVAFA++RLQP+NDRVYFPKWYLKG+R SP  SG
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSG  55



>ref|XP_006350470.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=767

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++AAINIL+ALIFL+AFAI+RLQP+NDRVYFPKWYL GLR+ P  SG  +
Sbjct  1    MATIGDIGVSAAINILSALIFLLAFAILRLQPLNDRVYFPKWYLAGLRNDPLKSGGFV  58



>ref|XP_008451390.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
 ref|XP_008451391.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
Length=761

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MA   DIG++A IN+L+AL FLVAFA++RLQP+NDRVYFPKWYLKG+R SP  SG
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSG  55



>ref|XP_008451392.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Cucumis melo]
Length=759

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MA   DIG++A IN+L+AL FLVAFA++RLQP+NDRVYFPKWYLKG+R SP  SG
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSG  55



>gb|EMS66710.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=743

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            +AFAI+R+QP+NDRVYFPKWYLKG R SP H GA
Sbjct  23   LAFAILRIQPINDRVYFPKWYLKGTRSSPRHIGA  56



>ref|XP_004164564.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
Length=755

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MA   DIG++A IN+L+AL FLVAFA++RLQP+NDRVYFPKWYLKG+R SP  SG
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSG  55



>ref|XP_004136187.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN44866.1| hypothetical protein Csa_7G392390 [Cucumis sativus]
Length=756

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MA   DIG++A IN+L+AL FLVAFA++RLQP+NDRVYFPKWYLKG+R SP  SG
Sbjct  1    MANLQDIGVSATINLLSALAFLVAFALLRLQPINDRVYFPKWYLKGIRGSPRRSG  55



>ref|XP_006352784.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=766

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DI ++A IN+++AL+FL+AFAI RLQP+NDRVYFPKWYLKG+R SP  SG+ +
Sbjct  1    MASVQDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGSFV  58



>gb|EPS71707.1| hypothetical protein M569_03051, partial [Genlisea aurea]
Length=744

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DI  AA IN+++ L FL+AFA +RLQP+NDRVYFPKWYLKG R SP  SG L+
Sbjct  1    MASLTDITAAAYINLVSILTFLLAFAFLRLQPINDRVYFPKWYLKGTRGSPKGSGVLV  58



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT ADI +AA+INIL+A  F VAFAI+R+QP+NDRVYFPKWYLKGLR SP  SGA +
Sbjct  1    MATIADISVAASINILSAFAFFVAFAILRIQPINDRVYFPKWYLKGLRSSPLQSGAFV  58



>ref|XP_010323041.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Solanum lycopersicum]
Length=688

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA+  DI ++A IN+++AL+FL+AFAI RLQP+NDRVYFPKWYLKG+R SP  SG+
Sbjct  1    MASVKDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGS  56



>ref|XP_004242328.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Solanum lycopersicum]
Length=766

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA+  DI ++A IN+++AL+FL+AFAI RLQP+NDRVYFPKWYLKG+R SP  SG+
Sbjct  1    MASVKDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGS  56



>ref|XP_003569103.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Brachypodium 
distachyon]
Length=768

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MAT  DIG+AA  NI+TA+ FL+AFA +RLQP+NDRVYFPKWYL+G+R+SP+ +G
Sbjct  1    MATVDDIGVAATFNIVTAIAFLLAFAFLRLQPINDRVYFPKWYLRGMRESPSSAG  55



>ref|XP_010323040.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Solanum lycopersicum]
Length=704

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA+  DI ++A IN+++AL+FL+AFAI RLQP+NDRVYFPKWYLKG+R SP  SG+
Sbjct  1    MASVKDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGS  56



>ref|XP_009356857.1| PREDICTED: CSC1-like protein At4g02900 [Pyrus x bretschneideri]
Length=757

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA F DI ++AAINIL+A  FL AF ++R+QPV DRVYFPKWYLKG+R SPT SGA
Sbjct  1    MANFQDIMMSAAINILSAFGFLAAFGLLRVQPVIDRVYFPKWYLKGMRGSPTSSGA  56



>ref|XP_003542161.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
 gb|KHN42234.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            M T +DIG+AAAINI +AL+F VAFAI+RLQP NDRVYFPKWYLKGLR  P H   L+
Sbjct  1    MTTLSDIGVAAAINISSALLFFVAFAILRLQPWNDRVYFPKWYLKGLRTDPVHGRPLV  58



>ref|XP_008803557.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Phoenix dactylifera]
Length=767

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  400  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            ++RLQP+NDRVYFPKWYLKG+R SPTHSG  +
Sbjct  27   VLRLQPINDRVYFPKWYLKGVRSSPTHSGTFV  58



>gb|KJB42871.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=788

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MAT  DIG+AAAINILTAL F +AFA++R+QPVNDRVYFPKWY+KGLR SP  +G+
Sbjct  1    MATLNDIGVAAAINILTALAFFLAFAMLRIQPVNDRVYFPKWYIKGLRSSPLVNGS  56



>ref|NP_001291223.1| calcium permeable stress-gated cation channel 1 [Populus euphratica]
 gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica]
Length=772

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI ++ AIN+L+A IFL+AFA++R+QP NDRVYFPKWY KGLR S + SGA +
Sbjct  1    MATLGDIAVSGAINLLSAFIFLLAFAVLRIQPFNDRVYFPKWYFKGLRSSASRSGAFV  58



>gb|KJB42870.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=768

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MAT  DIG+AAAINILTAL F +AFA++R+QPVNDRVYFPKWY+KGLR SP  +G+
Sbjct  1    MATLNDIGVAAAINILTALAFFLAFAMLRIQPVNDRVYFPKWYIKGLRSSPLVNGS  56



>ref|XP_011002577.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Populus 
euphratica]
Length=772

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DI ++ AIN+L+A IFL+AFA++R+QP NDRVYFPKWY KGLR S + SGA +
Sbjct  1    MATLGDIAVSGAINLLSAFIFLLAFAVLRIQPFNDRVYFPKWYFKGLRSSASRSGAFV  58



>emb|CAB10322.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78585.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>ref|XP_010522697.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Tarenaya hassleriana]
Length=785

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHS  483
            MA+  DIG++AAIN+L+A  FL+AFAI+RLQPVNDRVYFPKWYLKG+R SP  S
Sbjct  1    MASLQDIGISAAINLLSACAFLIAFAILRLQPVNDRVYFPKWYLKGIRGSPRRS  54



>ref|XP_010522696.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Tarenaya hassleriana]
Length=800

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHS  483
            MA+  DIG++AAIN+L+A  FL+AFAI+RLQPVNDRVYFPKWYLKG+R SP  S
Sbjct  1    MASLQDIGISAAINLLSACAFLIAFAILRLQPVNDRVYFPKWYLKGIRGSPRRS  54



>ref|XP_010522695.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Tarenaya hassleriana]
Length=803

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHS  483
            MA+  DIG++AAIN+L+A  FL+AFAI+RLQPVNDRVYFPKWYLKG+R SP  S
Sbjct  1    MASLQDIGISAAINLLSACAFLIAFAILRLQPVNDRVYFPKWYLKGIRGSPRRS  54



>ref|XP_010449936.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TAL FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTALAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>ref|XP_010449938.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>ref|XP_009418442.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+ +DIGL+AAIN L+AL FLVAFA++RLQP+NDRVYF KWYLK +R SPT SG  +
Sbjct  1    MASISDIGLSAAINFLSALAFLVAFAVLRLQPINDRVYFSKWYLKRIRSSPTRSGTFV  58



>ref|XP_010434983.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>ref|XP_010434984.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>emb|CDX79125.1| BnaA01g11920D [Brassica napus]
Length=695

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG++A INIL+A IF + FA++RLQP NDRVYF KWYLKGLR SP+  GA +
Sbjct  1    MATLSDIGVSAGINILSAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFV  58



>ref|NP_001154237.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AEE83603.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34618.1| hyperosmolality-gated Ca2+ permeable channel 1.6 [Arabidopsis 
thaliana]
Length=760

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>ref|NP_193278.4| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q8VZM5.1|CSCL3_ARATH RecName: Full=CSC1-like protein At4g15430 [Arabidopsis thaliana]
 gb|AAL36364.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83602.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
Length=761

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>dbj|BAJ96091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            + FA++R+QP+NDRVYFPKWYLKG R SP H G +L
Sbjct  23   LVFAVVRIQPINDRVYFPKWYLKGTRSSPRHIGTVL  58



>emb|CDX82907.1| BnaC01g13570D [Brassica napus]
Length=768

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG++A INIL+A IF + FA++RLQP NDRVYF KWYLKGLR SP+  GA +
Sbjct  1    MATLSDIGVSAGINILSAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFV  58



>gb|KHN19872.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=716

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MAT  DI ++A+IN+L+AL FL AF I+RLQP NDRVYFPKWYLKG+R SPT S 
Sbjct  1    MATIGDICVSASINLLSALAFLFAFGILRLQPFNDRVYFPKWYLKGIRGSPTGSN  55



>ref|XP_009107840.1| PREDICTED: CSC1-like protein At4g15430 [Brassica rapa]
 emb|CDY22738.1| BnaA08g05680D [Brassica napus]
Length=755

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            +AFAI+R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  23   IAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGF  57



>emb|CDY09064.1| BnaC08g10180D [Brassica napus]
Length=761

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            +AFAI+R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  23   IAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGF  57



>ref|XP_009135587.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brassica 
rapa]
Length=768

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG++A INIL+A IF + FA++RLQP NDRVYF KWYLKGLR SP+  GA +
Sbjct  1    MATLSDIGVSAGINILSAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFV  58



>ref|XP_003520558.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=756

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MAT  DI ++A+IN+L+AL FL AF I+RLQP NDRVYFPKWYLKG+R SPT S 
Sbjct  1    MATIGDICVSASINLLSALAFLFAFGILRLQPFNDRVYFPKWYLKGIRGSPTGSN  55



>gb|KHG10946.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=740

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            VAFAI+RLQP+NDRVYFPKWY +G+R+SP  SG 
Sbjct  23   VAFAILRLQPINDRVYFPKWYRRGIRNSPRRSGV  56



>gb|EMT11783.1| Putative membrane protein [Aegilops tauschii]
Length=792

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            + FA++R+QP+NDRVYFPKWYLKG R SP H G +L
Sbjct  23   LVFAVVRIQPINDRVYFPKWYLKGTRSSPRHIGNVL  58



>ref|XP_009147369.1| PREDICTED: CSC1-like protein At4g15430 isoform X3 [Brassica rapa]
Length=756

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MA+  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGF  57



>gb|EPS71959.1| hypothetical protein M569_02795, partial [Genlisea aurea]
Length=761

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSP  474
            MAT  DIG+AA INIL+A+ FL+AFA++RLQP NDRVYFPKWYLKGLR SP
Sbjct  1    MATLEDIGVAAGINILSAVAFLIAFAVLRLQPFNDRVYFPKWYLKGLRGSP  51



>ref|XP_006654360.1| PREDICTED: uncharacterized protein C354.08c-like [Oryza brachyantha]
Length=767

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            +AFA++R+QP+NDRVYFPKWYLKG R SP H G
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRHLG  55



>gb|EMS63788.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=792

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            + FA++R+QP+NDRVYFPKWYLKG R SP H G +L
Sbjct  23   LVFAVVRIQPINDRVYFPKWYLKGTRSSPRHIGNVL  58



>ref|XP_009147329.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147337.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147346.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147353.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
Length=762

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MA+  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGF  57



>ref|XP_009147362.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Brassica rapa]
Length=761

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MA+  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGF  57



>ref|XP_006355875.1| PREDICTED: uncharacterized protein C354.08c-like [Solanum tuberosum]
Length=751

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DI L+A +N+L+A  FLVAFAI+RLQP+NDRVYF KWYLKG+R SP  SG  +
Sbjct  1    MASSEDIILSAVLNLLSAFAFLVAFAILRLQPINDRVYFSKWYLKGIRASPRSSGTFV  58



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MAT +DIG+AAAINIL+A  F + FAI+R+QP NDRVYFPKWYL+GLR SP  S A
Sbjct  1    MATLSDIGVAAAINILSAFAFFIVFAIVRIQPFNDRVYFPKWYLRGLRCSPLRSDA  56



>ref|XP_009771290.1| PREDICTED: CSC1-like protein At4g02900, partial [Nicotiana sylvestris]
Length=654

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            VAFAI+RLQP NDRVYF KWYLKG+R SP  SGA +
Sbjct  23   VAFAILRLQPFNDRVYFSKWYLKGIRASPRSSGAFV  58



>ref|XP_009625807.1| PREDICTED: CSC1-like protein At4g02900 [Nicotiana tomentosiformis]
 ref|XP_009625808.1| PREDICTED: CSC1-like protein At4g02900 [Nicotiana tomentosiformis]
Length=750

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            VAFAI+RLQP NDRVYF KWYLKG+R SP  SGA +
Sbjct  23   VAFAILRLQPFNDRVYFSKWYLKGIRASPRSSGAFV  58



>ref|XP_006283166.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
 gb|EOA16064.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
Length=771

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG++A INIL+A++F + FA++RLQP NDRVYF KWYLKGLR SP+  GA 
Sbjct  1    MATLQDIGVSAGINILSAVVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAF  57



>emb|CDY49293.1| BnaC01g22480D [Brassica napus]
Length=756

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            +AFAI+R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  23   LAFAILRIQPVNDRVYFPKWYLKGLRSSSIQTGGF  57



>ref|XP_006854105.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
 gb|ERN15572.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
Length=760

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MAT  DIG++A INIL+A  FL+AFA++R+QPVNDRVYF KWYL G R SP HSG
Sbjct  1    MATLEDIGVSALINILSAFAFLLAFAVLRIQPVNDRVYFSKWYLSGSRRSPRHSG  55



>ref|XP_010448929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448930.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448931.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448932.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448933.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448934.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MAT  DIG++A INIL+A +F + FA++RLQP+NDRVYF KWYLKGLR SP   GA
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPLNDRVYFSKWYLKGLRSSPARGGA  56



>ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Solanum lycopersicum]
Length=751

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DI L+A +N+L+A  FLVAFAI+RLQP+NDRVYF KWYLKG+R SP  SG  +
Sbjct  1    MASSEDIILSAVLNLLSAFAFLVAFAILRLQPMNDRVYFSKWYLKGIRASPRTSGTFM  58



>ref|XP_002867790.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44049.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG++A INIL+A +F + FAI+RLQP NDRVYF KWYLKGLR SP   GA 
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAILRLQPFNDRVYFSKWYLKGLRSSPARGGAF  57



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  406  RLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            RLQP NDRVYFPKWYLKG+RDSPT SGA +
Sbjct  29   RLQPFNDRVYFPKWYLKGVRDSPTRSGAFV  58



>emb|CDY22920.1| BnaA01g18580D [Brassica napus]
Length=756

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            +AFAI+R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  23   LAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGF  57



>ref|XP_010440309.1| PREDICTED: CSC1-like protein At4g15430 [Camelina sativa]
Length=762

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWY KGLR S   +G  
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYFKGLRSSSIQTGGF  57



>gb|KHG17938.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=756

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGA  489
            MA+  DI  +A+IN+L+A  FL+AFAI+R+QP NDRVYFP+WY KG R SPT SGA
Sbjct  1    MASLRDIVTSASINLLSAFGFLMAFAILRIQPFNDRVYFPRWYKKGTRSSPTRSGA  56



>ref|XP_006285697.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
 gb|EOA18595.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
Length=763

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MA+  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G  
Sbjct  1    MASINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRTSSIQTGGF  57



>emb|CAA18115.1| putative protein [Arabidopsis thaliana]
 emb|CAB79167.1| putative protein [Arabidopsis thaliana]
Length=697

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKGLR SP   GA 
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAF  57



>dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana]
Length=771

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKGLR SP   GA 
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAF  57



>ref|XP_010439363.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439364.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439365.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
Length=771

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKGLR SP   GA 
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAF  57



>ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q5XEZ5.1|CSC1_ARATH RecName: Full=Calcium permeable stress-gated cation channel 1; 
Short=AtCSC1 [Arabidopsis thaliana]
 gb|AAU94384.1| At4g22120 [Arabidopsis thaliana]
 gb|AAW50707.1| At4g22120 [Arabidopsis thaliana]
 gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34614.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Arabidopsis 
thaliana]
Length=771

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKGLR SP   GA 
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAF  57



>emb|CDY48898.1| BnaA03g36370D [Brassica napus]
Length=756

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT +DIG+AAAINILTA  F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G L
Sbjct  1    MATLSDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGL  57



>gb|EPS74192.1| hypothetical protein M569_00556, partial [Genlisea aurea]
Length=761

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MA+  DI  +AAIN+L+AL FL+AFA +RLQP+NDRVYFPKWY KG+R SP  SG L+
Sbjct  1    MASLQDITASAAINLLSALAFLMAFAFLRLQPLNDRVYFPKWYKKGIRASPRSSGHLV  58



>ref|XP_003568506.1| PREDICTED: CSC1-like protein At4g02900 [Brachypodium distachyon]
Length=767

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            +AFA++R+QP+NDRVYFPKWYLKG R SP   G +L
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRSIGTVL  58



>ref|XP_009135761.1| PREDICTED: CSC1-like protein At3g21620 [Brassica rapa]
Length=756

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT +DIG+AAAINILTA  F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G L
Sbjct  1    MATLSDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGL  57



>emb|CDY32438.1| BnaC03g42220D [Brassica napus]
Length=756

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT +DIG+AAAINILTA  F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G L
Sbjct  1    MATLSDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGL  57



>ref|XP_006304000.1| hypothetical protein CARUB_v10011444mg [Capsella rubella]
 gb|EOA36898.1| hypothetical protein CARUB_v10011444mg [Capsella rubella]
Length=808

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++A IN+  A +FL+AFA++R+QP+NDRVYFPKWYL G R+SP  S   L
Sbjct  1    MATLQDIGVSALINLFGAFMFLIAFAVLRIQPINDRVYFPKWYLSGERNSPRRSDGTL  58



>ref|XP_010499754.1| PREDICTED: CSC1-like protein At1g32090 [Camelina sativa]
Length=814

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++A IN+  A +FL+AFA++R+QP+NDRVYFPKWYL G R+SP  S   L
Sbjct  1    MATLQDIGVSALINLFGAFLFLIAFAVLRIQPINDRVYFPKWYLSGERNSPRRSDGTL  58



>ref|XP_010461028.1| PREDICTED: CSC1-like protein At1g32090 [Camelina sativa]
Length=815

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++A IN+  A +FL+AFA++R+QP+NDRVYFPKWYL G R+SP  S   L
Sbjct  1    MATLQDIGVSALINLFGAFLFLIAFAVLRIQPINDRVYFPKWYLSGERNSPRRSDGTL  58



>gb|KFK44972.1| hypothetical protein AALP_AA1G327200 [Arabis alpina]
Length=800

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTH  480
            MAT  DIG++A IN+  A +FL+AFA++R+QP+NDRVYFPKWYL G R+SP H
Sbjct  1    MATLQDIGVSALINLFGAFLFLIAFALLRIQPINDRVYFPKWYLSGDRNSPRH  53



>ref|XP_010478627.1| PREDICTED: CSC1-like protein At1g32090 [Camelina sativa]
Length=815

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG++A IN+  A +FL+AFA++R+QP+NDRVYFPKWYL G R+SP  S   L
Sbjct  1    MATLQDIGVSALINLFGAFLFLIAFAVLRIQPINDRVYFPKWYLSGERNSPRRSDGTL  58



>ref|XP_010434078.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKG+R SP   GA 
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGIRSSPARGGAF  57



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AAAINIL+A  F +AFAI+R+QPVNDRVYFPKWYLKGLR SP  +GA +
Sbjct  1    MATLSDIGVAAAINILSAFAFFLAFAILRIQPVNDRVYFPKWYLKGLRCSPLANGAFV  58



>ref|XP_009134294.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134295.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134297.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
Length=768

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AA INI+TA IF + FA++RLQP NDRVYF KWYLKGLR SP   G L
Sbjct  1    MATLKDIGVAAGINIVTAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPASGGFL  57



>ref|XP_007210357.1| hypothetical protein PRUPE_ppa001580mg [Prunus persica]
 gb|EMJ11556.1| hypothetical protein PRUPE_ppa001580mg [Prunus persica]
Length=799

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSG  486
            MAT +DIG++A INIL+A+ FL+AFA +R+QPVNDRVYFPKWY+ G R SP  SG
Sbjct  1    MATLSDIGVSALINILSAIAFLLAFAFLRIQPVNDRVYFPKWYINGSRSSPRGSG  55



>emb|CDY21297.1| BnaC03g29810D [Brassica napus]
Length=768

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AA INI+TA IF + FA++RLQP NDRVYF KWYLKGLR SP   G L
Sbjct  1    MATLKDIGVAAGINIVTAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPASGGFL  57



>emb|CDX90856.1| BnaA03g25360D [Brassica napus]
Length=768

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DIG+AA INI+TA IF + FA++RLQP NDRVYF KWYLKGLR SP   G L
Sbjct  1    MATLKDIGVAAGINIVTAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPASGGFL  57



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT  DIG+AAAINIL+A  F +AFAI+R+QPVNDRVYFPKWYLKGLR SP  +GA +
Sbjct  1    MATLNDIGVAAAINILSAFAFFLAFAILRIQPVNDRVYFPKWYLKGLRSSPLANGAFV  58



>ref|XP_007145950.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
 gb|ESW17944.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
Length=773

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            M T +DIG+AAAINI +AL+F +AFAI+RLQP NDRVYFPKWYLKGLR  P    A +
Sbjct  1    MTTLSDIGVAAAINISSALLFFLAFAILRLQPWNDRVYFPKWYLKGLRTDPIQGRAFV  58



>ref|XP_002301612.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE80885.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=763

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AAAINILTA  F  AFAI+R+QPVNDRVYFPKWY+KGLR SP  +GA +
Sbjct  1    MATLSDIGVAAAINILTAFAFFFAFAILRIQPVNDRVYFPKWYIKGLRSSPFGTGAFV  58



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            MAT +DIG+AAAINILTA  F  AFAI+R+QPVNDRVYFPKWY+KGLR SP  +GA +
Sbjct  1    MATLSDIGVAAAINILTAFAFFFAFAILRIQPVNDRVYFPKWYIKGLRSSPFGTGAFV  58



>ref|XP_009765629.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765630.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  400  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            I+RLQP+NDRVYFPKWYLKG+R SP  SGA 
Sbjct  27   IVRLQPINDRVYFPKWYLKGIRASPRSSGAF  57



>ref|XP_003553451.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Glycine 
max]
 gb|KHN45373.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=756

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  322  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGAL  492
            MAT  DI ++A+IN+L+AL FL+AF I+RLQP NDRVYFPKWYLKG+R SPT S A+
Sbjct  1    MATIGDICVSASINLLSALAFLLAFGILRLQPFNDRVYFPKWYLKGIRGSPTGSNAV  57



>ref|NP_001055457.1| Os05g0393800 [Oryza sativa Japonica Group]
 gb|AAT93895.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17371.1| Os05g0393800 [Oryza sativa Japonica Group]
 dbj|BAG91241.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34630.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Oryza sativa]
Length=767

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  388  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  495
            +AFA++R+QP+NDRVYFPKWYLKG R SP   G + 
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRSMGTVF  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190